Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0K08822g45144420980.0
Sklu_2248.43623129651e-128
YMR010W4053079681e-128
Kwal_55.208073433368881e-117
KLLA0D14509g3603038281e-108
Scas_717.243793537646e-98
ADR022W3573127243e-92
Sklu_1971.229090950.001
Kwal_55.2153829495920.002
YDR352W317111910.003
Scas_658.15311110910.003
CAGL0A02508g316172860.014
KLLA0E21736g31984840.023
Kwal_47.1663843377760.25
Scas_628.230549710.85
Kwal_27.120778626651.0
ADL239C89198711.2
ACL106C27350672.4
CAGL0L12892g32946663.7
AFR605C31552654.3
YBR147W29648654.8
Scas_518.331052645.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0K08822g
         (444 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0K08822g 884170..885525 similar to sp|Q03687 Saccharomyces c...   812   0.0  
Sklu_2248.4 YMR010W, Contig c2248 8114-9202                           376   e-128
YMR010W (YMR010W) [3974] chr13 (285099..286316) Protein possibly...   377   e-128
Kwal_55.20807                                                         346   e-117
KLLA0D14509g 1230053..1231135 similar to sp|Q03687 Saccharomyces...   323   e-108
Scas_717.24                                                           298   6e-98
ADR022W [1763] [Homologous to ScYMR010W - SH] complement(744266....   283   3e-92
Sklu_1971.2 YDR352W, Contig c1971 2812-3684                            41   0.001
Kwal_55.21538                                                          40   0.002
YDR352W (YDR352W) [1179] chr4 (1181790..1182743) Protein contain...    40   0.003
Scas_658.15                                                            40   0.003
CAGL0A02508g 264398..265348 similar to tr|Q06328 Saccharomyces c...    38   0.014
KLLA0E21736g complement(1931058..1932017) similar to sgd|S000276...    37   0.023
Kwal_47.16638                                                          34   0.25 
Scas_628.2                                                             32   0.85 
Kwal_27.12077                                                          30   1.0  
ADL239C [1502] [Homologous to ScYIL109C (SEC24) - SH; ScYNL049C ...    32   1.2  
ACL106C [943] [Homologous to ScYDR352W - SH] (153775..154596) [8...    30   2.4  
CAGL0L12892g 1375491..1376480 similar to sp|P35735 Saccharomyces...    30   3.7  
AFR605C [3797] [Homologous to ScYOL092W - SH; ScYBR147W - SH] (1...    30   4.3  
YBR147W (YBR147W) [332] chr2 (536531..537421) Protein containing...    30   4.8  
Scas_518.3                                                             29   5.9  

>CAGL0K08822g 884170..885525 similar to sp|Q03687 Saccharomyces
           cerevisiae YMR010w, hypothetical start
          Length = 451

 Score =  812 bits (2098), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/444 (89%), Positives = 399/444 (89%)

Query: 1   MDGAELIQEHXXXXXXXXXXXXXXXXKNQDSYVVTLTSYLPKLDQFYIPEWLTMRVLTGY 60
           MDGAELIQEH                KNQDSYVVTLTSYLPKLDQFYIPEWLTMRVLTGY
Sbjct: 1   MDGAELIQEHELAAVEQIAEAAAESAKNQDSYVVTLTSYLPKLDQFYIPEWLTMRVLTGY 60

Query: 61  IYSCTPLFSYGAAILSIERCQTAFGFSIDICATMLIASILRISYFFFVPYEVTLLRQSII 120
           IYSCTPLFSYGAAILSIERCQTAFGFSIDICATMLIASILRISYFFFVPYEVTLLRQSII
Sbjct: 61  IYSCTPLFSYGAAILSIERCQTAFGFSIDICATMLIASILRISYFFFVPYEVTLLRQSII 120

Query: 121 MXXXXXXXXXXXXKYRPEEYKYDNLQSVEPFTQLIHDVWFEYFAIRNKPRMFSDEWKNLL 180
           M            KYRPEEYKYDNLQSVEPFTQLIHDVWFEYFAIRNKPRMFSDEWKNLL
Sbjct: 121 MVLVQLLLLRTTLKYRPEEYKYDNLQSVEPFTQLIHDVWFEYFAIRNKPRMFSDEWKNLL 180

Query: 181 RSLSFERLMGXXXXXXXXXXXXXXXXXDPSFKRVGSFWQWNDDRKYWKFLIIFATFQFSF 240
           RSLSFERLMG                 DPSFKRVGSFWQWNDDRKYWKFLIIFATFQFSF
Sbjct: 181 RSLSFERLMGFIFKIFLVFVYKFLKFFDPSFKRVGSFWQWNDDRKYWKFLIIFATFQFSF 240

Query: 241 TLLITKVIAWENFAHNVGSLIGGISLLVESLLPLPQISILHKLKSVQGFKIILLISWLCG 300
           TLLITKVIAWENFAHNVGSLIGGISLLVESLLPLPQISILHKLKSVQGFKIILLISWLCG
Sbjct: 241 TLLITKVIAWENFAHNVGSLIGGISLLVESLLPLPQISILHKLKSVQGFKIILLISWLCG 300

Query: 301 DTVKLSFLLSLNSGEKNVDTSSLFEFFALFQMGLDFYIGGQYIYYKFYYNPEGTVVNGYR 360
           DTVKLSFLLSLNSGEKNVDTSSLFEFFALFQMGLDFYIGGQYIYYKFYYNPEGTVVNGYR
Sbjct: 301 DTVKLSFLLSLNSGEKNVDTSSLFEFFALFQMGLDFYIGGQYIYYKFYYNPEGTVVNGYR 360

Query: 361 GTPVIGGSQDHEFMELQNEFADGPLNELNEKAFNGKEHRSNSTPKRKLSYSQHLSKTPSS 420
           GTPVIGGSQDHEFMELQNEFADGPLNELNEKAFNGKEHRSNSTPKRKLSYSQHLSKTPSS
Sbjct: 361 GTPVIGGSQDHEFMELQNEFADGPLNELNEKAFNGKEHRSNSTPKRKLSYSQHLSKTPSS 420

Query: 421 SRKASIGNIEVSSPRRGHSKSYTF 444
           SRKASIGNIEVSSPRRGHSKSYTF
Sbjct: 421 SRKASIGNIEVSSPRRGHSKSYTF 444

>Sklu_2248.4 YMR010W, Contig c2248 8114-9202
          Length = 362

 Score =  376 bits (965), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 182/312 (58%), Positives = 227/312 (72%), Gaps = 9/312 (2%)

Query: 38  SYLPKLDQFYIPEWLTMRVLTGYIYSCTPLFSYGAAILSIERCQTAFGFSIDICATMLIA 97
           SYLP++DQFYIPEWLTM+ +   + S TPLFSYG  +LSIER +TA GFSIDICATML+A
Sbjct: 27  SYLPRVDQFYIPEWLTMQFIANNLISFTPLFSYGTTVLSIERSKTALGFSIDICATMLLA 86

Query: 98  SILRISYFFFVPYEVTLLRQSIIMXXXXXXXXXXXXKYRPEEYKYDNLQSVEPFTQLIHD 157
           SILR+SY+   PYE+TLLRQS++M             YRPEEYKYDNL +VEPFTQL+ D
Sbjct: 87  SILRVSYYIITPYELTLLRQSLVMIVIQLLLLRTSLYYRPEEYKYDNLTTVEPFTQLLQD 146

Query: 158 VWFEYFAIRNKPRMFSDEWKNLLRSLSFERLMGXXXXXXXXXXXXXXXXXDPSFKRVGSF 217
           VW EYF +      F  +W+  L+SLS++ ++                  DPSFKR  SF
Sbjct: 147 VWLEYFPLNP----FGTQWRETLKSLSYKNMLRFVCKVLLIFVYKFLKFFDPSFKRFKSF 202

Query: 218 WQWNDDRKYWKFLIIFATFQFSFTLLITKVIAWENFAHNVGSLIGGISLLVESLLPLPQI 277
           WQWND+ KYWKFL++F+T Q  FT+LI+K+I W   A  +GS+IG + LL+E+LLPLPQI
Sbjct: 203 WQWNDESKYWKFLVVFSTGQLCFTVLISKIIHWNELAQWIGSMIGALGLLIEALLPLPQI 262

Query: 278 SILHKLKSVQGFKIILLISWLCGDTVKLSFLLSLNSGEKNVDTSSLFEFFALFQMGLDFY 337
           SIL+KLK+VQGFK++LL+SWLCGD +K+S+L+    G KN+  S LF FFALFQM LD Y
Sbjct: 263 SILYKLKTVQGFKLVLLVSWLCGDVLKISYLV---FGAKNI--SVLFLFFALFQMSLDIY 317

Query: 338 IGGQYIYYKFYY 349
           IGGQYIYYKFYY
Sbjct: 318 IGGQYIYYKFYY 329

>YMR010W (YMR010W) [3974] chr13 (285099..286316) Protein possibly
           required for full induction of IME1 during early meiosis
           [1218 bp, 405 aa]
          Length = 405

 Score =  377 bits (968), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 177/307 (57%), Positives = 227/307 (73%), Gaps = 5/307 (1%)

Query: 35  TLTSYLPKLDQFYIPEWLTMRVLTGYIYSCTPLFSYGAAILSIERCQTAFGFSIDICATM 94
           TL SYLPK+DQFYIPEWLTM+ +   + S TPLFSYG  I+SIE+C+TA GFSIDICATM
Sbjct: 30  TLYSYLPKVDQFYIPEWLTMQFIANNLISFTPLFSYGTTIISIEKCKTALGFSIDICATM 89

Query: 95  LIASILRISYFFFVPYEVTLLRQSIIMXXXXXXXXXXXXKYRPEEYKYDNLQSVEPFTQL 154
           LIASILRISY+   PYE+TLLRQS++M            KYRP+EYKY NL  VE  + L
Sbjct: 90  LIASILRISYYLITPYEITLLRQSLVMIFIQLILLRTSLKYRPDEYKYQNLTDVESLSHL 149

Query: 155 IHDVWFEYFAIRNKPRMFSDEWKNLLRSLSFERLMGXXXXXXXXXXXXXXXXXDPSFKRV 214
           IHD+WFE+F+  N+P+  S++WKNL++SLSF  L+                  DP+FKR+
Sbjct: 150 IHDIWFEFFSCINRPKFLSEDWKNLIKSLSFTNLLKFSFKIFLAFFYKILKFFDPNFKRI 209

Query: 215 GSFWQWNDDRKYWKFLIIFATFQFSFTLLITKVIAWENFAHNVGSLIGGISLLVESLLPL 274
           G+FWQW+DD+ +W+FL +FAT Q   T  I+ ++ W++ A  +GS+IG + LLVESLLPL
Sbjct: 210 GAFWQWDDDKNFWRFLALFATVQILVTFFISNILNWDSLAQGLGSIIGSLGLLVESLLPL 269

Query: 275 PQISILHKLKSVQGFKIILLISWLCGDTVKLSFLLSLNSGEKNVDTSSLFEFFALFQMGL 334
           PQI+IL+KLKSVQGFK+ILL+SWLCGDT+K+++L+    G KN+  S+LF  FALFQM L
Sbjct: 270 PQIAILYKLKSVQGFKLILLVSWLCGDTLKITYLI---FGAKNI--SALFVIFALFQMSL 324

Query: 335 DFYIGGQ 341
           DFYIGGQ
Sbjct: 325 DFYIGGQ 331

>Kwal_55.20807
          Length = 343

 Score =  346 bits (888), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 169/336 (50%), Positives = 228/336 (67%), Gaps = 10/336 (2%)

Query: 38  SYLPKLDQFYIPEWLTMRVLTGYIYSCTPLFSYGAAILSIERCQTAFGFSIDICATMLIA 97
           SY P++DQFYIPEWLTM+ +   + S TPL SYG  +LSI + +TA GFS+DICATML+A
Sbjct: 17  SYFPRIDQFYIPEWLTMQFVLNNMISFTPLLSYGTTVLSIRKSKTALGFSLDICATMLLA 76

Query: 98  SILRISYFFFVPYEVTLLRQSIIMXXXXXXXXXXXXKYRPEEYKYDNLQSVEPFTQLIHD 157
           SILRISY+   PY++TLLRQS++M             YRPE+YKY+NL+ VEP TQL+HD
Sbjct: 77  SILRISYYLITPYDITLLRQSLVMIFIQLILLRTSLHYRPEQYKYENLEPVEPLTQLLHD 136

Query: 158 VWFEYFAIRNKPRMFSDEWKNLLRSLSFERLMGXXXXXXXXXXXXXXXXXDPSFKRVGSF 217
           VW EYF +      F  +W++L++SLS++  +                  DPS++R  SF
Sbjct: 137 VWLEYFPLNP----FGSDWRHLIKSLSYKGFLDFTYKIVLVLIYKFLKFFDPSYRRFRSF 192

Query: 218 WQWNDDRKYWKFLIIFATFQFSFTLLITKVIAWENFAHNVGSLIGGISLLVESLLPLPQI 277
           WQW+ D K+W FL  FAT Q + TL ++K++ WE+F+  +GS+IG + LL+ESLLPLPQI
Sbjct: 193 WQWDQDSKFWIFLAYFATAQITITLFVSKIMNWESFSQWIGSVIGSLGLLIESLLPLPQI 252

Query: 278 SILHKLKSVQGFKIILLISWLCGDTVKLSFLLSLNSGEKNVDTSSLFEFFALFQMGLDFY 337
           SIL+KLKS QGFK+ILL+SWLCGD VK+S+L+    G  N+  S+LF FFA+FQM LD Y
Sbjct: 253 SILNKLKSTQGFKLILLVSWLCGDVVKISYLI---FGANNI--SALFLFFAMFQMSLDIY 307

Query: 338 IGGQYIYYKFYY-NPEGTVVNGYRGTPVIGGSQDHE 372
           I  QY+YY+FYY +P     + Y    +  G   ++
Sbjct: 308 IACQYVYYRFYYLDPAVVAPDEYEMDSIRSGPTQNK 343

>KLLA0D14509g 1230053..1231135 similar to sp|Q03687 Saccharomyces
           cerevisiae YMR010w singleton, start by similarity
          Length = 360

 Score =  323 bits (828), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 161/303 (53%), Positives = 208/303 (68%), Gaps = 6/303 (1%)

Query: 39  YLPKLDQFYIPEWLTMRVLTGYIYSCTPLFSYGAAILSIERCQTAFGFSIDICATMLIAS 98
           Y  K+DQFYIPEWLTM+ +   + S TPLFSYG  +L+I + QT+ GFS+DICATMLIAS
Sbjct: 23  YFSKIDQFYIPEWLTMQFVANNLISFTPLFSYGTTVLAIHKSQTSLGFSLDICATMLIAS 82

Query: 99  ILRISYFFFVPYEVTLLRQSIIMXXXXXXXXXXXXKYRPEEYKYDNLQSVEPFTQLIHDV 158
           ILR+SY+   PYE+TLLRQSI+M             YRPE+ KY+NL+ VE  ++L+ DV
Sbjct: 83  ILRVSYYLITPYEITLLRQSIVMILIQLILLKVALNYRPEDAKYENLEPVETLSELLQDV 142

Query: 159 WFEYFAIRNKPRMFSDEWKNLLRSLSFERLMGXXXXXXXXXXXXXXXXXDPSFKRVGSFW 218
           W +YF   N   ++S +WK LL+SLS++ L+G                 DPSFKR   FW
Sbjct: 143 WEQYFP-ANPFDVYSTDWKPLLKSLSWKNLLGFGYKIVLVCVYKFLKFFDPSFKRFKGFW 201

Query: 219 QWNDDRKYWKFLIIFATFQFSFTLLITKVIAWENFAHNVGSLIGGISLLVESLLPLPQIS 278
           QWNDD  YWKFL++F + QF  TL+I+KV  WE+F+  +GSLIG + L +ESLLPLPQIS
Sbjct: 202 QWNDDLMYWKFLLVFGSLQFFITLIISKVFNWESFSQWIGSLIGSLGLFIESLLPLPQIS 261

Query: 279 ILHKLKSVQGFKIILLISWLCGDTVKLSFLLSLNSGEKNVDTSSLFEFFALFQMGLDFYI 338
           I +KLKSVQGFK+I+L+SWLCGD +K+S+L+    G  N+  S +F  F LFQM LD YI
Sbjct: 262 IFYKLKSVQGFKLIILVSWLCGDILKISYLV---FGASNI--SVIFLCFGLFQMSLDIYI 316

Query: 339 GGQ 341
             Q
Sbjct: 317 ACQ 319

>Scas_717.24
          Length = 379

 Score =  298 bits (764), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 170/353 (48%), Positives = 230/353 (65%), Gaps = 14/353 (3%)

Query: 36  LTSYLPKLDQFYIPEWLTMRVLTGYIYSCTPLFSYGAAILSIERCQTAFGFSIDICATML 95
           ++SYLP++DQFYIPEWLTM+ +   + S TPLFSYG  I+SIE+ +TA GFSIDICATML
Sbjct: 25  ISSYLPRVDQFYIPEWLTMQFIANNLISFTPLFSYGTTIISIEKSKTALGFSIDICATML 84

Query: 96  IASILRISYFFFVPYEVTLLRQSIIMXXXXXXXXXXXXKYRPEEYKYDNLQSVEPFTQLI 155
           IASILR+SY+   PYE+TLLRQ+++M            KYRP+EYKY NL+SVE F+QL 
Sbjct: 85  IASILRVSYYLISPYEITLLRQALVMIFIQLILLKTSLKYRPDEYKYHNLKSVETFSQLF 144

Query: 156 HDVWFEYFAIRNKPRMFSDEWKNLLRSLSFERLMGXXXXXXXXXXXXXXXXXDPSFKRVG 215
            ++W+E F    +    S E  N     +  R+                   DPS+KR G
Sbjct: 145 KEIWYESF----QSVSLSHEEDNF---SALTRICKFLYKFLLIFLYKFLKFFDPSYKRFG 197

Query: 216 SFWQWNDDRKYWKFLIIFATFQFSFTLLITKVIAWENFAHNVGSLIGGISLLVESLLPLP 275
           SFWQW+ +R +WKFL+IF   Q   T  I+ ++ W +    +GS+IG + L +E+LLPLP
Sbjct: 198 SFWQWDKNRTFWKFLLIFTFLQMIVTFSISNILNWSSLESFLGSVIGSLGLFIEALLPLP 257

Query: 276 QISILHKLKSVQGFKIILLISWLCGDTVKLSFLLSLNSGEKNVDTSSLFEFFALFQMGLD 335
           QISIL+KLKS+QGFK+ILL+SWLCGDT+K+++L+    G KN+  S LF FFA FQM LD
Sbjct: 258 QISILNKLKSIQGFKLILLVSWLCGDTLKITYLM---FGAKNI--SMLFFFFAFFQMSLD 312

Query: 336 FYIGGQYIYYKFYYNPEGTVVNGYRGTPVIG-GSQDHEFMELQNEFADGPLNE 387
            YIGGQY+YYK+YYN        + G  +   G  + + ++L+N   D P ++
Sbjct: 313 IYIGGQYVYYKYYYNKSEDSDEEFPGIELTTFGFNNPQVLQLENR-EDTPQDQ 364

>ADR022W [1763] [Homologous to ScYMR010W - SH]
           complement(744266..745339) [1074 bp, 357 aa]
          Length = 357

 Score =  283 bits (724), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 148/312 (47%), Positives = 193/312 (61%), Gaps = 9/312 (2%)

Query: 38  SYLPKLDQFYIPEWLTMRVLTGYIYSCTPLFSYGAAILSIERCQTAFGFSIDICATMLIA 97
           SY P++DQFYIP WL ++ L   I S TPLFSYG  +  I+R +T  G  IDICATMLIA
Sbjct: 27  SYWPRIDQFYIPPWLDVQFLANNIISFTPLFSYGTTVCIIKRSKTVLGIFIDICATMLIA 86

Query: 98  SILRISYFFFVPYEVTLLRQSIIMXXXXXXXXXXXXKYRPEEYKYDNLQSVEPFTQLIHD 157
            ILR+SY    PYEV L R S+ M             YRP EYKY++L+ V+ F QL  D
Sbjct: 87  CILRVSYNLITPYEVALFRYSLAMIFMQLILLYTSMCYRPVEYKYESLKPVDRFGQLSQD 146

Query: 158 VWFEYFAIRNKPRMFSDEWKNLLRSLSFERLMGXXXXXXXXXXXXXXXXXDPSFKRVGSF 217
           VW E+F + +        WK + +++S+    G                 DP ++R+G+F
Sbjct: 147 VWQEFFPLCSM----GAGWKGIWQAMSWNSFAGYMEKMLLVALYKFLKFFDPGYQRIGAF 202

Query: 218 WQWNDDRKYWKFLIIFATFQFSFTLLITKVIAWENFAHNVGSLIGGISLLVESLLPLPQI 277
           WQWN+ R +W FL+ F   QF  T  I +V+  E     +GS IG + LL+E+LLPLPQI
Sbjct: 203 WQWNNPRYFWLFLLWFTCGQFLMTFFIARVMNLEWLGQWLGSFIGSLGLLIEALLPLPQI 262

Query: 278 SILHKLKSVQGFKIILLISWLCGDTVKLSFLLSLNSGEKNVDTSSLFEFFALFQMGLDFY 337
           SILH LKSVQGFK+ILL+SWLCGD +K+S+L+    G KN+  S +F  FALFQMGLD Y
Sbjct: 263 SILHTLKSVQGFKLILLVSWLCGDILKISYLV---FGAKNI--SMIFFLFALFQMGLDIY 317

Query: 338 IGGQYIYYKFYY 349
           I   Y+YYK+Y+
Sbjct: 318 IAFIYVYYKYYF 329

>Sklu_1971.2 YDR352W, Contig c1971 2812-3684
          Length = 290

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 43/90 (47%), Gaps = 7/90 (7%)

Query: 256 NVGSLIGGISLLVESLLPLPQISILHKLKSVQGFKIILLISWLCGDTVKLSFLLSLNSGE 315
           +V +  G +S +   +  +PQ+   +K K+V+G   I L++WL GD   L   L  +   
Sbjct: 10  SVSAAAGSVSFITSFIAQIPQLIETYKDKTVEGLSPIFLLAWLFGDITSLIGALLTHQLP 69

Query: 316 KNVDTSSLFEFFALFQMGLDFYIGGQYIYY 345
             +         AL+ M  D +I GQY YY
Sbjct: 70  FQI-------ILALYFMANDMFICGQYYYY 92

>Kwal_55.21538
          Length = 294

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 43/95 (45%), Gaps = 7/95 (7%)

Query: 256 NVGSLIGGISLLVESLLPLPQISILHKLKSVQGFKIILLISWLCGDTVKLSFLLSLNSGE 315
           ++ ++ G IS L   +  +PQ+   +  K+V+G   + L++WL GD   L        G 
Sbjct: 10  HISTIAGSISFLSSFVAQIPQVLETYVDKTVEGLSPLFLLAWLMGDITTL-------VGA 62

Query: 316 KNVDTSSLFEFFALFQMGLDFYIGGQYIYYKFYYN 350
                 S     AL+ +  D +I GQY YY   + 
Sbjct: 63  VLTQQLSFQIILALYFLANDLFICGQYYYYGIVHG 97

>YDR352W (YDR352W) [1179] chr4 (1181790..1182743) Protein containing
           two PQ loop repeat domains, has low similarity to S.
           pombe Stm1p, which is a G protein-coupled receptor that
           acts as a nutrient sensor for sexual diffentiation and
           stress response pathways [954 bp, 317 aa]
          Length = 317

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 51/111 (45%), Gaps = 10/111 (9%)

Query: 256 NVGSLIGGISLLVESLLPLPQISILHKLKSVQGFKIILLISWLCGDTVKLSFLLSLNSGE 315
            V +L G +S     +   PQI   ++ KSV G     L++WLCGD   L        G 
Sbjct: 10  TVSNLCGSLSFFTSVISLFPQIIETYRDKSVDGLSPYFLLAWLCGDITSL-------IGA 62

Query: 316 KNVDTSSLFE-FFALFQMGLDFYIGGQYIYYKFYYNPEGTVVNGYRGTPVI 365
           K +    LF+   A++ +  D ++ GQY YY   +  +   V G+   P++
Sbjct: 63  K-LTGQLLFQILLAIYFLLNDSFVCGQYYYYGVLHENKLATV-GHEPKPLL 111

>Scas_658.15
          Length = 311

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 51/110 (46%), Gaps = 10/110 (9%)

Query: 257 VGSLIGGISLLVESLLPLPQISILHKLKSVQGFKIILLISWLCGDTVKLSFLLSLNSGEK 316
           V ++ G I+ +   +  LPQI   +  K+V G     L++WLCGD   L+  +  N    
Sbjct: 11  VSNVNGSIAFVSSFISLLPQILETYHDKTVVGLSPWFLLAWLCGDITSLTGAILTN---- 66

Query: 317 NVDTSSLFEF-FALFQMGLDFYIGGQYIYYKFYYNPEGTVVNGYRGTPVI 365
                 +F+   A++ +  D ++ GQY YY   Y  +     G+   PV+
Sbjct: 67  ----QLMFQIVLAIYFLLNDMFVCGQYYYYGILYENK-LATTGHEPKPVL 111

>CAGL0A02508g 264398..265348 similar to tr|Q06328 Saccharomyces
           cerevisiae YDR352w, start by similarity
          Length = 316

 Score = 37.7 bits (86), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 74/172 (43%), Gaps = 17/172 (9%)

Query: 275 PQISILHKLKSVQGFKIILLISWLCGDTVKLSFLLSLNSGEKNVDTSSLFEFFALFQMGL 334
           PQI   +K K+V+G   + L+ WL GD    S + +L +G+     +      A++ +  
Sbjct: 29  PQIIETYKDKTVEGLSPLFLMCWLSGDIT--SLIGALMTGQLKFQIA-----LAIYFLFN 81

Query: 335 DFYIGGQYIYYKFYYNPEGTVVNGYRGTPVIGGSQDHEFME-----LQNEFADGPLNELN 389
           D ++  QY YY   +  +   V G+   PVI    D   +      LQN  +  P   + 
Sbjct: 82  DLFVCCQYYYYGVLHENKLATV-GHETVPVISSLIDDGIITVDENGLQNTDSR-PETNME 139

Query: 390 EKAFNGKEHRSNSTPKRKLSYSQHLSKTPSSSRKASIGNIEV--SSPRRGHS 439
               +     S S   R L  +  L    SS+ +  + +++V  ++P  GH+
Sbjct: 140 GSRLSNSSIYSGSRATRSL-LANALVSVKSSNAQQILSSLQVPPNAPYPGHT 190

>KLLA0E21736g complement(1931058..1932017) similar to sgd|S0002760
           Saccharomyces cerevisiae YDR352w, start by similarity
          Length = 319

 Score = 37.0 bits (84), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 36/84 (42%), Gaps = 7/84 (8%)

Query: 262 GGISLLVESLLPLPQISILHKLKSVQGFKIILLISWLCGDTVKLSFLLSLNSGEKNVDTS 321
           GGIS L   +  +PQ+   ++ KSV+G     L+ WL GD   L        G       
Sbjct: 20  GGISFLTSFVAQIPQLIETYRDKSVEGLSPGFLLCWLFGDITSL-------IGAVLTHQL 72

Query: 322 SLFEFFALFQMGLDFYIGGQYIYY 345
                 A++ +  D  I GQY YY
Sbjct: 73  PFQILLAVYYLSNDMLICGQYYYY 96

>Kwal_47.16638
          Length = 433

 Score = 33.9 bits (76), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 1/77 (1%)

Query: 235 TFQFSFTL-LITKVIAWENFAHNVGSLIGGISLLVESLLPLPQISILHKLKSVQGFKIIL 293
           + + SF   LI  V  WE +A  + S + G +L    LL       +H +K+++  + I 
Sbjct: 5   SLEVSFAASLIVHVSDWEYWADAITSHVTGRALPNAILLAPRGAPTIHGIKTIKARRHIQ 64

Query: 294 LISWLCGDTVKLSFLLS 310
           ++ W C D    S L S
Sbjct: 65  VVVWACLDPTLPSLLRS 81

>Scas_628.2
          Length = 305

 Score = 32.0 bits (71), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 25/49 (51%)

Query: 254 AHNVGSLIGGISLLVESLLPLPQISILHKLKSVQGFKIILLISWLCGDT 302
           A NV  + G IS+    ++ +PQI      KS  G  ++ ++ WL GD 
Sbjct: 10  AQNVSGMAGSISIACWVIVFMPQIYENFYRKSADGLSLLFVVLWLAGDV 58

>Kwal_27.12077
          Length = 86

 Score = 29.6 bits (65), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 16/26 (61%)

Query: 338 IGGQYIYYKFYYNPEGTVVNGYRGTP 363
           +G + I+Y   +NPEG   +GYR  P
Sbjct: 28  LGTKSIFYDAEWNPEGEAPSGYRNVP 53

>ADL239C [1502] [Homologous to ScYIL109C (SEC24) - SH; ScYNL049C
           (SFB2) - SH] (281426..284101) [2676 bp, 891 aa]
          Length = 891

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 43/98 (43%), Gaps = 8/98 (8%)

Query: 254 AHNVGSLIGGISLLVESLLPLPQISILHKLKSVQGFKIILLISWL--CGDTVKLSFLLSL 311
           AHN+   IGG  ++V + LP   I  L+K             S L  CGD+   +F +  
Sbjct: 402 AHNLIKGIGGKIIVVSATLPNIGIGKLNKRNEASVANTSKEASQLLSCGDSFYKNFTIDC 461

Query: 312 NSGEKNVD----TSSLFEFFALFQMGLDFYIGGQYIYY 345
           N  +  +D    +    +F ++  +G   Y GGQ  +Y
Sbjct: 462 NKTQVTIDMFLASDDYVDFASVSNLGR--YTGGQTHFY 497

>ACL106C [943] [Homologous to ScYDR352W - SH] (153775..154596) [822
           bp, 273 aa]
          Length = 273

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 257 VGSLIGGISLLVESLLP-LPQISILHKLKSVQGFKIILLISWLCGDTVKL 305
           V S+  G+     SL+  +PQ+   +K KSV G   + L+ W+ GD   L
Sbjct: 14  VISIASGVVSFTTSLVASIPQVVETYKEKSVDGLSPLCLLCWISGDITTL 63

>CAGL0L12892g 1375491..1376480 similar to sp|P35735 Saccharomyces
           cerevisiae YKL051w, hypothetical start
          Length = 329

 Score = 30.0 bits (66), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 9/46 (19%)

Query: 321 SSLFEFFALFQMGL-------DFYIGGQYIYYKFYYNPEGTVVNGY 359
           S+ FE+   F  G+       DFY+GG+Y+Y K+++  E   ++GY
Sbjct: 247 SACFEWLLAFWFGVLFMIISWDFYMGGRYMYSKYFHQIEA--IHGY 290

>AFR605C [3797] [Homologous to ScYOL092W - SH; ScYBR147W - SH]
           (1530918..1531865) [948 bp, 315 aa]
          Length = 315

 Score = 29.6 bits (65), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 27/52 (51%)

Query: 254 AHNVGSLIGGISLLVESLLPLPQISILHKLKSVQGFKIILLISWLCGDTVKL 305
           +  +  + G IS+    ++ +PQI    + KS +G  ++ ++ WL GD   L
Sbjct: 8   SETISGITGSISIACWVIVFVPQIYENFRRKSAEGLSLLFVVLWLAGDIFNL 59

>YBR147W (YBR147W) [332] chr2 (536531..537421) Protein containing
           two PQ loop repeat domains, has low similarity to S.
           pombe Stm1p, which is a G protein-coupled receptor that
           acts as a nutrient sensor for sexual diffentiation and
           stress response pathways [891 bp, 296 aa]
          Length = 296

 Score = 29.6 bits (65), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 27/48 (56%)

Query: 254 AHNVGSLIGGISLLVESLLPLPQISILHKLKSVQGFKIILLISWLCGD 301
           A N+  + G IS+    ++ +PQI    + +S +G  ++ ++ WL GD
Sbjct: 10  AKNLSGMAGSISICCWIVVFVPQIYENFRRQSAEGLSLLFIVLWLLGD 57

>Scas_518.3
          Length = 310

 Score = 29.3 bits (64), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%)

Query: 254 AHNVGSLIGGISLLVESLLPLPQISILHKLKSVQGFKIILLISWLCGDTVKL 305
           + NV  + G IS+    ++ +PQI      KS  G  ++ +I WL GD   L
Sbjct: 10  SENVSGITGCISISCWIVVFVPQIYENFTRKSSDGLSLLFIILWLLGDIFNL 61

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.323    0.139    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,188,790
Number of extensions: 539367
Number of successful extensions: 1596
Number of sequences better than 10.0: 34
Number of HSP's gapped: 1590
Number of HSP's successfully gapped: 34
Length of query: 444
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 339
Effective length of database: 12,961,219
Effective search space: 4393853241
Effective search space used: 4393853241
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 63 (28.9 bits)