Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0K08800g1751739191e-129
Sklu_2248.31771736707e-91
Scas_717.251781746073e-81
Kwal_55.208131751725882e-78
KLLA0D14487g1761725622e-74
YMR009W1791745604e-74
ADR021W1761725441e-71
Scas_713.2436169641.8
CAGL0C05247g35769632.1
Sklu_2346.635435614.0
CAGL0K10626g69680614.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0K08800g
         (173 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0K08800g 883045..883572 similar to sp|Q03677 Saccharomyces c...   358   e-129
Sklu_2248.3 YMR009W, Contig c2248 7331-7864                           262   7e-91
Scas_717.25                                                           238   3e-81
Kwal_55.20813                                                         231   2e-78
KLLA0D14487g 1229115..1229645 similar to sp|Q03677 Saccharomyces...   221   2e-74
YMR009W (YMR009W) [3973] chr13 (284101..284640) Member of the ac...   220   4e-74
ADR021W [1762] [Homologous to ScYMR009W - SH] complement(743305....   214   1e-71
Scas_713.24                                                            29   1.8  
CAGL0C05247g 501476..502549 highly similar to sp|P32179 Saccharo...    29   2.1  
Sklu_2346.6 YOL064C, Contig c2346 12123-13187 reverse complement       28   4.0  
CAGL0K10626g complement(1031704..1033794) highly similar to sp|P...    28   4.1  

>CAGL0K08800g 883045..883572 similar to sp|Q03677 Saccharomyces
           cerevisiae YMR009w, start by similarity
          Length = 175

 Score =  358 bits (919), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 173/173 (100%), Positives = 173/173 (100%)

Query: 1   MVEIYVHDENDSVDFRQPHNSGKTVALEDLGKIGVIYKHIADQADVDILAKERNYKNRDI 60
           MVEIYVHDENDSVDFRQPHNSGKTVALEDLGKIGVIYKHIADQADVDILAKERNYKNRDI
Sbjct: 1   MVEIYVHDENDSVDFRQPHNSGKTVALEDLGKIGVIYKHIADQADVDILAKERNYKNRDI 60

Query: 61  VTINVDTFKGDKNALEKQLGIFYKEHLHEDEEIRYCIEGSGYFDVRNGKDDVWVRCKVGP 120
           VTINVDTFKGDKNALEKQLGIFYKEHLHEDEEIRYCIEGSGYFDVRNGKDDVWVRCKVGP
Sbjct: 61  VTINVDTFKGDKNALEKQLGIFYKEHLHEDEEIRYCIEGSGYFDVRNGKDDVWVRCKVGP 120

Query: 121 GDLLILPAGIYHRFTLTETNHIKALRLFKDEPKWQAYNRPDADSLPVRHEYLQ 173
           GDLLILPAGIYHRFTLTETNHIKALRLFKDEPKWQAYNRPDADSLPVRHEYLQ
Sbjct: 121 GDLLILPAGIYHRFTLTETNHIKALRLFKDEPKWQAYNRPDADSLPVRHEYLQ 173

>Sklu_2248.3 YMR009W, Contig c2248 7331-7864
          Length = 177

 Score =  262 bits (670), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 117/173 (67%), Positives = 146/173 (84%)

Query: 1   MVEIYVHDENDSVDFRQPHNSGKTVALEDLGKIGVIYKHIADQADVDILAKERNYKNRDI 60
           MV++Y HD ND+VDFRQPHN+G+ ++L+ L KIGV Y+H   Q +VD LA+ERNYKNRDI
Sbjct: 1   MVQVYYHDNNDAVDFRQPHNTGREISLQRLEKIGVFYRHFKTQQEVDELARERNYKNRDI 60

Query: 61  VTINVDTFKGDKNALEKQLGIFYKEHLHEDEEIRYCIEGSGYFDVRNGKDDVWVRCKVGP 120
           V+I+ ++F  D+NA+ ++L +FY EHLHEDEEIRYC++G+GYFDVR+ + D W+RCKV P
Sbjct: 61  VSISKESFGNDENAMIEKLKVFYSEHLHEDEEIRYCLDGTGYFDVRDAESDEWIRCKVEP 120

Query: 121 GDLLILPAGIYHRFTLTETNHIKALRLFKDEPKWQAYNRPDADSLPVRHEYLQ 173
           GDLLILPAGIYHRFTLT+ N+IKALRLFK+EPKW AYNRPDADS P R EYL 
Sbjct: 121 GDLLILPAGIYHRFTLTDDNYIKALRLFKEEPKWLAYNRPDADSNPTREEYLS 173

>Scas_717.25
          Length = 178

 Score =  238 bits (607), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 111/174 (63%), Positives = 136/174 (78%), Gaps = 1/174 (0%)

Query: 1   MVEIYVHDENDSVDFRQPHNSGKTVALEDLGKIGVIYKHIADQADVDILAKERNYKNRDI 60
           MVE YVHD ++ +DFR+PHNSG  V+LE L K+G++ K++    DV++LAKERNYKNRD 
Sbjct: 1   MVEAYVHDNDNKIDFREPHNSGVAVSLERLAKLGIVAKYLEKIDDVELLAKERNYKNRDT 60

Query: 61  VTINVDTFKGDKNALEKQLGIFYKEHLHEDEEIRYCIEGSGYFDVRNGKDDVWVRCKVGP 120
           V ++  TF  D+  L  QL IFY+EHLHEDEEIRYCIEGSGYFD+++   + W+RCKV P
Sbjct: 61  VKLSKKTFNNDETLLLNQLNIFYQEHLHEDEEIRYCIEGSGYFDIKDTFTNEWIRCKVSP 120

Query: 121 GDLLILPAGIYHRFTLTETNHIKALRLFKDEPKWQAYNRP-DADSLPVRHEYLQ 173
           GDLLI+PAGIYHRFTLT  N IKALRLFKDEPKWQA+N+  D D   VR +YLQ
Sbjct: 121 GDLLIVPAGIYHRFTLTTDNFIKALRLFKDEPKWQAHNKSGDTDQTSVRKQYLQ 174

>Kwal_55.20813
          Length = 175

 Score =  231 bits (588), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 113/172 (65%), Positives = 135/172 (78%), Gaps = 3/172 (1%)

Query: 1   MVEIYVHDENDSVDFRQPHNSGKTVALEDLGKIGVIYKHIADQADVDILAKERNYKNRDI 60
           MVE Y HD +D+VDFR+PH+SG+T++L+ L KIGV YK+   QA VD +A ER+YKNRD 
Sbjct: 1   MVEAYYHDNDDTVDFREPHHSGETLSLDQLAKIGVFYKYCPSQAQVDEVATERDYKNRDT 60

Query: 61  VTINVDTFKGDKNALEKQLGIFYKEHLHEDEEIRYCIEGSGYFDVRNGKDDVWVRCKVGP 120
           V I+ +T  GD  AL  +L  FY EHLHEDEEIRY I+G G+FDVRN  +D WVRCK+ P
Sbjct: 61  VQISQETL-GD--ALLPKLQTFYAEHLHEDEEIRYIIDGEGFFDVRNEPNDRWVRCKLVP 117

Query: 121 GDLLILPAGIYHRFTLTETNHIKALRLFKDEPKWQAYNRPDADSLPVRHEYL 172
           GDLLILPAGIYHRFTLT  N++KALRLFKDEPKW A+ RP AD LP+R EYL
Sbjct: 118 GDLLILPAGIYHRFTLTSKNYVKALRLFKDEPKWVAHGRPIADDLPIRREYL 169

>KLLA0D14487g 1229115..1229645 similar to sp|Q03677 Saccharomyces
           cerevisiae YMR009w singleton, start by similarity
          Length = 176

 Score =  221 bits (562), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 103/172 (59%), Positives = 133/172 (77%), Gaps = 1/172 (0%)

Query: 1   MVEIYVHDENDSVDFRQPHNSGKTVALEDLGKIGVIYKHIADQADVDILAKERNYKNRDI 60
           MV+ Y+HD + SVDFR+ H++GK V+LE L +IG+IY+    Q +VD  A++R+YKNRDI
Sbjct: 1   MVKAYIHDNDSSVDFREDHDTGKPVSLEKLEQIGLIYRKFDTQEEVDQFAQDRDYKNRDI 60

Query: 61  VTINVDTFKGDKNALEKQLGIFYKEHLHEDEEIRYCIEGSGYFDVRNGKDDVWVRCKVGP 120
           V I V++F  ++  + K L +FY EHLHEDEEIRYC++G G+FDVR+   + W+RC+V  
Sbjct: 61  VNITVNSFPDEETMISK-LNVFYAEHLHEDEEIRYCLDGEGFFDVRDPFTEEWIRCRVQK 119

Query: 121 GDLLILPAGIYHRFTLTETNHIKALRLFKDEPKWQAYNRPDADSLPVRHEYL 172
           GDLL+LPAGIYHRFTLT  N+IKALRLFK+EPKW AYNRPDAD    R EYL
Sbjct: 120 GDLLVLPAGIYHRFTLTSDNYIKALRLFKEEPKWLAYNRPDADDNRYRQEYL 171

>YMR009W (YMR009W) [3973] chr13 (284101..284640) Member of the
           acireductone dioxygenase family, has high similarity to
           uncharacterized C. albicans Orf6.5544p [540 bp, 179 aa]
          Length = 179

 Score =  220 bits (560), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 135/174 (77%), Gaps = 3/174 (1%)

Query: 1   MVEIYVHDENDSVDFRQPHNSGKTVALEDLGKIGVIYKHIADQADVDILAKERNYKNRDI 60
           MV++Y+HD     D+R PHNSG  ++L++L K+GVIYK+ A++ +V+ +A++R YKNRD+
Sbjct: 1   MVKVYIHDNKVDSDYRAPHNSGTELSLDELAKLGVIYKYCANEEEVNEIARQREYKNRDV 60

Query: 61  VTINVDTFKGDKNALEKQLGIFYKEHLHEDEEIRYCIEGSGYFDVRNGKD-DVWVRCKVG 119
           V I   +FK +    EK L  FY+EHLHEDEEIRYC+EG+GYFDVR+    + W+RC V 
Sbjct: 61  VNICEGSFKSEAEFNEK-LATFYQEHLHEDEEIRYCLEGAGYFDVRDASTPENWIRCLVE 119

Query: 120 PGDLLILPAGIYHRFTLTETNHIKALRLFKDEPKWQAYNRPD-ADSLPVRHEYL 172
            GDLLILP GIYHRFTLT +NHIKALRLFKDEPKWQA NR + ADSLPVR +Y+
Sbjct: 120 SGDLLILPPGIYHRFTLTTSNHIKALRLFKDEPKWQAINRSNQADSLPVRKDYI 173

>ADR021W [1762] [Homologous to ScYMR009W - SH]
           complement(743305..743835) [531 bp, 176 aa]
          Length = 176

 Score =  214 bits (544), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 126/172 (73%), Gaps = 1/172 (0%)

Query: 1   MVEIYVHDENDSVDFRQPHNSGKTVALEDLGKIGVIYKHIADQADVDILAKERNYKNRDI 60
           MVE YVHD N  VD R PH+SGK+V+LE L  +GV Y+H   Q +VD +A  R+Y NRD 
Sbjct: 1   MVEAYVHDNNTHVDCRAPHHSGKSVSLERLASLGVFYRHCRSQDEVDAVACARHYSNRDE 60

Query: 61  VTINVDTFKGDKNALEKQLGIFYKEHLHEDEEIRYCIEGSGYFDVRNGKDDVWVRCKVGP 120
           VTI+  +F  + +A   +L +FY EHLHEDEEIRY + G GYFD+R+     W+R K+  
Sbjct: 61  VTISPASFPSE-DAFRDKLAVFYTEHLHEDEEIRYALAGEGYFDLRDATTGDWIRVKLTT 119

Query: 121 GDLLILPAGIYHRFTLTETNHIKALRLFKDEPKWQAYNRPDADSLPVRHEYL 172
           GDLLI+PAGIYHRFT+TE+N I+A RLFKDEPKWQA+NRP+ D+ PV  EYL
Sbjct: 120 GDLLIVPAGIYHRFTVTESNFIRAQRLFKDEPKWQAFNRPEGDARPVHKEYL 171

>Scas_713.24
          Length = 361

 Score = 29.3 bits (64), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 38/69 (55%), Gaps = 12/69 (17%)

Query: 71  DKNALEKQLGIFYKEHLHEDEEIRYCIEGSGYFDV-------RNGKDDVWVRCKVGPGDL 123
           +++ +++QLG+   + LH D +++YCI   G  D+        + ++ +W     G G++
Sbjct: 251 EQSQIKEQLGV--TKSLHLDSQVKYCILALGLADLYLRLPIKMSYEEKIWDH---GAGNV 305

Query: 124 LILPAGIYH 132
           ++  AG +H
Sbjct: 306 IVHEAGGFH 314

>CAGL0C05247g 501476..502549 highly similar to sp|P32179
           Saccharomyces cerevisiae YOL064c MET22, start by
           similarity
          Length = 357

 Score = 28.9 bits (63), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 35/69 (50%), Gaps = 12/69 (17%)

Query: 71  DKNALEKQLGIFYKEHLHEDEEIRYCIEGSGYFDV-------RNGKDDVWVRCKVGPGDL 123
           +++ ++ +LGI     LH D +++YC+   G  DV        + ++ +W       G+ 
Sbjct: 247 EQSQIKAKLGI--NNSLHLDSQVKYCLLALGLADVYLRLPIKLSYREKIWDH---AAGNT 301

Query: 124 LILPAGIYH 132
           ++L AG YH
Sbjct: 302 IVLEAGGYH 310

>Sklu_2346.6 YOL064C, Contig c2346 12123-13187 reverse complement
          Length = 354

 Score = 28.1 bits (61), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 22/35 (62%), Gaps = 2/35 (5%)

Query: 71  DKNALEKQLGIFYKEHLHEDEEIRYCIEGSGYFDV 105
           +++ ++ QLGI   + LH D +++YC+   G  DV
Sbjct: 245 EQSVIKTQLGI--SDSLHLDSQVKYCLLALGLGDV 277

>CAGL0K10626g complement(1031704..1033794) highly similar to
           sp|P23337 Saccharomyces cerevisiae YFR015c GSY1, start
           by similarity
          Length = 696

 Score = 28.1 bits (61), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 38/80 (47%), Gaps = 3/80 (3%)

Query: 25  VALEDLGKIGVIYKHIADQADVDILAKERNYKNRDIVTINVDTFKGDKNALE-KQLGIFY 83
           VA E   K+G IY  +  +A V +   + NY    I  +N  T++G+   L+ +   IF 
Sbjct: 13  VATEVANKVGGIYSVLKSKAPVTVAQYQDNYTL--IGPLNKGTYQGEVEELDWEDPSIFS 70

Query: 84  KEHLHEDEEIRYCIEGSGYF 103
           +E     + ++Y  E   YF
Sbjct: 71  EELQPVQQALKYMREKGVYF 90

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.140    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,665,485
Number of extensions: 301697
Number of successful extensions: 692
Number of sequences better than 10.0: 18
Number of HSP's gapped: 686
Number of HSP's successfully gapped: 18
Length of query: 173
Length of database: 16,596,109
Length adjustment: 95
Effective length of query: 78
Effective length of database: 13,307,399
Effective search space: 1037977122
Effective search space used: 1037977122
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 58 (26.9 bits)