Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0K07480g56755829910.0
Scas_721.12356955825700.0
YMR105C (PGM2)56955825140.0
CAGL0K03421g56855724320.0
Scas_717.7056955824070.0
YKL127W (PGM1)57055923740.0
Sklu_2430.457156023550.0
Kwal_26.762857055923360.0
KLLA0B12694g56856022780.0
ABL029W56855822160.0
Kwal_27.102586204951014e-04
YMR278W622568890.012
Scas_696.42625369820.079
CAGL0M02981g617127760.40
Sklu_1994.2624133702.1
KLLA0F14861g58945683.7
Sklu_2244.2352122656.3
KLLA0D08910g20637647.6
YEL058W (PCM1)55764658.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0K07480g
         (558 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0K07480g complement(739633..741336) highly similar to sp|P37...  1156   0.0  
Scas_721.123                                                          994   0.0  
YMR105C (PGM2) [4062] chr13 complement(475896..477605) Phosphogl...   972   0.0  
CAGL0K03421g complement(313851..315557) highly similar to sp|P37...   941   0.0  
Scas_717.70                                                           931   0.0  
YKL127W (PGM1) [3139] chr11 (203187..204899) Phosphoglucomutase,...   919   0.0  
Sklu_2430.4 YMR105C, Contig c2430 6115-7830                           911   0.0  
Kwal_26.7628                                                          904   0.0  
KLLA0B12694g 1107696..1109402 highly similar to sp|P37012 Saccha...   882   0.0  
ABL029W [563] [Homologous to ScYKL127W (PGM1) - SH; ScYMR105C (P...   858   0.0  
Kwal_27.10258                                                          44   4e-04
YMR278W (YMR278W) [4232] chr13 (822762..824630) Protein containi...    39   0.012
Scas_696.42                                                            36   0.079
CAGL0M02981g 335863..337716 similar to sp|Q03262 Saccharomyces c...    34   0.40 
Sklu_1994.2 YMR278W, Contig c1994 3654-5528                            32   2.1  
KLLA0F14861g 1375042..1376811 some similarities with sp|Q00539 S...    31   3.7  
Sklu_2244.2 YOL151W, Contig c2244 1821-2879 reverse complement         30   6.3  
KLLA0D08910g 750828..751448 similar to sp|P46683 Saccharomyces c...    29   7.6  
YEL058W (PCM1) [1370] chr5 (43252..44925) Hexosephosphate mutase...    30   8.7  

>CAGL0K07480g complement(739633..741336) highly similar to sp|P37012
           Saccharomyces cerevisiae YMR105c PGM2
           phosphoglucomutase, hypothetical start
          Length = 567

 Score = 1156 bits (2991), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/558 (100%), Positives = 558/558 (100%)

Query: 1   MQVETVPTKPYQDQKPGTSGLRKKTKVFMEEPNYTENFIQAIMDAIPEGAKDAVLVVGGD 60
           MQVETVPTKPYQDQKPGTSGLRKKTKVFMEEPNYTENFIQAIMDAIPEGAKDAVLVVGGD
Sbjct: 1   MQVETVPTKPYQDQKPGTSGLRKKTKVFMEEPNYTENFIQAIMDAIPEGAKDAVLVVGGD 60

Query: 61  GRFYNDVIMQKIAAIGAANGVRKLIIGQNGLLSTPAASHVIRSYAEKCTGGIILTASHNP 120
           GRFYNDVIMQKIAAIGAANGVRKLIIGQNGLLSTPAASHVIRSYAEKCTGGIILTASHNP
Sbjct: 61  GRFYNDVIMQKIAAIGAANGVRKLIIGQNGLLSTPAASHVIRSYAEKCTGGIILTASHNP 120

Query: 121 GGPENDLGIKYNLANGGPAPEPVTNKMWEVSKQLTHYKIIKDFPQVDFSKIGKDQQYGPL 180
           GGPENDLGIKYNLANGGPAPEPVTNKMWEVSKQLTHYKIIKDFPQVDFSKIGKDQQYGPL
Sbjct: 121 GGPENDLGIKYNLANGGPAPEPVTNKMWEVSKQLTHYKIIKDFPQVDFSKIGKDQQYGPL 180

Query: 181 LVDIIDTTEDYVKFMKEIFDFKLIKEFIHKQREAKNWKLLFDSLNGITGPYGKAIFVDEF 240
           LVDIIDTTEDYVKFMKEIFDFKLIKEFIHKQREAKNWKLLFDSLNGITGPYGKAIFVDEF
Sbjct: 181 LVDIIDTTEDYVKFMKEIFDFKLIKEFIHKQREAKNWKLLFDSLNGITGPYGKAIFVDEF 240

Query: 241 DLPADEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVDREKIEFGAASDGDGDRNMIYGAG 300
           DLPADEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVDREKIEFGAASDGDGDRNMIYGAG
Sbjct: 241 DLPADEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVDREKIEFGAASDGDGDRNMIYGAG 300

Query: 301 PAFVSPGDSVAIIAEYAKEIPYFQKQGIYGLARSFPTSGAIDRVAKAQGLNCYEVPTGWK 360
           PAFVSPGDSVAIIAEYAKEIPYFQKQGIYGLARSFPTSGAIDRVAKAQGLNCYEVPTGWK
Sbjct: 301 PAFVSPGDSVAIIAEYAKEIPYFQKQGIYGLARSFPTSGAIDRVAKAQGLNCYEVPTGWK 360

Query: 361 FFCALFDAKKLSICGEESFGTGSNHIREKDGVWAICAWLNILALYNKHNPEKEASIKTIQ 420
           FFCALFDAKKLSICGEESFGTGSNHIREKDGVWAICAWLNILALYNKHNPEKEASIKTIQ
Sbjct: 361 FFCALFDAKKLSICGEESFGTGSNHIREKDGVWAICAWLNILALYNKHNPEKEASIKTIQ 420

Query: 421 EEFWAKYGRTFFTRYDYEGITTEKANKVVDLLDKFVNDPKSKNAPFPGDESLTVSDCGDF 480
           EEFWAKYGRTFFTRYDYEGITTEKANKVVDLLDKFVNDPKSKNAPFPGDESLTVSDCGDF
Sbjct: 421 EEFWAKYGRTFFTRYDYEGITTEKANKVVDLLDKFVNDPKSKNAPFPGDESLTVSDCGDF 480

Query: 481 SYTDLDGSVSDHQGLFVKLSNGARFVLRLSGTGSAGATIRLYIEEYSDDKSTYTQSADQY 540
           SYTDLDGSVSDHQGLFVKLSNGARFVLRLSGTGSAGATIRLYIEEYSDDKSTYTQSADQY
Sbjct: 481 SYTDLDGSVSDHQGLFVKLSNGARFVLRLSGTGSAGATIRLYIEEYSDDKSTYTQSADQY 540

Query: 541 LQKMIKSVTSFLNFKELI 558
           LQKMIKSVTSFLNFKELI
Sbjct: 541 LQKMIKSVTSFLNFKELI 558

>Scas_721.123
          Length = 569

 Score =  994 bits (2570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/558 (84%), Positives = 510/558 (91%)

Query: 1   MQVETVPTKPYQDQKPGTSGLRKKTKVFMEEPNYTENFIQAIMDAIPEGAKDAVLVVGGD 60
           +Q+ET+ TKPYQDQKPGTSGLRKKT +FM EPNYTENFIQA++DAIPEG++DA LVVGGD
Sbjct: 3   LQIETIETKPYQDQKPGTSGLRKKTAIFMNEPNYTENFIQAMLDAIPEGSQDATLVVGGD 62

Query: 61  GRFYNDVIMQKIAAIGAANGVRKLIIGQNGLLSTPAASHVIRSYAEKCTGGIILTASHNP 120
           GRFYNDVIM KIAAI AANGV+KLIIGQNGLLSTPAASH+IRSY EK TGGIILTASHNP
Sbjct: 63  GRFYNDVIMNKIAAISAANGVKKLIIGQNGLLSTPAASHIIRSYEEKVTGGIILTASHNP 122

Query: 121 GGPENDLGIKYNLANGGPAPEPVTNKMWEVSKQLTHYKIIKDFPQVDFSKIGKDQQYGPL 180
           GGPENDLGIKYNLANGGPAPE VTN +WEVSK+LTHYKIIK+FP +D SK+GKDQ+YGPL
Sbjct: 123 GGPENDLGIKYNLANGGPAPESVTNAIWEVSKKLTHYKIIKNFPPLDLSKMGKDQKYGPL 182

Query: 181 LVDIIDTTEDYVKFMKEIFDFKLIKEFIHKQREAKNWKLLFDSLNGITGPYGKAIFVDEF 240
           LVDIID T+DYV F+KEIFDF+LIK+FIHKQRE KNWKLLFDSLNGITGPYGKAIFVDEF
Sbjct: 183 LVDIIDVTKDYVDFLKEIFDFELIKKFIHKQRETKNWKLLFDSLNGITGPYGKAIFVDEF 242

Query: 241 DLPADEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVDREKIEFGAASDGDGDRNMIYGAG 300
           DLPA+EVLQNWHP+PDFGGLHPDPNLTYA TLVERVDREKIEFGAASDGDGDRNMIYGAG
Sbjct: 243 DLPANEVLQNWHPKPDFGGLHPDPNLTYAKTLVERVDREKIEFGAASDGDGDRNMIYGAG 302

Query: 301 PAFVSPGDSVAIIAEYAKEIPYFQKQGIYGLARSFPTSGAIDRVAKAQGLNCYEVPTGWK 360
           PAFVSPGDSVAIIAEYA EIPYF KQGIYGLARSFPTS AIDRVAKA GL+CYEVPTGWK
Sbjct: 303 PAFVSPGDSVAIIAEYASEIPYFVKQGIYGLARSFPTSAAIDRVAKAHGLSCYEVPTGWK 362

Query: 361 FFCALFDAKKLSICGEESFGTGSNHIREKDGVWAICAWLNILALYNKHNPEKEASIKTIQ 420
           FFCALFDAKKLSICGEESFGTGSNHIREKDG+WAI AWLN+LA+YNKHNPEK+ASIKTIQ
Sbjct: 363 FFCALFDAKKLSICGEESFGTGSNHIREKDGLWAIVAWLNVLAIYNKHNPEKDASIKTIQ 422

Query: 421 EEFWAKYGRTFFTRYDYEGITTEKANKVVDLLDKFVNDPKSKNAPFPGDESLTVSDCGDF 480
           EEFW KYGRTFFTRYDYE I+ E A+KVVDLL+ FV+ P    + FPGDESLTV D GDF
Sbjct: 423 EEFWNKYGRTFFTRYDYEHISNEDASKVVDLLNNFVSKPNVIGSAFPGDESLTVVDAGDF 482

Query: 481 SYTDLDGSVSDHQGLFVKLSNGARFVLRLSGTGSAGATIRLYIEEYSDDKSTYTQSADQY 540
           SYTDLDGSVSDHQGLF KLSNGAR VLRLSGTGS+GATIR+Y+E Y+DDK+ Y +SA  +
Sbjct: 483 SYTDLDGSVSDHQGLFFKLSNGARIVLRLSGTGSSGATIRIYVENYTDDKTKYEESAQDF 542

Query: 541 LQKMIKSVTSFLNFKELI 558
           L   IK+V  FL FKE I
Sbjct: 543 LAPTIKTVVKFLKFKEFI 560

>YMR105C (PGM2) [4062] chr13 complement(475896..477605)
           Phosphoglucomutase, major isozyme, interconverts Glc-1-P
           and Glc-6-P [1710 bp, 569 aa]
          Length = 569

 Score =  972 bits (2514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/558 (81%), Positives = 508/558 (91%)

Query: 1   MQVETVPTKPYQDQKPGTSGLRKKTKVFMEEPNYTENFIQAIMDAIPEGAKDAVLVVGGD 60
            Q+ETVPTKPY+DQKPGTSGLRKKTKVF +EPNYTENFIQ+IM+AIPEG+K A LVVGGD
Sbjct: 3   FQIETVPTKPYEDQKPGTSGLRKKTKVFKDEPNYTENFIQSIMEAIPEGSKGATLVVGGD 62

Query: 61  GRFYNDVIMQKIAAIGAANGVRKLIIGQNGLLSTPAASHVIRSYAEKCTGGIILTASHNP 120
           GR+YNDVI+ KIAAIGAANG++KL+IGQ+GLLSTPAASH++R+Y EKCTGGIILTASHNP
Sbjct: 63  GRYYNDVILHKIAAIGAANGIKKLVIGQHGLLSTPAASHIMRTYEEKCTGGIILTASHNP 122

Query: 121 GGPENDLGIKYNLANGGPAPEPVTNKMWEVSKQLTHYKIIKDFPQVDFSKIGKDQQYGPL 180
           GGPEND+GIKYNL+NGGPAPE VTN +WE+SK+LT YKIIKDFP++D   IGK+++YGPL
Sbjct: 123 GGPENDMGIKYNLSNGGPAPESVTNAIWEISKKLTSYKIIKDFPELDLGTIGKNKKYGPL 182

Query: 181 LVDIIDTTEDYVKFMKEIFDFKLIKEFIHKQREAKNWKLLFDSLNGITGPYGKAIFVDEF 240
           LVDIID T+DYV F+KEIFDF LIK+FI  QR  KNWKLLFDS+NG+TGPYGKAIFVDEF
Sbjct: 183 LVDIIDITKDYVNFLKEIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVDEF 242

Query: 241 DLPADEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVDREKIEFGAASDGDGDRNMIYGAG 300
            LPADEVLQNWHP PDFGG+HPDPNLTYA +LV+RVDREKIEFGAASDGDGDRNMIYG G
Sbjct: 243 GLPADEVLQNWHPSPDFGGMHPDPNLTYASSLVKRVDREKIEFGAASDGDGDRNMIYGYG 302

Query: 301 PAFVSPGDSVAIIAEYAKEIPYFQKQGIYGLARSFPTSGAIDRVAKAQGLNCYEVPTGWK 360
           P+FVSPGDSVAIIAEYA EIPYF KQGIYGLARSFPTSGAIDRVAKA GLNCYEVPTGWK
Sbjct: 303 PSFVSPGDSVAIIAEYAAEIPYFAKQGIYGLARSFPTSGAIDRVAKAHGLNCYEVPTGWK 362

Query: 361 FFCALFDAKKLSICGEESFGTGSNHIREKDGVWAICAWLNILALYNKHNPEKEASIKTIQ 420
           FFCALFDAKKLSICGEESFGTGSNH+REKDGVWAI AWLNILA+YNKH+PE EASIKTIQ
Sbjct: 363 FFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNKHHPENEASIKTIQ 422

Query: 421 EEFWAKYGRTFFTRYDYEGITTEKANKVVDLLDKFVNDPKSKNAPFPGDESLTVSDCGDF 480
            EFWAKYGRTFFTRYD+E + TEKANK+VD L  +V      N+ FP DESL V+DCGDF
Sbjct: 423 NEFWAKYGRTFFTRYDFEKVETEKANKIVDQLRAYVTKSGVVNSAFPADESLKVTDCGDF 482

Query: 481 SYTDLDGSVSDHQGLFVKLSNGARFVLRLSGTGSAGATIRLYIEEYSDDKSTYTQSADQY 540
           SYTDLDGSVSDHQGL+VKLSNGARFVLRLSGTGS+GATIRLYIE+Y DDKS Y ++A++Y
Sbjct: 483 SYTDLDGSVSDHQGLYVKLSNGARFVLRLSGTGSSGATIRLYIEKYCDDKSQYQKTAEEY 542

Query: 541 LQKMIKSVTSFLNFKELI 558
           L+ +I SV  FLNFK+++
Sbjct: 543 LKPIINSVIKFLNFKQVL 560

>CAGL0K03421g complement(313851..315557) highly similar to sp|P37012
           Saccharomyces cerevisiae YMR105c Phosphoglucomutase 2,
           start by similarity
          Length = 568

 Score =  941 bits (2432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/557 (77%), Positives = 505/557 (90%)

Query: 2   QVETVPTKPYQDQKPGTSGLRKKTKVFMEEPNYTENFIQAIMDAIPEGAKDAVLVVGGDG 61
           Q+E+VPTKPYQDQKPGTSGLRKKTKVF ++PNY ENFIQ++M+AIPEGAK AVLVVGGDG
Sbjct: 3   QIESVPTKPYQDQKPGTSGLRKKTKVFEDQPNYVENFIQSVMEAIPEGAKGAVLVVGGDG 62

Query: 62  RFYNDVIMQKIAAIGAANGVRKLIIGQNGLLSTPAASHVIRSYAEKCTGGIILTASHNPG 121
           R+YNDVI+QKIAAIGAANGV+KL+IGQNGLLSTPAASH++R+Y EKCTGGIILTASHNPG
Sbjct: 63  RYYNDVILQKIAAIGAANGVKKLVIGQNGLLSTPAASHIMRTYKEKCTGGIILTASHNPG 122

Query: 122 GPENDLGIKYNLANGGPAPEPVTNKMWEVSKQLTHYKIIKDFPQVDFSKIGKDQQYGPLL 181
           GPEND+GIKYNL+NGGPAPEPVTNK+WE+SK+LTHYKI+KDFP++D +K+ ++++YGPLL
Sbjct: 123 GPENDMGIKYNLSNGGPAPEPVTNKIWEISKKLTHYKIVKDFPELDLTKLVENKKYGPLL 182

Query: 182 VDIIDTTEDYVKFMKEIFDFKLIKEFIHKQREAKNWKLLFDSLNGITGPYGKAIFVDEFD 241
           VD+IDTT+ Y++ +KEIFDF+LI +FI KQR+ K WKLL DS+NG+TGPY KAIFVDEF 
Sbjct: 183 VDVIDTTDAYIQLLKEIFDFELIHKFIAKQRKEKGWKLLVDSMNGVTGPYAKAIFVDEFG 242

Query: 242 LPADEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVDREKIEFGAASDGDGDRNMIYGAGP 301
           L + EVLQNWHPQPDFGGLHPDPNLTYAHTLVERV++EKIEFGAASDGDGDRNMIYG GP
Sbjct: 243 LDSKEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVNKEKIEFGAASDGDGDRNMIYGYGP 302

Query: 302 AFVSPGDSVAIIAEYAKEIPYFQKQGIYGLARSFPTSGAIDRVAKAQGLNCYEVPTGWKF 361
           AFVSPGDSVAIIAEYA EIPYF+KQGIYGLARSFPT+ AIDRVAK  GLNCYEVPTGWKF
Sbjct: 303 AFVSPGDSVAIIAEYANEIPYFKKQGIYGLARSFPTASAIDRVAKKHGLNCYEVPTGWKF 362

Query: 362 FCALFDAKKLSICGEESFGTGSNHIREKDGVWAICAWLNILALYNKHNPEKEASIKTIQE 421
           FCALFDAKKLSICGEESFGTGSNH+REKDG+WAI AWLNILA++N+ +P+KEASIKTIQ 
Sbjct: 363 FCALFDAKKLSICGEESFGTGSNHVREKDGIWAIMAWLNILAIFNQRHPDKEASIKTIQN 422

Query: 422 EFWAKYGRTFFTRYDYEGITTEKANKVVDLLDKFVNDPKSKNAPFPGDESLTVSDCGDFS 481
           EFW  YGRTFFTRYDYE + T+KANKV++ L ++V D  +K + FP D +LTV D GDFS
Sbjct: 423 EFWDTYGRTFFTRYDYEKVETDKANKVIENLRQYVADSGTKGSKFPTDSALTVVDAGDFS 482

Query: 482 YTDLDGSVSDHQGLFVKLSNGARFVLRLSGTGSAGATIRLYIEEYSDDKSTYTQSADQYL 541
           YTDLDG++S HQGL+V LSNGARFV+RLSGTGS+GATIRLYIE Y+DDKS Y+  A +YL
Sbjct: 483 YTDLDGTISSHQGLYVILSNGARFVVRLSGTGSSGATIRLYIERYTDDKSKYSLDAQEYL 542

Query: 542 QKMIKSVTSFLNFKELI 558
           + +IKS+  FL+ K ++
Sbjct: 543 KPIIKSIVQFLDLKTIL 559

>Scas_717.70
          Length = 569

 Score =  931 bits (2407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/558 (77%), Positives = 495/558 (88%)

Query: 1   MQVETVPTKPYQDQKPGTSGLRKKTKVFMEEPNYTENFIQAIMDAIPEGAKDAVLVVGGD 60
            Q++TVPTKPYQDQKPGTSGLRKKTK+F + PNYTENFIQAIMDAIPEG+K A LVVGGD
Sbjct: 3   FQIQTVPTKPYQDQKPGTSGLRKKTKIFKDTPNYTENFIQAIMDAIPEGSKGATLVVGGD 62

Query: 61  GRFYNDVIMQKIAAIGAANGVRKLIIGQNGLLSTPAASHVIRSYAEKCTGGIILTASHNP 120
           GR+YNDVI+ KIAAIGAANGV+KL+IGQ GLLSTPAASH++R+Y EK  GGIILTASHNP
Sbjct: 63  GRYYNDVILHKIAAIGAANGVKKLVIGQRGLLSTPAASHIMRTYEEKTQGGIILTASHNP 122

Query: 121 GGPENDLGIKYNLANGGPAPEPVTNKMWEVSKQLTHYKIIKDFPQVDFSKIGKDQQYGPL 180
           GG +ND+GIK+NL+NGGPAPEPVTNK+WE+SK++T +KIIKDFP+++   +GK+++YGPL
Sbjct: 123 GGIKNDMGIKFNLSNGGPAPEPVTNKIWEISKKMTSFKIIKDFPELELETLGKNKKYGPL 182

Query: 181 LVDIIDTTEDYVKFMKEIFDFKLIKEFIHKQREAKNWKLLFDSLNGITGPYGKAIFVDEF 240
           LVD+IDTT+ YV+F+K+IFDF LIK+F+HKQR+ K+WKLLFD +NG+TGPYGKAIFVDE 
Sbjct: 183 LVDVIDTTKAYVEFVKQIFDFDLIKKFVHKQRDTKHWKLLFDGMNGVTGPYGKAIFVDEL 242

Query: 241 DLPADEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVDREKIEFGAASDGDGDRNMIYGAG 300
            LPADEVLQ WHP PDFGG+HPDPNLTYA  LV+RVDRE IEFGAASDGDGDRNMIYGAG
Sbjct: 243 GLPADEVLQQWHPSPDFGGVHPDPNLTYAKALVDRVDRENIEFGAASDGDGDRNMIYGAG 302

Query: 301 PAFVSPGDSVAIIAEYAKEIPYFQKQGIYGLARSFPTSGAIDRVAKAQGLNCYEVPTGWK 360
           PAFVSPGDSVAIIAEYA EIPYF KQGIYGLARSFPTS AIDRVAKA GLNCYEVPTGWK
Sbjct: 303 PAFVSPGDSVAIIAEYAAEIPYFAKQGIYGLARSFPTSSAIDRVAKAHGLNCYEVPTGWK 362

Query: 361 FFCALFDAKKLSICGEESFGTGSNHIREKDGVWAICAWLNILALYNKHNPEKEASIKTIQ 420
           FFCALFDAKKLSICGEESFGTGSNH+REKDG+WAI AWLN+LA+YNKH+P+++ SIK IQ
Sbjct: 363 FFCALFDAKKLSICGEESFGTGSNHVREKDGIWAILAWLNLLAIYNKHHPDRDVSIKIIQ 422

Query: 421 EEFWAKYGRTFFTRYDYEGITTEKANKVVDLLDKFVNDPKSKNAPFPGDESLTVSDCGDF 480
           +EFW KYGRTFFTRYDYE + TE A KV+D L K V      N  FP DESLTV + GDF
Sbjct: 423 DEFWNKYGRTFFTRYDYEKVATEDAAKVIDNLRKHVESKTFVNHKFPTDESLTVVEAGDF 482

Query: 481 SYTDLDGSVSDHQGLFVKLSNGARFVLRLSGTGSAGATIRLYIEEYSDDKSTYTQSADQY 540
           SYTDLDGSVS HQGLF KLSNGAR V+RLSGTGS+GATIRLY+E+Y+DDKS Y Q+A  Y
Sbjct: 483 SYTDLDGSVSAHQGLFFKLSNGARVVVRLSGTGSSGATIRLYVEKYTDDKSVYGQNAQVY 542

Query: 541 LQKMIKSVTSFLNFKELI 558
           L+ +I+SV  FLNFKE I
Sbjct: 543 LKPVIQSVVKFLNFKEFI 560

>YKL127W (PGM1) [3139] chr11 (203187..204899) Phosphoglucomutase,
           minor isoform, interconverts Glc-1-P and Glc-6-P [1713
           bp, 570 aa]
          Length = 570

 Score =  919 bits (2374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/559 (77%), Positives = 492/559 (88%), Gaps = 1/559 (0%)

Query: 1   MQVETVPTKPYQDQKPGTSGLRKKTKVFMEEPNYTENFIQAIMDAIPEGAKDAVLVVGGD 60
           + +++VPT  Y+DQKPGTSGLRKKTKVFM+EP+YTENFIQA M +IP G++   LVVGGD
Sbjct: 3   LLIDSVPTVAYKDQKPGTSGLRKKTKVFMDEPHYTENFIQATMQSIPNGSEGTTLVVGGD 62

Query: 61  GRFYNDVIMQKIAAIGAANGVRKLIIGQNGLLSTPAASHVIRSYAEKCTGG-IILTASHN 119
           GRFYNDVIM KIAA+GAANGVRKL+IGQ GLLSTPAASH+IR+Y EKCTGG IILTASHN
Sbjct: 63  GRFYNDVIMNKIAAVGAANGVRKLVIGQGGLLSTPAASHIIRTYEEKCTGGGIILTASHN 122

Query: 120 PGGPENDLGIKYNLANGGPAPEPVTNKMWEVSKQLTHYKIIKDFPQVDFSKIGKDQQYGP 179
           PGGPENDLGIKYNL NGGPAPE VTN +WE SK+LTHYKIIK+FP+++ +K+GK+Q+YGP
Sbjct: 123 PGGPENDLGIKYNLPNGGPAPESVTNAIWEASKKLTHYKIIKNFPKLNLNKLGKNQKYGP 182

Query: 180 LLVDIIDTTEDYVKFMKEIFDFKLIKEFIHKQREAKNWKLLFDSLNGITGPYGKAIFVDE 239
           LLVDIID  + YV+F+KEIFDF LIK F+ KQR+ K WKLLFDSLNGITGPYGKAIFVDE
Sbjct: 183 LLVDIIDPAKAYVQFLKEIFDFDLIKSFLAKQRKDKGWKLLFDSLNGITGPYGKAIFVDE 242

Query: 240 FDLPADEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVDREKIEFGAASDGDGDRNMIYGA 299
           F LPA+EVLQNWHP PDFGGLHPDPNLTYA TLV+RVDREKI FGAASDGDGDRNMIYG 
Sbjct: 243 FGLPAEEVLQNWHPLPDFGGLHPDPNLTYARTLVDRVDREKIAFGAASDGDGDRNMIYGY 302

Query: 300 GPAFVSPGDSVAIIAEYAKEIPYFQKQGIYGLARSFPTSGAIDRVAKAQGLNCYEVPTGW 359
           GPAFVSPGDSVAIIAEYA EIPYF KQGIYGLARSFPTS AIDRVA  +GL CYEVPTGW
Sbjct: 303 GPAFVSPGDSVAIIAEYAPEIPYFAKQGIYGLARSFPTSSAIDRVAAKKGLRCYEVPTGW 362

Query: 360 KFFCALFDAKKLSICGEESFGTGSNHIREKDGVWAICAWLNILALYNKHNPEKEASIKTI 419
           KFFCALFDAKKLSICGEESFGTGSNHIREKDG+WAI AWLNILA+Y++ NPEKEASIKTI
Sbjct: 363 KFFCALFDAKKLSICGEESFGTGSNHIREKDGLWAIIAWLNILAIYHRRNPEKEASIKTI 422

Query: 420 QEEFWAKYGRTFFTRYDYEGITTEKANKVVDLLDKFVNDPKSKNAPFPGDESLTVSDCGD 479
           Q+EFW +YGRTFFTRYDYE I  E+A KVV LL +FV+ P    + FP DESLTV DCGD
Sbjct: 423 QDEFWNEYGRTFFTRYDYEHIECEQAEKVVALLSEFVSRPNVCGSHFPADESLTVIDCGD 482

Query: 480 FSYTDLDGSVSDHQGLFVKLSNGARFVLRLSGTGSAGATIRLYIEEYSDDKSTYTQSADQ 539
           FSY DLDGS+S++QGLFVK SNG +FVLRLSGTGS+GATIRLY+E+Y+D K  Y Q+AD 
Sbjct: 483 FSYRDLDGSISENQGLFVKFSNGTKFVLRLSGTGSSGATIRLYVEKYTDKKENYGQTADV 542

Query: 540 YLQKMIKSVTSFLNFKELI 558
           +L+ +I S+  FL FKE++
Sbjct: 543 FLKPVINSIVKFLRFKEIL 561

>Sklu_2430.4 YMR105C, Contig c2430 6115-7830
          Length = 571

 Score =  911 bits (2355), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/560 (78%), Positives = 486/560 (86%), Gaps = 2/560 (0%)

Query: 1   MQVETVPTKPYQDQKPGTSGLRKKTKVFMEEPNYTENFIQAIMDAIPEGAKDAVLVVGGD 60
            ++ET+PT PY DQKPGTSGLRKKTKVFMEEPNYTENFIQA+MDAIPEG++DA LVVGGD
Sbjct: 3   FKIETIPTTPYTDQKPGTSGLRKKTKVFMEEPNYTENFIQAVMDAIPEGSQDATLVVGGD 62

Query: 61  GRFYNDVIMQKIAAIGAANGVRKLIIGQNGLLSTPAASHVIRSYAE-KCTGGIILTASHN 119
           GRFYNDV++QKIAAIGAANGV KL+IGQNG+LSTPAASH+IR+Y   K TGGIILTASHN
Sbjct: 63  GRFYNDVVVQKIAAIGAANGVHKLVIGQNGILSTPAASHIIRTYPHAKITGGIILTASHN 122

Query: 120 PGGPENDLGIKYNLANGGPAPEPVTNKMWEVSKQLTHYKIIKDFPQVDFSKIGKDQQYGP 179
           PGG +ND GIKYNL+NGGPAPE VTNK++E SKQLT YKI+ +FPQ+D SK G DQ+YGP
Sbjct: 123 PGGAKNDFGIKYNLSNGGPAPESVTNKIFEKSKQLTSYKIVANFPQLDLSKKGTDQRYGP 182

Query: 180 LLVDIIDTTEDYVKFMKEIFDFKLIKEFIHKQREAKNWKLLFDSLNGITGPYGKAIFVDE 239
           LLVDIID+TE YVK MK IFDF LIK+FI  Q+E   +KLLFDSLNG+TGPYGKA+FVDE
Sbjct: 183 LLVDIIDSTEAYVKLMKSIFDFDLIKKFIKTQKETVGFKLLFDSLNGVTGPYGKALFVDE 242

Query: 240 FDLPADEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVDREKIEFGAASDGDGDRNMIYGA 299
             L A+E LQN+ P+PDFGGLHPDPNLTYAHTLVERVD++KI FGAASDGDGDRNMIYG 
Sbjct: 243 LGLSAEESLQNYVPKPDFGGLHPDPNLTYAHTLVERVDKDKIAFGAASDGDGDRNMIYGY 302

Query: 300 GPAFVSPGDSVAIIAEYAKEIPYFQKQGIYGLARSFPTSGAIDRVAKAQGLNCYEVPTGW 359
           GPAFVSPGDSVAIIAEYA EIPYF KQGIYGLARSFPTS AIDRVAKA GLNCYEVPTGW
Sbjct: 303 GPAFVSPGDSVAIIAEYASEIPYFAKQGIYGLARSFPTSAAIDRVAKAHGLNCYEVPTGW 362

Query: 360 KFFCALFDAKKLSICGEESFGTGSNHIREKDGVWAICAWLNILALYNKHNPEKEASIKTI 419
           KFFCALFDAKKLSICGEESFGTGSNH+REKDGVWAI AWLNILA+YN+ NP KEASIKTI
Sbjct: 363 KFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNRKNPTKEASIKTI 422

Query: 420 QEEFWAKYGRTFFTRYDYEGITTEKANKVVDLLDKFVNDPKS-KNAPFPGDESLTVSDCG 478
           QEEFW KYGRTFFTRYD+E I +E A+KV+ LL  FV+   S  N  FP    LTV D G
Sbjct: 423 QEEFWNKYGRTFFTRYDFEQIASENADKVIQLLHNFVSKKDSVVNKAFPAATDLTVVDAG 482

Query: 479 DFSYTDLDGSVSDHQGLFVKLSNGARFVLRLSGTGSAGATIRLYIEEYSDDKSTYTQSAD 538
           DFSYTDLDGSVS +QGLFVKLSNG +FV+RLSGTGS+GATIRLY+E YSD+KS Y+ +AD
Sbjct: 483 DFSYTDLDGSVSSNQGLFVKLSNGCKFVVRLSGTGSSGATIRLYVERYSDNKSDYSLTAD 542

Query: 539 QYLQKMIKSVTSFLNFKELI 558
           Q+L   IK V  FL FKE +
Sbjct: 543 QFLGNDIKHVLQFLKFKEFL 562

>Kwal_26.7628
          Length = 570

 Score =  904 bits (2336), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/559 (75%), Positives = 491/559 (87%), Gaps = 1/559 (0%)

Query: 1   MQVETVPTKPYQDQKPGTSGLRKKTKVFMEEPNYTENFIQAIMDAIPEGAKDAVLVVGGD 60
           + +E+VPTKP+ DQKPGTSGLRKKTKVF +EP+YTENFIQAI++AIPEG+++A LVVGGD
Sbjct: 3   LTIESVPTKPFDDQKPGTSGLRKKTKVFKDEPHYTENFIQAILEAIPEGSENATLVVGGD 62

Query: 61  GRFYNDVIMQKIAAIGAANGVRKLIIGQNGLLSTPAASHVIRSYAEKCTGGIILTASHNP 120
           GR+YN+ +MQ I AI AANGVRK+I+GQNG+LSTPAASH+IRSY EKCTGGIILTASHNP
Sbjct: 63  GRYYNNEVMQIIGAIAAANGVRKMILGQNGILSTPAASHIIRSYPEKCTGGIILTASHNP 122

Query: 121 GGPENDLGIKYNLANGGPAPEPVTNKMWEVSKQLTHYKIIKDFPQVDFSKIGKDQQYGPL 180
           GGPEND GIKYNL+NGGPAPE VTN ++E SKQLTHYKI+K+FP++DFSKIGKDQ+YGPL
Sbjct: 123 GGPENDFGIKYNLSNGGPAPESVTNAIFEKSKQLTHYKIVKNFPKIDFSKIGKDQKYGPL 182

Query: 181 LVDIIDTTEDYVKFMKEIFDFKLIKEFIHKQREAKNWKLLFDSLNGITGPYGKAIFVDEF 240
           LVD++D+T DYV  MKEIFDF LIK+FI  QR  K +K+LFDSLNG+TGPYG+AIFV E 
Sbjct: 183 LVDVVDSTADYVALMKEIFDFDLIKKFIDNQRSTKGFKILFDSLNGVTGPYGEAIFVKEL 242

Query: 241 DLPADEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVDREKIEFGAASDGDGDRNMIYGAG 300
            LPA+EVLQN+ P+PDFGGLHPDPNLTYAHTLVERVD+E+I FGAASDGDGDRNMIYG G
Sbjct: 243 GLPAEEVLQNYVPKPDFGGLHPDPNLTYAHTLVERVDKEQIAFGAASDGDGDRNMIYGCG 302

Query: 301 PAFVSPGDSVAIIAEYAKEIPYFQKQGIYGLARSFPTSGAIDRVAKAQGLNCYEVPTGWK 360
           PAFVSPGDSVAIIAEYA EIPYF+KQGIYGLARSFPTS AIDRVAK QGL CYEVPTGWK
Sbjct: 303 PAFVSPGDSVAIIAEYASEIPYFKKQGIYGLARSFPTSAAIDRVAKEQGLACYEVPTGWK 362

Query: 361 FFCALFDAKKLSICGEESFGTGSNHIREKDGVWAICAWLNILALYNKHNPEKEASIKTIQ 420
           FFCALFDAKKLSICGEESFGTGSNH+REKDGVWAI AWLNILA+YN+ +P+ + SIK IQ
Sbjct: 363 FFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIVAWLNILAIYNRDHPDSDVSIKVIQ 422

Query: 421 EEFWAKYGRTFFTRYDYEGITTEKANKVVDLLDKFVNDPKSK-NAPFPGDESLTVSDCGD 479
           E+FWAKYGRTFFTRYD+E +++E A +V+ +L+  V    S    PF G+ +LTV+DCGD
Sbjct: 423 EKFWAKYGRTFFTRYDFEQVSSESAAQVLQVLEDLVAAKDSSVGKPFAGNPALTVADCGD 482

Query: 480 FSYTDLDGSVSDHQGLFVKLSNGARFVLRLSGTGSAGATIRLYIEEYSDDKSTYTQSADQ 539
           FSYTDLDGSVS+HQGL+ KLSNG RFV+RLSGTGS+GATIRLY+E+Y+DD S Y+   +Q
Sbjct: 483 FSYTDLDGSVSEHQGLYAKLSNGCRFVVRLSGTGSSGATIRLYVEKYTDDASKYSLDVEQ 542

Query: 540 YLQKMIKSVTSFLNFKELI 558
           +L   IKS+  FL F E +
Sbjct: 543 FLGDDIKSILKFLKFCEYL 561

>KLLA0B12694g 1107696..1109402 highly similar to sp|P37012
           Saccharomyces cerevisiae YMR105c PGM2
           phosphoglucomutase, major isoform, start by similarity
          Length = 568

 Score =  882 bits (2278), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/560 (74%), Positives = 485/560 (86%), Gaps = 5/560 (0%)

Query: 1   MQVETVPTKPYQDQKPGTSGLRKKTKVFMEEPNYTENFIQAIMDAIPEGAKDAVLVVGGD 60
           ++  +V T PY DQKPGTSGLRKKTKVF E PNYTENFIQAIM+AIPEG++ A LV+GGD
Sbjct: 3   LKTVSVATNPYPDQKPGTSGLRKKTKVFEETPNYTENFIQAIMEAIPEGSQGATLVIGGD 62

Query: 61  GRFYNDVIMQKIAAIGAANGVRKLIIGQNGLLSTPAASHVIRSYAEKCTGGIILTASHNP 120
           GR+YNDV++QKIAAIG+ANGVRK++IG NG+LSTPAASH+IR+Y EKCTGGIILTASHNP
Sbjct: 63  GRYYNDVVIQKIAAIGSANGVRKIVIGHNGILSTPAASHIIRAYHEKCTGGIILTASHNP 122

Query: 121 GGPENDLGIKYNLANGGPAPEPVTNKMWEVSKQLTHYKIIKDFPQVDFSKIGKDQQYGPL 180
           GGP ND GIKYNLANGGPAPE VTN +W  S++LTHYKI++ FP +D +KIG+DQ+YG L
Sbjct: 123 GGPTNDFGIKYNLANGGPAPESVTNSIWHKSRELTHYKIVESFPAIDLTKIGQDQKYGDL 182

Query: 181 LVDIIDTTEDYVKFMKEIFDFKLIKEFIHKQREAKN-WKLLFDSLNGITGPYGKAIFVDE 239
           LVDI+D+T  YV+ MKEIFDF LIK FI  Q  AKN +K+LFD++NG+TGPYG+A+FV E
Sbjct: 183 LVDIVDSTAAYVELMKEIFDFPLIKSFIDTQ--AKNGFKILFDAMNGVTGPYGEALFVKE 240

Query: 240 FDLPADEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVDREKIEFGAASDGDGDRNMIYGA 299
             LP +  LQN+HP+PDFGGLHPDPNLTYAHTLVERVD+  I+FGAASDGDGDRNMIYGA
Sbjct: 241 LGLP-ESSLQNYHPKPDFGGLHPDPNLTYAHTLVERVDKYGIQFGAASDGDGDRNMIYGA 299

Query: 300 GPAFVSPGDSVAIIAEYAKEIPYFQKQGIYGLARSFPTSGAIDRVAKAQGLNCYEVPTGW 359
           GPAFVSPGDSVAIIAEYA  IPYF+KQGIYGLARSFPTS AIDRVAK QGLNCYEVPTGW
Sbjct: 300 GPAFVSPGDSVAIIAEYASAIPYFKKQGIYGLARSFPTSSAIDRVAKEQGLNCYEVPTGW 359

Query: 360 KFFCALFDAKKLSICGEESFGTGSNHIREKDGVWAICAWLNILALYNKHNPEKEASIKTI 419
           KFFCALFDAKKLSICGEESFGTGSNH+REKDGVWAI AWLNILA+YN+  P KEASIK+I
Sbjct: 360 KFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNQRFPNKEASIKSI 419

Query: 420 QEEFWAKYGRTFFTRYDYEGITTEKANKVVDLLDKFVNDPKS-KNAPFPGDESLTVSDCG 478
           Q +FW KYGRTFFTRYD+E +++E A KV+ LL  +V DP+S K   FP D+SLTV + G
Sbjct: 420 QTDFWQKYGRTFFTRYDFENLSSEDAGKVILLLQNYVADPESIKGTKFPADDSLTVVEGG 479

Query: 479 DFSYTDLDGSVSDHQGLFVKLSNGARFVLRLSGTGSAGATIRLYIEEYSDDKSTYTQSAD 538
           DFSYTDLDGSVS HQGL+V+LSNG RFV+RLSGTGS+GATIRLY+E Y++D S Y Q+A+
Sbjct: 480 DFSYTDLDGSVSSHQGLYVRLSNGVRFVVRLSGTGSSGATIRLYVERYTNDGSKYEQTAE 539

Query: 539 QYLQKMIKSVTSFLNFKELI 558
           ++L K IK++  FL FKE I
Sbjct: 540 EFLGKDIKTILKFLKFKEAI 559

>ABL029W [563] [Homologous to ScYKL127W (PGM1) - SH; ScYMR105C
           (PGM2) - SH] complement(343852..345558) [1707 bp, 568
           aa]
          Length = 568

 Score =  858 bits (2216), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/558 (72%), Positives = 475/558 (85%), Gaps = 1/558 (0%)

Query: 1   MQVETVPTKPYQDQKPGTSGLRKKTKVFMEEPNYTENFIQAIMDAIPEGAKDAVLVVGGD 60
           + +E+VPTK + DQKPGTSGLRKKTKVF +  +YTENFIQAIM++IPEG+++AVLV+GGD
Sbjct: 3   ITIESVPTKAFADQKPGTSGLRKKTKVFEQTEHYTENFIQAIMESIPEGSENAVLVIGGD 62

Query: 61  GRFYNDVIMQKIAAIGAANGVRKLIIGQNGLLSTPAASHVIRSYAEKCTGGIILTASHNP 120
           GR+YND +MQKIA +G+ANGVRKLIIGQNGLLSTPAASH+IR+Y +K TGGIILTASHNP
Sbjct: 63  GRYYNDAVMQKIAEVGSANGVRKLIIGQNGLLSTPAASHIIRTYHDKVTGGIILTASHNP 122

Query: 121 GGPENDLGIKYNLANGGPAPEPVTNKMWEVSKQLTHYKIIKDFPQVDFSKIGKDQQYGPL 180
           GGP+ND GIKYNLANG PAPE VTN M+E S+ LTHYKI +  P++D  KIG++QQYG L
Sbjct: 123 GGPDNDFGIKYNLANGAPAPEKVTNSMFERSRNLTHYKITRGMPKLDLGKIGENQQYGNL 182

Query: 181 LVDIIDTTEDYVKFMKEIFDFKLIKEFIHKQREAKNWKLLFDSLNGITGPYGKAIFVDEF 240
           LVD+ID TE YV+ MKEIFDF LIK+F+   ++    K+LFD+LNGITGPYGKAIFVDE 
Sbjct: 183 LVDVIDPTEAYVRLMKEIFDFPLIKKFLEHAQKEYGLKVLFDALNGITGPYGKAIFVDEL 242

Query: 241 DLPADEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVDREKIEFGAASDGDGDRNMIYGAG 300
            L  D  LQN+ P+PDFGGLHPDPNLTYAHTLV RVDRE I FGAASDGDGDRNMIYGAG
Sbjct: 243 GLSEDS-LQNFVPKPDFGGLHPDPNLTYAHTLVSRVDRENIAFGAASDGDGDRNMIYGAG 301

Query: 301 PAFVSPGDSVAIIAEYAKEIPYFQKQGIYGLARSFPTSGAIDRVAKAQGLNCYEVPTGWK 360
           PAFVSPGDSVAIIAEYA EIPYF K GI+GLARSFPTSGAID VAK + L+CYEVPTGWK
Sbjct: 302 PAFVSPGDSVAIIAEYASEIPYFIKNGIHGLARSFPTSGAIDLVAKEKNLDCYEVPTGWK 361

Query: 361 FFCALFDAKKLSICGEESFGTGSNHIREKDGVWAICAWLNILALYNKHNPEKEASIKTIQ 420
           FFC LFD+KKLSICGEESFGTGS+H+REKDG+WAI AWLN+LA+Y++ +P++E SIKTIQ
Sbjct: 362 FFCNLFDSKKLSICGEESFGTGSDHVREKDGLWAIVAWLNVLAIYHRRHPDREPSIKTIQ 421

Query: 421 EEFWAKYGRTFFTRYDYEGITTEKANKVVDLLDKFVNDPKSKNAPFPGDESLTVSDCGDF 480
           EEFWAKYGRTFFTRYD+E   TE ANKV++LL  F  +P     PFP    ++VS  GDF
Sbjct: 422 EEFWAKYGRTFFTRYDFEECDTEDANKVIELLRTFAENPAVVGQPFPAWHEVSVSAAGDF 481

Query: 481 SYTDLDGSVSDHQGLFVKLSNGARFVLRLSGTGSAGATIRLYIEEYSDDKSTYTQSADQY 540
           SYTDLDGSVS+HQGL++KLSNG R+V+RLSGTGS+GATIRLY+E Y++D + Y Q+ADQ+
Sbjct: 482 SYTDLDGSVSEHQGLYIKLSNGTRYVVRLSGTGSSGATIRLYVERYTNDPAYYAQTADQF 541

Query: 541 LQKMIKSVTSFLNFKELI 558
           L   IK+V  FL FK+LI
Sbjct: 542 LAPDIKAVLKFLRFKDLI 559

>Kwal_27.10258
          Length = 620

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 120/495 (24%), Positives = 196/495 (39%), Gaps = 85/495 (17%)

Query: 17  GTSGLRKKTKVFMEEPNYTENFIQA-------IMDAIPEGAKDAVLVVGGDGRFYNDVIM 69
           GT+GLR K +      N T   +QA       I +  PE   +  + VG D RF +    
Sbjct: 55  GTAGLRSKMEAGFSRMN-TLTVLQASQGLAKYIAEKFPE---NKTVAVGHDHRFNSRDFA 110

Query: 70  QKIAAIGAANGVRKLIIGQNG------LLSTPAASHVIRSYAEKCTGGIILTASHNPGGP 123
           +  +        +   +G N        + TP     I       + G+++TASHN   P
Sbjct: 111 EVTSVAFLQLRFKVYSLGFNADPKKDAFVHTPMVPFAIDRLG--ASAGVMITASHN---P 165

Query: 124 ENDLGIKYNLANGGPAPEPVTNKMWE-VSKQLTHYKIIKDFPQVDFSKIGKDQQYGPLLV 182
           + D G K   +NG     P    + + +   L  ++   D   V    I +  + G   V
Sbjct: 166 KMDNGYKVYYSNGCQIIPPHDRLIAQSILDNLNPWERAWDCKAV----IAEATEKG-YFV 220

Query: 183 DIIDTTEDYVKFMKEIFDFKLIKEFIHKQREAKNWKLLFDSLNGITGPYGKAIFVDEFDL 242
           D+     D+  ++KEI D KL+   I  +  +K W  ++  L+G+          + F+ 
Sbjct: 221 DMKKPMVDH--YVKEISD-KLVSSDIGDR--SKPW-FVYTPLHGVG--------FEIFER 266

Query: 243 PADEVL------QNW----HPQPD--FGGLH-PDPNLTYAHTL-VERVDREKIEFGAASD 288
            A EVL        W    H QPD  F  +  P+P    A  L +   D+  I F   +D
Sbjct: 267 IASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEAGALDLAIALADKNGISFVLGND 326

Query: 289 GDGDR--NMIYGAGPAFVSPGDSVAII------AEYAKEIPYFQKQGIYGLARSFPTSGA 340
            D DR    +   G      G+ +  +       +Y KE   F+ +    L  S  +S  
Sbjct: 327 PDADRFSAAVKHQGKWRQLTGNEIGFLFAQFVWEKYQKESSEFKLENPLALINSTVSSQM 386

Query: 341 IDRVAKAQGLNCYEVPTGWKFFCALFDAKKLSICG-------EESFG-TGSNHIREKDGV 392
           I ++A  +  +  +  TG+K+      A++L   G       EE+ G   S+ + +KDGV
Sbjct: 387 IKKLAGVEKFHYEDTLTGFKWLGN--RARQLESSGYYVPFAYEEAIGFMFSDIVHDKDGV 444

Query: 393 WAICAWLNILALYNKHNPEKEASIKTIQEEFWAKYGRTFFTRYDYEGITTEKANKVVDLL 452
            A   +L +L  + K   +  + I  +Q  F  KYG       +Y G  T      + L 
Sbjct: 445 SAAVVFLQMLWSWKK---QALSPIDVLQSAF-GKYG----VFKEYNGYYTVPD---LSLT 493

Query: 453 DKFVNDPKSKNAPFP 467
           D+  +D +S    +P
Sbjct: 494 DRIFSDIRSSYDSYP 508

>YMR278W (YMR278W) [4232] chr13 (822762..824630) Protein containing
           a phosphoglucomutase or phosphomannomutase
           alpha-beta-alpha domain I, has high similarity to
           uncharacterized C. albicans Orf6.8892p [1869 bp, 622 aa]
          Length = 622

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 126/568 (22%), Positives = 223/568 (39%), Gaps = 85/568 (14%)

Query: 17  GTSGLRKKTKVFMEEPNYTENFIQA-------IMDAIPEGAKDAVLVVGGDGRFYNDVIM 69
           GT+GLR + +      N T   IQA       +    P+   + V VVG D RF++    
Sbjct: 56  GTAGLRSQMQAGFSRMN-TLVVIQASQGLATYVRQQFPD---NLVAVVGHDHRFHSKEFA 111

Query: 70  QKIAAIGAANGVRKLIIG-QNGLLSTPAASHVIRSYAEKCTGGIILTASHNPGGPENDLG 128
           +  AA     G +   +   +  + TP     +     K + G+++TASHN   P+ D G
Sbjct: 112 RATAAAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL--KASVGVMITASHN---PKMDNG 166

Query: 129 IKYNLANGGPAPEPVTNKMWE-VSKQLTHYKIIKDFPQVDFSKIGKDQQYGPLLVDIIDT 187
            K   +NG     P  + + + +   L  +  + DF  V    + K  + G L+    + 
Sbjct: 167 YKVYYSNGCQIIPPHDHAISDSIDANLEPWANVWDFDDV----LNKALKQGKLMYSREEM 222

Query: 188 TEDYV----KFMKEIFDFKLIKEFIHKQREAKNWKLLFDSLNGITGPYGKAIFVDEFDLP 243
            + Y+    K + EI   KL       + +AK W  ++  ++G+       I      L 
Sbjct: 223 LKLYLEEVSKNLVEINPLKL-------EVKAKPW-FVYTPMHGVGFDIFSTIVKKTLCLV 274

Query: 244 ADE----VLQNWHPQPDFGGL-HPDPNLTYAHTL-VERVDREKIEFGAASDGDGDRNMI- 296
             +    V +  +P P F  +  P+P    A  + +   ++  I+   A+D D DR  + 
Sbjct: 275 EGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALDIGINLAEKHDIDLLVANDPDADRFSVA 334

Query: 297 ---YGAGPAFVSPGDSVAIIAEYAKEIPY------FQKQGIYGLARSFPTSGAIDRVAKA 347
                +G      G+ +  +  + +   Y      FQ      +  S  +S  I ++A+ 
Sbjct: 335 VKDMQSGEWRQLTGNEIGFLFAFYEYQKYKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEI 394

Query: 348 QGLNCYEVPTGWKFFC--ALFDAKK---LSICGEESFGTGSNHI-REKDGVWAICAWLNI 401
           +G +  +  TG+K+    A+   KK   +    EE+ G     +  +KDG   I A +  
Sbjct: 395 EGFHYEDTLTGFKWIGNRAILLEKKGYYVPFGFEEAIGYMFPAMEHDKDG---ISASIVF 451

Query: 402 LALYNKHNPEKEASIKTIQEEFWAKYGRTFFTRYD-YEGITTEKANKVVDLLDKFVNDPK 460
           L  Y K   +       + E  + KYG   F  Y+ Y  +      K  D+ D   N   
Sbjct: 452 LQAYCKWKIDHNLDPLNVLENGFKKYG--VFKEYNGYYVVPNPTVTK--DIFDYIRNVYT 507

Query: 461 SKNAPFPGD--ESLTVSDCGDFSYTDLDGSVSDHQGLFV-----------KLSNGA---- 503
            + A +P    E + V    D +      +++    L V           + SNG+    
Sbjct: 508 PEGASYPSSIGEEIEVLYYRDLTTGYQSDTINHKPTLPVDPTSQMITVSARPSNGSENEH 567

Query: 504 -RFVLRLSGTGSAGATIRLYIEEYSDDK 530
            RF +R SGT      +++YIE  ++++
Sbjct: 568 IRFTIRGSGT---EPKLKVYIEACANEE 592

>Scas_696.42
          Length = 625

 Score = 36.2 bits (82), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 80/369 (21%), Positives = 143/369 (38%), Gaps = 40/369 (10%)

Query: 17  GTSGLRKKTKVFMEEPNY------TENFIQAIMDAIPEGAKDAVLVVGGDGRFYNDVIMQ 70
           GT+GLR + +      N       T+     I +  P    +   VVG D RF++     
Sbjct: 58  GTAGLRSRMEAGFSRMNSLIILQSTQGLANYIKEQFP---NNLTAVVGHDHRFHSKEFAI 114

Query: 71  KIAAIGAANGVRKLIIG-QNGLLSTPAASHVIRSYAEKCTGGIILTASHNPGGPENDLGI 129
             A+I    G +   +   +  + TP     + +   K + G+++TASHN   P+ D G 
Sbjct: 115 VTASIFLRAGFKVFYLTPDDQFVHTPLVPFSVLNL--KASVGVMITASHN---PKMDNGY 169

Query: 130 KYNLANGGPAPEPVTNKMWE-VSKQLTHYKIIKDFPQVDFSKIGKDQQYGPLLVDIIDTT 188
           K    N      P    + E + K L  +    D+    F K G +      + D++  T
Sbjct: 170 KVYYDNACQIIPPHDKNIAEMIQKNLEPWSTSWDW-DATFKK-GLETNKLVFIKDLM--T 225

Query: 189 EDYVKFMKEIFDFKLIKEFIHKQREAKNWKLLFDSLNGITGPYGKAIFVDEFDLPAD--- 245
           E Y+  MK +    LI       ++ K    ++  ++G+       +  +  +L  +   
Sbjct: 226 EKYLMQMKRV----LIHSSHLSLKDVKTPFFVYTPMHGVGAEIFAKVSSELLNLHENVDY 281

Query: 246 -EVLQNWHPQPDFGGLH-PDPNLTYAHTLVERVDREK-IEFGAASDGDGDR----NMIYG 298
             V +   P P F  +  P+P    A +L  ++ +E  +    A+D D DR     +   
Sbjct: 282 LVVSEQRLPDPSFPTVSFPNPEEKGALSLAIKLAQENGLSLVIANDPDADRFSAAVLNKK 341

Query: 299 AGPAFVSPGDSVAIIAEYAKEIPY------FQKQGIYGLARSFPTSGAIDRVAKAQGLNC 352
            G      G+ +  +  Y +   Y      F+K     +  S  +S  I R+A   G + 
Sbjct: 342 TGKWRQLTGNEIGFLLGYYEFQLYEQQDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHY 401

Query: 353 YEVPTGWKF 361
            +  TG+K+
Sbjct: 402 EDTLTGFKW 410

>CAGL0M02981g 335863..337716 similar to sp|Q03262 Saccharomyces
           cerevisiae YMR278w, hypothetical start
          Length = 617

 Score = 33.9 bits (76), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 53/127 (41%), Gaps = 15/127 (11%)

Query: 17  GTSGLRKKTKVFMEEPN------YTENFIQAIMDAIPEGAKDAVLVVGGDGRFYNDVIMQ 70
           GT+GLR + +      N       ++     I D  P+   +   VVG D R+++    Q
Sbjct: 53  GTAGLRARMEAGTNRLNKLVILQASQGLATYIKDKFPQ---NLTAVVGHDHRYHSQEFAQ 109

Query: 71  KIAAIGAANGVRKLIIG-QNGLLSTPAASHVIRSYAEKCTGGIILTASHNPGGPENDLGI 129
             AA     G +   +   +  + TP   + +       + G+++TASHN   P+ D G 
Sbjct: 110 VTAATFIRAGFKVYYLNPHDEFVHTPMVPYSVDHL--NASVGVMITASHN---PKMDNGY 164

Query: 130 KYNLANG 136
           K    NG
Sbjct: 165 KVYYTNG 171

>Sklu_1994.2 YMR278W, Contig c1994 3654-5528
          Length = 624

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 53/133 (39%), Gaps = 22/133 (16%)

Query: 17  GTSGLRKKTKVFMEEPNYTENFIQA-------IMDAIPEGAKDAVLVVGGDGRFYNDVIM 69
           GT+GLR + +      N T   +QA       I    PE      ++VG D R++++   
Sbjct: 55  GTAGLRSRMEAGFSRMN-TLTVLQASQGLASYIKSQFPENLS---VIVGHDHRYHSNEFA 110

Query: 70  QKIAAIGAANGVRKLIIGQNG------LLSTPAASHVIRSYAEKCTGGIILTASHNPGGP 123
           +         G +   +  +        + TP     I       + GI++TASHN   P
Sbjct: 111 RVTVTAFLQLGFKVYYLNLSSKDSTETFVHTPMVPFTINQL--NASAGIMITASHN---P 165

Query: 124 ENDLGIKYNLANG 136
           + D G K   +NG
Sbjct: 166 KMDNGYKVYYSNG 178

>KLLA0F14861g 1375042..1376811 some similarities with sp|Q00539
           Saccharomyces cerevisiae YHR086w NAM8 meiotic
           recombination protein, hypothetical start
          Length = 589

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 24/45 (53%)

Query: 197 EIFDFKLIKEFIHKQREAKNWKLLFDSLNGITGPYGKAIFVDEFD 241
            + + +L + FI +     N K++FD   G++  YG   FV+E +
Sbjct: 160 NVTEAQLFELFISRYSSTLNAKIVFDQFTGVSKGYGFVKFVNEME 204

>Sklu_2244.2 YOL151W, Contig c2244 1821-2879 reverse complement
          Length = 352

 Score = 29.6 bits (65), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 50/122 (40%), Gaps = 15/122 (12%)

Query: 291 GDRNMIYGAGPAFVSPGDSVAIIAEYAKEI--------PYFQKQGIYGLARSFPT---SG 339
            + N+     P    P     I A+YAK+I        P+F +   +      P    + 
Sbjct: 55  SNSNLSMEIVPNIAEPDAFDHIFAKYAKDIKVVLHTASPFFFESKDFDKDLLIPAVNGTS 114

Query: 340 AIDRVAKAQGLNCYE---VPTGWKFFCALF-DAKKLSICGEESFGTGSNHIREKDGVWAI 395
           +I +  K    N  E   + + +   C    D++K ++  EES+ T S    +KDG+ A 
Sbjct: 115 SILKAVKKYAANTVERVVITSSYAAVCTFNEDSQKGNVINEESWNTMSWEEAKKDGIAAY 174

Query: 396 CA 397
           CA
Sbjct: 175 CA 176

>KLLA0D08910g 750828..751448 similar to sp|P46683 Saccharomyces
           cerevisiae YPL239w YAR1 ankyrin repeat-containing
           protein singleton, start by similarity
          Length = 206

 Score = 29.3 bits (64), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 23/37 (62%)

Query: 190 DYVKFMKEIFDFKLIKEFIHKQREAKNWKLLFDSLNG 226
           + VK++  IF    +KE+++KQ E  N  L + SLNG
Sbjct: 64  EVVKYLLSIFPKDKLKEWVNKQNETGNTALHWASLNG 100

>YEL058W (PCM1) [1370] chr5 (43252..44925) Hexosephosphate mutase
           (phosphoacetylglucosamine mutase,
           N-acetylglucosamine-phosphate mutase), catalyzes
           conversion of N-acetyl-D-glucosamine 1-phosphate to
           N-acetyl-D-glucosamine 6-phosphate [1674 bp, 557 aa]
          Length = 557

 Score = 29.6 bits (65), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 35/64 (54%), Gaps = 3/64 (4%)

Query: 185 IDTTEDYVKFMKEIFDFKLIKEFIHKQREAKNWKLLFDSLNGITGPYGKAIFVDE-FDLP 243
           + T +DY  F    F+ +L   +  ++R +   KL  D+ NGI GP  K +   E +D+P
Sbjct: 192 VATEQDYYSFFIGAFN-ELFATYQLEKRLSVP-KLFIDTANGIGGPQLKKLLASEDWDVP 249

Query: 244 ADEV 247
           A++V
Sbjct: 250 AEQV 253

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.137    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,105,463
Number of extensions: 947719
Number of successful extensions: 2270
Number of sequences better than 10.0: 26
Number of HSP's gapped: 2314
Number of HSP's successfully gapped: 26
Length of query: 558
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 451
Effective length of database: 12,891,983
Effective search space: 5814284333
Effective search space used: 5814284333
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)