Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0K07458g70469333340.0
Scas_721.12468457720030.0
CAGL0K03399g70354819680.0
Kwal_26.763569165819340.0
Scas_717.6967455019210.0
ABL028W72265019180.0
KLLA0B12716g71655518360.0
Kwal_47.167617443929091e-112
ADL389W7114158951e-110
YHR205W (SCH9)8243978831e-107
Scas_703.57493678731e-106
KLLA0B03586g7343518671e-106
CAGL0F09075g7463888601e-104
Scas_689.25*4092936962e-84
YJL164C (TPK1)3972916793e-82
CAGL0M08404g4622936835e-82
KLLA0B07205g4552916765e-81
Scas_651.183712936695e-81
Kwal_33.138463752936696e-81
KLLA0E06413g11613277067e-80
Kwal_27.1058111543296971e-78
ACR191C11493296908e-78
CAGL0G09020g3612946423e-77
Scas_715.3411503346863e-77
Kwal_56.240593532946405e-77
AFL090W3462946396e-77
KLLA0D03190g3722946373e-76
CAGL0M09361g11443276793e-76
YBL105C (PKC1)11513866732e-75
Scas_690.133542946283e-75
AEL115C3862916173e-73
CAGL0C03509g8953065965e-66
KLLA0C18568g7743075917e-66
Kwal_23.64588684065931e-65
YCR091W (KIN82)7202985861e-65
ADR167W8733065912e-65
Scas_629.169183075862e-64
Scas_720.1038044215707e-63
CAGL0J06072g7733505611e-61
Kwal_56.227885153825442e-61
KLLA0F24618g5563895412e-60
YBR028C5253955251e-58
AEL083W5363645261e-58
CAGL0B04301g5423945217e-58
Scas_593.14d4952975047e-56
CAGL0B04147g5663834701e-50
Kwal_23.39925713794586e-49
AFL101C3672564361e-47
Scas_705.235533794462e-47
CAGL0E05720g3582664333e-47
Kwal_56.240913812534291e-46
YGR092W (DBF2)5723504402e-46
KLLA0D14905g5673724402e-46
YDR490C (PKH1)7662884472e-46
ADR033W5773644366e-46
KLLA0B02332g3612564237e-46
Scas_716.335733944351e-45
Kwal_56.226939842874395e-45
Kwal_33.145547143604275e-44
AFR377C7262824267e-44
KLLA0C12485g9252884243e-43
KLLA0E03487g6472794184e-43
CAGL0G04609g9652924191e-42
CAGL0G03047g5393784064e-42
AFR335C10332834102e-41
CAGL0I07513g10762833997e-40
Scas_627.73492503771e-39
KLLA0F13552g12672633891e-38
Scas_660.209572933862e-38
YDR466W (PKH3)8983083852e-38
Scas_502.211162843845e-38
Kwal_47.182335983103652e-36
Kwal_47.183076213253653e-36
CAGL0M08910g6123103601e-35
YDR477W (SNF1)6333213592e-35
KLLA0D07810g7181483593e-35
AFR035W7191483583e-35
Scas_616.1014613453598e-35
YDL101C (DUN1)5133013481e-34
Kwal_56.224766972743503e-34
CAGL0J03872g6612593494e-34
Kwal_26.778812672513534e-34
Scas_654.127371483495e-34
ACL006W7082563495e-34
KLLA0C06138g7082563478e-34
AEL230W6082793459e-34
ABL034W14252493491e-33
CAGL0J11638g7462883433e-33
Scas_700.348642963434e-33
Kwal_0.964272583291e-32
KLLA0A03806g6022483351e-32
CAGL0K06479g9913013391e-32
Scas_660.286232573352e-32
AFR696C11422613392e-32
CAGL0M02519g7563563344e-32
Scas_644.157262873326e-32
CAGL0K08514g14892073356e-32
Kwal_26.87098292983336e-32
Kwal_26.87967962593292e-31
AAR009W4532513193e-31
KLLA0E01584g4152703174e-31
KLLA0F11143g8132603264e-31
CAGL0K05709g11032633266e-31
Scas_618.84272523141e-30
KLLA0C01650g11122613231e-30
CAGL0L07326g5062843162e-30
KLLA0F23155g4272563113e-30
Scas_613.55172893135e-30
KLLA0F11319g8432483168e-30
Scas_700.546982603141e-29
CAGL0L11550g10722603161e-29
ACR142W8372613141e-29
KLLA0F09031g6331693112e-29
YDR507C (GIN4)11422643142e-29
Scas_707.315981453133e-29
YGL158W (RCK1)5123583063e-29
Scas_693.1710492903123e-29
KLLA0F19536g11043043114e-29
ACL104C9472773096e-29
CAGL0F04741g4422473017e-29
Scas_564.712102733099e-29
AGR058W10712833071e-28
KLLA0D07348g9092513071e-28
AFR724C4402652981e-28
Scas_493.211172643062e-28
ACR218W15691453053e-28
ACR133C8512873033e-28
YFR014C (CMK1)4462462954e-28
CAGL0M02233g7673183016e-28
CAGL0B01925g9442703016e-28
YCL024W (KCC4)10372663017e-28
CAGL0K10604g4462472937e-28
CAGL0K12562g16821523011e-27
CAGL0M11396g11922732991e-27
Scas_201.1*2742302821e-27
Scas_580.610152602982e-27
Scas_713.79832542972e-27
ACR119W9312942963e-27
YFL033C (RIM15)17701462973e-27
CAGL0I09504g5282712913e-27
Kwal_33.131125053232903e-27
CAGL0B03509g5972222923e-27
CAGL0C05005g10762712945e-27
YHR102W (KIC1)10802602937e-27
KLLA0C04191g7972452918e-27
Scas_640.14*7282792891e-26
AER223C9022802902e-26
Kwal_23.35904992832842e-26
AFL188C4723332832e-26
CAGL0M02299g8932542892e-26
Scas_573.105693182853e-26
Kwal_14.115915211452893e-26
YDR122W (KIN1)10642722873e-26
Kwal_0.1555873002843e-26
KLLA0E21780g10162452864e-26
Scas_673.20*7582562846e-26
KLLA0F09020g9281542812e-25
Kwal_26.87518482692802e-25
YJL128C (PBS2)6682932792e-25
Scas_700.288962482793e-25
Kwal_47.172528723542784e-25
Kwal_56.237178581852741e-24
Kwal_55.215458652482741e-24
Kwal_27.97638682412722e-24
YDR523C (SPS1)4902562672e-24
YAR019C (CDC15)9742582661e-23
Kwal_23.632515422572671e-23
AAL029W5342132621e-23
AER264C14832562624e-23
KLLA0C08525g15512592625e-23
Scas_685.245152702567e-23
CAGL0L05632g6772932587e-23
Scas_675.25272602568e-23
KLLA0C00979g4832682549e-23
Scas_618.156203212552e-22
Kwal_14.24974181882502e-22
Scas_582.16382942542e-22
Kwal_47.1726311273402562e-22
CAGL0F00649g5143072495e-22
YGL180W (ATG1)8972872525e-22
KLLA0F12188g5462132496e-22
CAGL0K02673g9152042526e-22
Scas_713.216412912499e-22
YHL007C (STE20)9392042472e-21
Kwal_33.141678383012472e-21
KLLA0E15378g7242942463e-21
Scas_619.5*5102822433e-21
Scas_707.369153332463e-21
CAGL0L06006g9423042463e-21
ABR014W9712072463e-21
Kwal_26.78619552072454e-21
KLLA0F01276g5192822414e-21
Kwal_33.140815802922424e-21
KLLA0B13607g9892132437e-21
CAGL0J04290g3572972357e-21
Scas_668.228932042428e-21
KLLA0C17160g8313632411e-20
ACL054W9723052411e-20
AEL185C5152762381e-20
CAGL0K02167g11623472412e-20
KLLA0F23507g4872632352e-20
AEL205W7932312382e-20
Kwal_26.87034442062342e-20
ADR379C4922822343e-20
YBL016W (FUS3)3532992293e-20
Scas_720.9416832752384e-20
KLLA0D07304g4652072316e-20
CAGL0M03729g8612042356e-20
CAGL0M10153g8672762347e-20
CAGL0H07535g2982972231e-19
Kwal_56.238414322822291e-19
ACR117W5242082301e-19
Scas_707.349053282331e-19
YCR073C (SSK22)13312642322e-19
CAGL0H01639g5212042292e-19
Scas_711.2515152672322e-19
YBR274W (CHK1)5272712282e-19
YGL179C (TOS3)5602502292e-19
Kwal_26.735514462672312e-19
CAGL0M11748g4472822263e-19
KLLA0A07403g8792042293e-19
AGR048C4532822244e-19
Kwal_23.52908191472275e-19
AFL217C6913082275e-19
Kwal_55.203267502442275e-19
ADL315C4343252226e-19
CAGL0J03828g4672092236e-19
Kwal_27.97734062892217e-19
Kwal_23.42765212592238e-19
CAGL0D02244g4872772228e-19
CAGL0I03498g4512672229e-19
KLLA0F20053g4442802219e-19
Kwal_26.715412132692251e-18
Scas_602.1111864022251e-18
Kwal_33.132221481122041e-18
CAGL0F00913g12062562232e-18
AER222C4233182182e-18
Kwal_27.125594143682173e-18
Scas_688.144793192183e-18
CAGL0J00539g4883022183e-18
Scas_598.67901472203e-18
Scas_643.2010822512204e-18
Scas_710.283522482135e-18
KLLA0B11902g4953522165e-18
Scas_713.384322822146e-18
CAGL0K01617g7742912186e-18
Scas_640.165052312157e-18
KLLA0C03828g7932582187e-18
KLLA0D09328g10463432188e-18
CAGL0E01683g3753232128e-18
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0K07458g
         (693 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0K07458g complement(736336..738450) similar to sp|P12688 Sac...  1288   0.0  
Scas_721.124                                                          776   0.0  
CAGL0K03399g complement(310487..312598) highly similar to sp|P12...   762   0.0  
Kwal_26.7635                                                          749   0.0  
Scas_717.69                                                           744   0.0  
ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C (Y...   743   0.0  
KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces...   711   0.0  
Kwal_47.16761                                                         354   e-112
ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH] complement(...   349   e-110
YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine pro...   344   e-107
Scas_703.5                                                            340   e-106
KLLA0B03586g complement(326871..329075) similar to sp|P11792 Sac...   338   e-106
CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces c...   335   e-104
Scas_689.25*                                                          272   2e-84
YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic...   266   3e-82
CAGL0M08404g complement(836791..838179) some similarities with s...   267   5e-82
KLLA0B07205g complement(624606..625973) some similarities with s...   265   5e-81
Scas_651.18                                                           262   5e-81
Kwal_33.13846                                                         262   6e-81
KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732....   276   7e-80
Kwal_27.10581                                                         273   1e-78
ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..68...   270   8e-78
CAGL0G09020g 860266..861351 highly similar to sp|P06245 Saccharo...   251   3e-77
Scas_715.34                                                           268   3e-77
Kwal_56.24059                                                         251   5e-77
AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH] complement(...   250   6e-77
KLLA0D03190g 267933..269051 highly similar to sp|P06245 Saccharo...   249   3e-76
CAGL0M09361g complement(928484..931918) highly similar to sp|P24...   266   3e-76
YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase...   263   2e-75
Scas_690.13                                                           246   3e-75
AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C (...   242   3e-73
CAGL0C03509g complement(350846..353533) similar to sp|P53739 Sac...   234   5e-66
KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1 Kluyvero...   232   7e-66
Kwal_23.6458                                                          233   1e-65
YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine pro...   230   1e-65
ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) ...   232   2e-65
Scas_629.16                                                           230   2e-64
Scas_720.103                                                          224   7e-63
CAGL0J06072g complement(572377..574698) similar to sp|P53894 Sac...   220   1e-61
Kwal_56.22788                                                         214   2e-61
KLLA0F24618g complement(2288943..2290613) similar to sp|P38070 S...   213   2e-60
YBR028C (YBR028C) [220] chr2 complement(294387..295964) Serine/t...   206   1e-58
AEL083W [2423] [Homologous to ScYBR028C - SH] complement(470964....   207   1e-58
CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces c...   205   7e-58
Scas_593.14d                                                          198   7e-56
CAGL0B04147g 402798..404498 highly similar to sp|P22204 Saccharo...   185   1e-50
Kwal_23.3992                                                          181   6e-49
AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH] (249144..25...   172   1e-47
Scas_705.23                                                           176   2e-47
CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces c...   171   3e-47
Kwal_56.24091                                                         169   1e-46
YGR092W (DBF2) [2052] chr7 (668191..669909) Serine/threonine pro...   174   2e-46
KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1 Kluyvero...   174   2e-46
YDR490C (PKH1) [1306] chr4 complement(1431956..1434256) Serine/t...   176   2e-46
ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W (...   172   6e-46
KLLA0B02332g complement(206863..207948) similar to sp|P38991 Sac...   167   7e-46
Scas_716.33                                                           172   1e-45
Kwal_56.22693                                                         173   5e-45
Kwal_33.14554                                                         169   5e-44
AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)...   168   7e-44
KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236 Saccha...   167   3e-43
KLLA0E03487g complement(323764..325707) similar to sgd|S0002874 ...   165   4e-43
CAGL0G04609g complement(437162..440059) similar to sp|Q12236 Sac...   166   1e-42
CAGL0G03047g 282299..283918 highly similar to sp|P22204 Saccharo...   160   4e-42
AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C (...   162   2e-41
CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces c...   158   7e-40
Scas_627.7                                                            149   1e-39
KLLA0F13552g complement(1252906..1256709) gi|33386566|emb|CAD877...   154   1e-38
Scas_660.20                                                           153   2e-38
YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine p...   152   2e-38
Scas_502.2                                                            152   5e-38
Kwal_47.18233                                                         145   2e-36
Kwal_47.18307                                                         145   3e-36
CAGL0M08910g complement(887703..889541) highly similar to sp|Q00...   143   1e-35
YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine p...   142   2e-35
KLLA0D07810g complement(669095..671251) gi|401646|sp|P31034|YL44...   142   3e-35
AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH] complement(...   142   3e-35
Scas_616.10                                                           142   8e-35
YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kin...   138   1e-34
Kwal_56.22476                                                         139   3e-34
CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces c...   139   4e-34
Kwal_26.7788                                                          140   4e-34
Scas_654.12                                                           139   5e-34
ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH] complement(...   139   5e-34
KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces c...   138   8e-34
AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH] complement(...   137   9e-34
ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH] complement(3...   139   1e-33
CAGL0J11638g complement(1128620..1130860) highly similar to sp|P...   136   3e-33
Scas_700.34                                                           136   4e-33
Kwal_0.96                                                             131   1e-32
KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235....   133   1e-32
CAGL0K06479g 636296..639271 some similarities with tr|Q03306 Sac...   135   1e-32
Scas_660.28                                                           133   2e-32
AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W (...   135   2e-32
CAGL0M02519g complement(290723..292993) highly similar to tr|Q03...   133   4e-32
Scas_644.15                                                           132   6e-32
CAGL0K08514g complement(853314..857783) similar to sp|P34244 Sac...   133   6e-32
Kwal_26.8709                                                          132   6e-32
Kwal_26.8796                                                          131   2e-31
AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C (C...   127   3e-31
KLLA0E01584g 149713..150960 highly similar to sp|P39009 Saccharo...   126   4e-31
KLLA0F11143g complement(1026129..1028570) similar to sp|P22216 S...   130   4e-31
CAGL0K05709g complement(555903..559214) similar to sp|Q12263 Sac...   130   6e-31
Scas_618.8                                                            125   1e-30
KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces c...   129   1e-30
CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces c...   126   2e-30
KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces...   124   3e-30
Scas_613.5                                                            125   5e-30
KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomy...   126   8e-30
Scas_700.54                                                           125   1e-29
CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces...   126   1e-29
ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH] complement...   125   1e-29
KLLA0F09031g 839103..841004 similar to sp|P43565 Saccharomyces c...   124   2e-29
YDR507C (GIN4) [1321] chr4 complement(1462346..1465774) Serine/t...   125   2e-29
Scas_707.3                                                            125   3e-29
YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine pro...   122   3e-29
Scas_693.17                                                           124   3e-29
KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces...   124   4e-29
ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH] (157357..160...   123   6e-29
CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces c...   120   7e-29
Scas_564.7                                                            123   9e-29
AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W (...   122   1e-28
KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062 Sacch...   122   1e-28
AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH] (1769897..1...   119   1e-28
Scas_493.2                                                            122   2e-28
ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH] complement...   122   3e-28
ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023) [...   121   3e-28
YFR014C (CMK1) [1695] chr6 complement(172529..173869) Calcium/ca...   118   4e-28
CAGL0M02233g complement(267332..269635) highly similar to sp|P22...   120   6e-28
CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces c...   120   6e-28
YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protei...   120   7e-28
CAGL0K10604g complement(1029226..1030566) similar to sp|P27466 S...   117   7e-28
CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces...   120   1e-27
CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces...   119   1e-27
Scas_201.1*                                                           113   1e-27
Scas_580.6                                                            119   2e-27
Scas_713.7                                                            119   2e-27
ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -...   118   3e-27
YFL033C (RIM15) [1651] chr6 complement(69113..74425) Serine/thre...   119   3e-27
CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces c...   116   3e-27
Kwal_33.13112                                                         116   3e-27
CAGL0B03509g complement(349638..351431) similar to sp|P38623 Sac...   117   3e-27
CAGL0C05005g complement(467626..470856) similar to sp|P27636 Sac...   117   5e-27
YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine pro...   117   7e-27
KLLA0C04191g 384198..386591 weakly similar to sp|P27636 Saccharo...   116   8e-27
Scas_640.14*                                                          115   1e-26
AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH] (1044971.....   116   2e-26
Kwal_23.3590                                                          114   2e-26
AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..902...   113   2e-26
CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces c...   115   2e-26
Scas_573.10                                                           114   3e-26
Kwal_14.1159                                                          115   3e-26
YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine prot...   115   3e-26
Kwal_0.155                                                            114   3e-26
KLLA0E21780g complement(1936438..1939488) similar to sp|P38692 S...   114   4e-26
Scas_673.20*                                                          114   6e-26
KLLA0F09020g 836287..839073 weakly similar to sp|P43565 Saccharo...   112   2e-25
Kwal_26.8751                                                          112   2e-25
YJL128C (PBS2) [2790] chr10 complement(178015..180021) MAP kinas...   112   2e-25
Scas_700.28                                                           112   3e-25
Kwal_47.17252                                                         111   4e-25
Kwal_56.23717                                                         110   1e-24
Kwal_55.21545                                                         110   1e-24
Kwal_27.9763                                                          109   2e-24
YDR523C (SPS1) [1335] chr4 complement(1485554..1487026) Serine/t...   107   2e-24
YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase ...   107   1e-23
Kwal_23.6325                                                          107   1e-23
AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W (R...   105   1e-23
AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C ...   105   4e-23
KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces c...   105   5e-23
Scas_685.24                                                           103   7e-23
CAGL0L05632g 610481..612514 similar to sp|P08018 Saccharomyces c...   103   7e-23
Scas_675.2                                                            103   8e-23
KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces cer...   102   9e-23
Scas_618.15                                                           102   2e-22
Kwal_14.2497                                                          100   2e-22
Scas_582.1                                                            102   2e-22
Kwal_47.17263                                                         103   2e-22
CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces cer...   100   5e-22
YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine pro...   101   5e-22
KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces...   100   6e-22
CAGL0K02673g complement(240509..243256) similar to sp|Q03497 Sac...   101   6e-22
Scas_713.21                                                           100   9e-22
YHL007C (STE20) [2279] chr8 complement(95113..97932) Serine/thre...   100   2e-21
Kwal_33.14167                                                         100   2e-21
KLLA0E15378g 1362851..1365025 some similarities with sp|P08018 S...    99   3e-21
Scas_619.5*                                                            98   3e-21
Scas_707.36                                                            99   3e-21
CAGL0L06006g complement(670707..673535) similar to sp|P53104 Sac...    99   3e-21
ABR014W [605] [Homologous to ScYHL007C (STE20) - SH] complement(...    99   3e-21
Kwal_26.7861                                                           99   4e-21
KLLA0F01276g complement(120001..121560) similar to sp|P38147 Sac...    97   4e-21
Kwal_33.14081                                                          98   4e-21
KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497 Saccha...    98   7e-21
CAGL0J04290g complement(400939..402012) similar to sp|P16892 Sac...    95   7e-21
Scas_668.22                                                            98   8e-21
KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces...    97   1e-20
ACL054W [995] [Homologous to ScYGL180W (APG1) - SH] complement(2...    97   1e-20
AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH] (291129..29...    96   1e-20
CAGL0K02167g complement(191468..194956) similar to sp|P38990 Sac...    97   2e-20
KLLA0F23507g complement(2198603..2200066) similar to sp|P24719 S...    95   2e-20
AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W (...    96   2e-20
Kwal_26.8703                                                           95   2e-20
ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH] (1386601..1...    95   3e-20
YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine prot...    93   3e-20
Scas_720.94                                                            96   4e-20
KLLA0D07304g 623352..624749 some similarities with sp|P32491 Sac...    94   6e-20
CAGL0M03729g complement(420316..422901) similar to sp|P48562 Sac...    95   6e-20
CAGL0M10153g complement(1010688..1013291) some similarities with...    95   7e-20
CAGL0H07535g 736241..737137 highly similar to sp|P00546 Saccharo...    91   1e-19
Kwal_56.23841                                                          93   1e-19
ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C (...    93   1e-19
Scas_707.34                                                            94   1e-19
YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase...    94   2e-19
CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces c...    93   2e-19
Scas_711.25                                                            94   2e-19
YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase, re...    92   2e-19
YGL179C (TOS3) [1812] chr7 complement(163413..165095) Serine/thr...    93   2e-19
Kwal_26.7355                                                           94   2e-19
CAGL0M11748g 1167306..1168649 highly similar to sp|P32485 Saccha...    92   3e-19
KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces c...    93   3e-19
AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH] (807470..80...    91   4e-19
Kwal_23.5290                                                           92   5e-19
AFL217C [2978] [Homologous to ScYJL128C (PBS2) - SH] (30765..328...    92   5e-19
Kwal_55.20326                                                          92   5e-19
ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH] (146098..14...    90   6e-19
CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces c...    91   6e-19
Kwal_27.9773                                                           90   7e-19
Kwal_23.4276                                                           91   8e-19
CAGL0D02244g complement(229504..230967) similar to sp|P24719 Sac...    90   8e-19
CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces c...    90   9e-19
KLLA0F20053g 1867209..1868543 highly similar to sp|P32485 Saccha...    90   9e-19
Kwal_26.7154                                                           91   1e-18
Scas_602.11                                                            91   1e-18
Kwal_33.13222                                                          83   1e-18
CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces ce...    91   2e-18
AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH] (1043479..1...    89   2e-18
Kwal_27.12559                                                          88   3e-18
Scas_688.14                                                            89   3e-18
CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomy...    89   3e-18
Scas_598.6                                                             89   3e-18
Scas_643.20                                                            89   4e-18
Scas_710.28                                                            87   5e-18
KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_...    88   5e-18
Scas_713.38                                                            87   6e-18
CAGL0K01617g complement(142479..144803) similar to sp|P54199 Sac...    89   6e-18
Scas_640.16                                                            87   7e-18
KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces c...    89   7e-18
KLLA0D09328g complement(788565..791705) some similarities with s...    89   8e-18
CAGL0E01683g complement(166584..167711) highly similar to sp|P21...    86   8e-18
AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -...    87   9e-18
CAGL0B02739g complement(262590..264620) similar to sp|P23561 Sac...    88   1e-17
Scas_700.35                                                            86   1e-17
Scas_683.6                                                             86   1e-17
ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) ...    88   1e-17
YDL028C (MPS1) [834] chr4 complement(400994..403288) Multi-funct...    87   1e-17
ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..2757...    85   2e-17
KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces c...    85   2e-17
CAGL0L03520g complement(401103..405446) similar to sp|Q01389 Sac...    87   3e-17
ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C (T...    87   3e-17
CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces c...    87   3e-17
Kwal_23.5576                                                           86   3e-17
KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyvero...    86   4e-17
CAGL0L12474g complement(1345044..1345952) highly similar to sp|P...    83   4e-17
Kwal_55.22001                                                          84   4e-17
YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine pr...    86   5e-17
KLLA0B13112g complement(1146006..1148198) similar to sp|P23561 S...    86   6e-17
KLLA0A02497g 218592..219680 highly similar to sp|P14681 Saccharo...    83   7e-17
Kwal_14.1416                                                           83   8e-17
KLLA0E07414g complement(672690..673787) highly similar to sp|P21...    83   9e-17
YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capab...    85   9e-17
Scas_544.6                                                             84   1e-16
YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent pro...    82   1e-16
Scas_628.9                                                             84   1e-16
KLLA0E11979g complement(1060048..1061892) some similarities with...    84   2e-16
ADR317C [2058] [Homologous to ScYDL028C (MPS1) - SH] (1263082..1...    84   2e-16
AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH] complement(...    84   2e-16
Scas_548.6                                                             84   2e-16
Scas_633.29                                                            84   2e-16
CAGL0D01694g complement(176981..178279) similar to sp|P41808 Sac...    82   2e-16
Kwal_23.5668                                                           84   2e-16
YHR030C (SLT2) [2317] chr8 complement(168882..170336) Serine/thr...    82   2e-16
Scas_568.9*                                                            80   2e-16
YDL159W (STE7) [712] chr4 (172482..174029) Serine/threonine/tyro...    82   3e-16
CAGL0I04422g 394159..395427 some similarities with sp|P22209 Sac...    82   3e-16
Kwal_17.2687                                                           81   3e-16
AFR019W [3211] [Homologous to ScYBL016W (FUS3) - SH] complement(...    81   4e-16
YGR040W (KSS1) [2006] chr7 (575400..576506) Serine/threonine pro...    81   4e-16
Scas_623.11                                                            81   4e-16
CAGL0D02002g 207419..209080 similar to sp|Q03957 Saccharomyces c...    82   4e-16
Scas_721.46                                                            80   5e-16
Kwal_27.11803                                                          79   5e-16
ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -...    80   5e-16
KLLA0D11990g join(complement(1023928..1023944), gi|2499590|sp|Q9...    80   5e-16
CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces c...    81   6e-16
YCR008W (SAT4) [542] chr3 (128467..130278) Serine/threonine prot...    81   9e-16
KLLA0B11946g complement(1048033..1049352) similar to sp|P41808 S...    80   1e-15
KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces c...    80   1e-15
Kwal_0.307                                                             80   1e-15
KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces c...    82   1e-15
AGR334W [4645] [Homologous to ScYMR291W - SH] complement(1354612...    80   1e-15
Kwal_33.13984                                                          80   2e-15
Scas_680.20                                                            80   2e-15
Scas_716.73                                                            80   2e-15
YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine prote...    81   2e-15
KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA6115...    79   2e-15
Scas_721.132                                                           80   2e-15
KLLA0E14828g complement(1323743..1324675) gi|27526973|emb|CAD369...    78   2e-15
Scas_477.5                                                             79   4e-15
CAGL0L07810g complement(857656..859446) similar to sp|P25333 Sac...    79   5e-15
ABL011C [581] [Homologous to ScYLR362W (STE11) - SH] (378259..38...    79   5e-15
Scas_336.1                                                             78   6e-15
Scas_651.3                                                             79   6e-15
KLLA0A09713g 851952..853625 similar to sp|Q03533 Saccharomyces c...    78   8e-15
Scas_635.1                                                             77   9e-15
CAGL0M13541g 1332296..1334164 similar to sp|Q03533 Saccharomyces...    78   1e-14
YAR018C (KIN3) [73] chr1 complement(170393..171700) Serine/threo...    77   1e-14
ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH] (692321..69...    77   1e-14
KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1 Kluyverom...    77   1e-14
AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919) [...    77   2e-14
Scas_667.18                                                            76   2e-14
ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C ...    75   2e-14
Kwal_56.24584                                                          76   2e-14
ABL055C [537] [Homologous to ScYKL116C (PRR1) - SH] (295497..297...    76   3e-14
ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH] (810941..8...    74   3e-14
AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH] (246896..2...    74   3e-14
KLLA0B09790g complement(855327..856214) highly similar to sp|P00...    74   4e-14
Kwal_47.17868                                                          75   4e-14
Scas_678.24                                                            76   6e-14
AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH] (805583..80...    75   6e-14
CAGL0I05896g 560169..562505 some similarities with sp|P14680 Sac...    76   6e-14
Kwal_33.13831                                                          75   6e-14
Scas_721.110                                                           75   9e-14
AER195C [2697] [Homologous to ScYCR008W (SAT4) - SH] (1005431..1...    74   9e-14
KLLA0C16577g complement(1451181..1452695) some similarities with...    74   9e-14
CAGL0H01199g 110610..115556 highly similar to sp|P15442 Saccharo...    75   1e-13
Scas_613.13*                                                           73   1e-13
Kwal_26.7682                                                           74   1e-13
KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces...    74   1e-13
CAGL0K11550g 1118142..1119758 similar to sp|P28708 Saccharomyces...    74   1e-13
Kwal_26.7552                                                           74   2e-13
YDR283C (GCN2) [1112] chr4 complement(1025062..1030041) Serine/t...    75   2e-13
CAGL0L06820g 767038..768138 highly similar to sp|P38615 Saccharo...    73   2e-13
KLLA0A05819g 541545..543659 similar to sp|P14680 Saccharomyces c...    74   2e-13
YJL141C (YAK1) [2777] chr10 complement(147885..150308) Serine/th...    72   6e-13
AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH] complement(1...    73   7e-13
Scas_689.24                                                            72   9e-13
ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH] complement...    69   1e-12
YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699) Cycli...    69   2e-12
KLLA0A02717g 245082..246380 some similarities with sp|P53233 Sac...    70   2e-12
KLLA0B07579g 659591..661759 weakly similar to sp|P32944 Saccharo...    70   4e-12
ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH] (797020..79...    70   4e-12
YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..3147...    69   4e-12
YJL187C (SWE1) [2737] chr10 complement(76802..79261) Serine/tyro...    70   4e-12
CAGL0H10318g complement(1006299..1007222) highly similar to sp|P...    68   5e-12
Scas_678.13                                                            69   5e-12
Kwal_14.1273                                                           69   5e-12
KLLA0C10802g complement(926916..931934) similar to sp|P15442 Sac...    70   6e-12
CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces c...    68   6e-12
Scas_634.5                                                             69   7e-12
Kwal_26.8347                                                           68   1e-11
Kwal_27.11919                                                          65   1e-11
AEL149C [2357] [Homologous to ScYJL187C (SWE1) - SH] (348350..35...    68   2e-11
Kwal_27.10004                                                          68   2e-11
Scas_684.28                                                            67   4e-11
ADL043C [1698] [Homologous to ScYLL019C (KNS1) - SH] (612091..61...    66   5e-11
Kwal_23.3471                                                           64   5e-11
YJL106W (IME2) [2809] chr10 (221307..223244) Serine/threonine pr...    66   6e-11
CAGL0F03245g complement(316924..320034) similar to sp|P32361 Sac...    66   7e-11
KLLA0F02838g 264329..266596 some similarities with sp|P32581 Sac...    65   9e-11
Scas_22.1                                                              63   1e-10
CAGL0K00693g complement(74637..77267) similar to sp|P32944 Sacch...    65   1e-10
CAGL0D06600g 626571..628748 similar to tr|Q12399 Saccharomyces c...    65   2e-10
KLLA0A06820g complement(615686..618004) some similarities with s...    65   2e-10
CAGL0M13167g complement(1291524..1293356) similar to sp|P32801 S...    64   2e-10
KLLA0F22297g complement(2083448..2085547) some similarities with...    64   2e-10
Scas_677.18                                                            64   3e-10
Scas_673.34*                                                           63   4e-10
ADL102C [1639] [Homologous to ScYIL035C (CKA1) - SH] (503670..50...    62   4e-10
Scas_695.33                                                            63   5e-10
Scas_568.13                                                            62   6e-10
YIL035C (CKA1) [2632] chr9 complement(287789..288907) Casein kin...    62   7e-10
Kwal_26.7276                                                           62   8e-10
AFR150C [3342] [Homologous to ScYFL029C (CAK1) - SH] (707306..70...    61   8e-10
CAGL0I06248g 600351..602792 similar to sp|P38970 Saccharomyces c...    62   9e-10
KLLA0F08877g 825217..826182 gi|27526975|emb|CAD36965.1 Kluyverom...    60   1e-09
CAGL0I05192g complement(493635..494756) highly similar to sp|P15...    60   2e-09
Scas_703.47                                                            61   2e-09
AEL118C [2388] [Homologous to ScYKL168C (KKQ8) - SH; ScYJL165C (...    60   3e-09
KLLA0F01408g 135424..136302 weakly similar to sgd|S0002183 Sacch...    59   3e-09
AFR076W [3268] [Homologous to ScYJL106W (IME2) - SH] complement(...    60   3e-09
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    60   3e-09
Scas_651.19                                                            60   4e-09
CAGL0G04455g 426386..428641 similar to sp|P32581 Saccharomyces c...    60   4e-09
CAGL0J04972g 472984..474003 some similarities with tr|Q12100 Sac...    59   5e-09
CAGL0H09152g complement(895722..898055) similar to sp|P47116 Sac...    60   6e-09
Scas_649.30                                                            59   7e-09
Kwal_47.18098                                                          58   8e-09
Kwal_47.17345                                                          59   9e-09
Scas_610.7                                                             59   9e-09
KLLA0E04136g 382874..383995 similar to sp|P15790 Saccharomyces c...    58   1e-08
AFR372W [3564] [Homologous to ScYJR059W (PTK2 ) - SH] complement...    59   1e-08
KLLA0B06501g complement(576636..579089) some similarities with s...    59   1e-08
KLLA0F01507g 144356..145774 some similarities with sp|P47042 Sac...    59   1e-08
Scas_704.50                                                            58   1e-08
Scas_711.15                                                            59   1e-08
CAGL0H01837g complement(176352..178736) tr|Q9C1R8 Candida glabra...    59   1e-08
YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threon...    58   1e-08
Kwal_55.21900                                                          58   2e-08
Kwal_27.11777                                                          58   2e-08
KLLA0D11814g complement(1007240..1009021) similar to sp|P39073 S...    58   2e-08
CAGL0I05390g complement(508677..510041) similar to sp|Q12505 Sac...    58   2e-08
Kwal_33.13681                                                          58   2e-08
Kwal_27.11830                                                          57   2e-08
Scas_648.17                                                            56   3e-08
ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH] (735828..738...    57   4e-08
KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces c...    57   4e-08
Scas_683.12                                                            56   4e-08
CAGL0I08349g complement(813728..815731) similar to sp|P23293 Sac...    57   5e-08
CAGL0H10208g complement(996853..999936) similar to sp|P38080 Sac...    57   5e-08
CAGL0L12650g 1357789..1359492 similar to sp|P39073 Saccharomyces...    56   5e-08
CAGL0H08437g complement(825191..829423) similar to sp|P22219 Sac...    56   7e-08
ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH] (1222346..1...    56   7e-08
Kwal_33.14434                                                          56   9e-08
KLLA0F26983g 2489326..2490729 some similarities with sp|P32801 S...    55   9e-08
Scas_698.37                                                            55   9e-08
CAGL0G02035g 179911..180930 highly similar to sp|P19454 Saccharo...    55   1e-07
Scas_653.25                                                            55   1e-07
CAGL0M08360g complement(833220..835520) some similarities with s...    55   1e-07
Scas_654.17                                                            55   1e-07
Kwal_55.20189                                                          55   1e-07
Scas_721.61                                                            55   1e-07
YJL165C (HAL5) [2756] chr10 complement(106887..109454) Serine/th...    55   2e-07
YDR247W (VHS1) [1081] chr4 (956005..957390) Serine/threonine pro...    54   2e-07
KLLA0F16467g 1519800..1520822 highly similar to sp|P19454 Saccha...    54   2e-07
Scas_671.16                                                            55   2e-07
ABR088C [679] [Homologous to ScYKL048C (ELM1) - SH] (546324..547...    54   2e-07
KLLA0D13266g complement(1137750..1141208) similar to sp|P32361 S...    55   2e-07
KLLA0E17127g complement(1515721..1518279) similar to sp|P38691 S...    55   2e-07
AGL249C [4063] [Homologous to ScYPL042C (SSN3) - SH] (234347..23...    54   2e-07
ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH] complement(...    54   3e-07
ADR163W [1905] [Homologous to ScYDR247W - SH; ScYPL026C (SKS1) -...    54   3e-07
Kwal_33.14192                                                          53   5e-07
Scas_697.12                                                            53   5e-07
Kwal_55.21709                                                          52   6e-07
Scas_718.90                                                            53   6e-07
ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C (P...    53   6e-07
KLLA0C03938g complement(358851..360632) some similarities with s...    53   7e-07
KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces c...    53   8e-07
KLLA0D12100g complement(1031728..1033161) some similarities with...    52   8e-07
Scas_601.6                                                             52   9e-07
CAGL0G06138g complement(585585..587204) similar to sp|P23291 Sac...    52   9e-07
Scas_458.1                                                             52   1e-06
Kwal_33.14596                                                          51   2e-06
Kwal_14.1249                                                           51   2e-06
YHR135C (YCK1) [2422] chr8 complement(372695..374311) Casein kin...    51   2e-06
CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces c...    51   2e-06
AFR040W [3232] [Homologous to ScYHR135C (YCK1) - SH; ScYNL154C (...    51   2e-06
KLLA0C07535g 658746..660620 some similarities with sgd|S0005793 ...    51   2e-06
CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces...    51   2e-06
YBR097W (VPS15) [288] chr2 (436908..441272) Serine/threonine pro...    51   3e-06
KLLA0E08371g complement(756205..758538) similar to sp|P40494 Sac...    51   3e-06
CAGL0K12496g 1218391..1219473 similar to sp|P43568 Saccharomyces...    50   3e-06
YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine ...    50   3e-06
CAGL0K11990g complement(1155395..1158370) some similarities with...    51   4e-06
YIL095W (PRK1) [2580] chr9 (183934..186366) Serine/threonine pro...    50   4e-06
CAGL0K01661g complement(146952..148400) some similarities with t...    50   4e-06
KLLA0D11044g complement(942458..944068) gi|730472|sp|P40230|RAG8...    50   4e-06
CAGL0K11275g 1093797..1095374 similar to tr|Q03785 Saccharomyces...    50   5e-06
CAGL0J05940g 560563..562023 similar to sp|P23291 Saccharomyces c...    50   5e-06
Scas_655.2                                                             50   5e-06
Kwal_27.11542                                                          50   7e-06
AGR027C [4337] [Homologous to ScYBR059C (AKL1) - SH] (763309..76...    50   7e-06
Scas_707.7                                                             49   7e-06
YHR082C (KSP1) [2372] chr8 complement(268460..271549) Serine/thr...    50   8e-06
ADL217W [1524] [Homologous to ScYIL095W (PRK1) - SH; ScYNL020C (...    49   1e-05
Kwal_33.15381                                                          49   1e-05
CAGL0G05720g complement(547617..549833) similar to sp|P22211 Sac...    49   1e-05
Scas_692.24                                                            49   1e-05
Kwal_27.10945                                                          49   1e-05
AEL173W [2333] [Homologous to ScYJL057C (IKS1) - SH] complement(...    49   1e-05
ADR293C [2034] [Homologous to ScYHR079C (IRE1) - SH] (1207023..1...    49   1e-05
KLLA0B11924g complement(1043344..1047582) similar to sp|P22219 S...    49   1e-05
Scas_584.11                                                            49   2e-05
ADR313W [2054] [Homologous to ScYDL025C - SH] complement(1255932...    48   2e-05
CAGL0F03311g complement(327599..330736) similar to sp|P38691 Sac...    48   2e-05
ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)...    48   2e-05
Scas_689.22                                                            48   3e-05
AEL179W [2327] [Homologous to NOHBY] complement(302948..303817) ...    47   3e-05
YFL029C (CAK1) [1654] chr6 complement(78053..79159) Cdk-activati...    47   3e-05
Kwal_33.13225                                                          47   4e-05
CAGL0C02893g complement(286017..287966) similar to tr|Q08732 Sac...    47   5e-05
KLLA0F18612g 1711131..1713575 some similarities with sp|P38080 S...    47   7e-05
Kwal_56.24274                                                          46   7e-05
Kwal_55.20221                                                          46   8e-05
Scas_627.4                                                             45   1e-04
Scas_661.27                                                            45   1e-04
Kwal_14.2554                                                           45   2e-04
CAGL0G02607g complement(240244..242310) similar to sp|P40494 Sac...    44   3e-04
YBR059C (AKL1) [250] chr2 complement(356821..360147) Serine/thre...    44   3e-04

>CAGL0K07458g complement(736336..738450) similar to sp|P12688
           Saccharomyces cerevisiae YKL126w or sp|P18961
           Saccharomyces cerevisiae YMR104c ser/thr-specific
           protein kinases, start by similarity
          Length = 704

 Score = 1288 bits (3334), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 630/693 (90%), Positives = 630/693 (90%)

Query: 1   MYGWKLHRFXXXXXXXXXXXXXXXXXXXXXXXXXXXXTAAGDSIFSRPSVERRDTVTAAN 60
           MYGWKLHRF                            TAAGDSIFSRPSVERRDTVTAAN
Sbjct: 1   MYGWKLHRFKFGRGKDDDSRKKKMIISSSQSSLNSADTAAGDSIFSRPSVERRDTVTAAN 60

Query: 61  GSIAPVRVSQDSYMSYFKESNENMSKFDLPSWLRSHKDXXXXXXXXXXXXXXXXXXXXXX 120
           GSIAPVRVSQDSYMSYFKESNENMSKFDLPSWLRSHKD                      
Sbjct: 61  GSIAPVRVSQDSYMSYFKESNENMSKFDLPSWLRSHKDSFSPFNSSSNSSSNLGSNRDSS 120

Query: 121 MTDVTELLNDTAFKSTPFDRIDENMHSGLLTVKVYSGSNFTMPVPITSDQGXXXXXXXXX 180
           MTDVTELLNDTAFKSTPFDRIDENMHSGLLTVKVYSGSNFTMPVPITSDQG         
Sbjct: 121 MTDVTELLNDTAFKSTPFDRIDENMHSGLLTVKVYSGSNFTMPVPITSDQGILHNLLNSS 180

Query: 181 XXXXEGDNNTYAEMEQLITQLSQVHLANQTSEEQLISNAFSSTFIPAVIKVPGHDDYPLI 240
               EGDNNTYAEMEQLITQLSQVHLANQTSEEQLISNAFSSTFIPAVIKVPGHDDYPLI
Sbjct: 181 ISSLEGDNNTYAEMEQLITQLSQVHLANQTSEEQLISNAFSSTFIPAVIKVPGHDDYPLI 240

Query: 241 YMTVEYDNTMATIYPEGGTISKPVFNKISTFDVTRKLPFLKCSVFIKIPSALLPSMRWQQ 300
           YMTVEYDNTMATIYPEGGTISKPVFNKISTFDVTRKLPFLKCSVFIKIPSALLPSMRWQQ
Sbjct: 241 YMTVEYDNTMATIYPEGGTISKPVFNKISTFDVTRKLPFLKCSVFIKIPSALLPSMRWQQ 300

Query: 301 EAALADPNMRSILETIHAGKEIFLDSFTLPVVLDMNSASNFRLFNHQWINLKQGLGTINL 360
           EAALADPNMRSILETIHAGKEIFLDSFTLPVVLDMNSASNFRLFNHQWINLKQGLGTINL
Sbjct: 301 EAALADPNMRSILETIHAGKEIFLDSFTLPVVLDMNSASNFRLFNHQWINLKQGLGTINL 360

Query: 361 TVDFKPSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVI 420
           TVDFKPSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVI
Sbjct: 361 TVDFKPSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVI 420

Query: 421 HTLAERTILARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFY 480
           HTLAERTILARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFY
Sbjct: 421 HTLAERTILARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFY 480

Query: 481 ASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPE 540
           ASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPE
Sbjct: 481 ASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPE 540

Query: 541 YLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDP 600
           YLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDP
Sbjct: 541 YLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDP 600

Query: 601 DAKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDLIWDSIWNKEYLPPFRPDVQNANDTS 660
           DAKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDLIWDSIWNKEYLPPFRPDVQNANDTS
Sbjct: 601 DAKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDLIWDSIWNKEYLPPFRPDVQNANDTS 660

Query: 661 NFDNEFTKQKPVDSVIDEYLSESVQNQFKGWSY 693
           NFDNEFTKQKPVDSVIDEYLSESVQNQFKGWSY
Sbjct: 661 NFDNEFTKQKPVDSVIDEYLSESVQNQFKGWSY 693

>Scas_721.124
          Length = 684

 Score =  776 bits (2003), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/577 (64%), Positives = 464/577 (80%), Gaps = 12/577 (2%)

Query: 122 TDVTELLNDTAFKSTPFDRIDENMH---SGLLTVKVYSGSNFTMPVPITSDQGXXXXXXX 178
           + V+++  DTA      D   +N H   SG++T+K+Y+G  FT+P PITS+Q        
Sbjct: 98  SSVSQISQDTASN----DPHPQNTHISSSGIMTIKIYNGDAFTLPFPITSNQ---QILSK 150

Query: 179 XXXXXXEGDNNTYAEMEQLITQLSQVHLANQT-SEEQLISNAFSSTFIPAVIKVPGHDDY 237
                    +    +++ L++QLS+V L NQ  +EE L+++  SS FIPA IK+PG    
Sbjct: 151 LLGSGISPPSTATPDVDTLVSQLSRVQLQNQGPAEENLLASDVSSKFIPATIKLPGSSVL 210

Query: 238 -PLIYMTVEYDNTMATIYPEGGTISKPVFNKISTFDVTRKLPFLKCSVFIKIPSALLPSM 296
            PL+Y T+E+DNT+ATI PE GT++KPVFNKISTFDVTRKLPFLK  VF +IPS LLPS 
Sbjct: 211 NPLLYFTIEFDNTVATIEPEYGTMTKPVFNKISTFDVTRKLPFLKIDVFARIPSILLPSK 270

Query: 297 RWQQEAALADPNMRSILETIHAGKEIFLDSFTLPVVLDMNSASNFRLFNHQWINLKQGLG 356
            WQQE +  D  ++ +LE I++ +++ LDSF LP+ L  ++ASN RL+NH W++L+ GLG
Sbjct: 271 MWQQEMSANDEKLKEMLEKINSNQDVHLDSFQLPINLKFDTASNIRLYNHHWVSLENGLG 330

Query: 357 TINLTVDFKPSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAK 416
            IN+++D+KPS +KP+ IDDF+LL V+GKGS+GKVMQVRKKDTQKIYALKAIRK+YIV+K
Sbjct: 331 RINISIDYKPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKAIRKAYIVSK 390

Query: 417 SEVIHTLAERTILARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISR 476
           SEV HTLAERT+LAR++CPFIVPLKF+FQ+P+KLYLVLACINGGELF+HLQ+EG FD+SR
Sbjct: 391 SEVTHTLAERTVLARIDCPFIVPLKFSFQSPDKLYLVLACINGGELFYHLQKEGRFDLSR 450

Query: 477 ARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFC 536
           +RFYA+ELL AL++LH ++V+YRDLKPENILLD QGHIALCDFGLCKLNMKD++KT TFC
Sbjct: 451 SRFYAAELLCALETLHNLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDDDKTDTFC 510

Query: 537 GTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPD 596
           GTPEYLAPE+LLG+GYTKVVDWWTLGVLLYEMLTGLPPYYDE+V +MYKKIL+ PL FPD
Sbjct: 511 GTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPD 570

Query: 597 GMDPDAKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDLIWDSIWNKEYLPPFRPDVQNA 656
           G D DAKDLL  LL+RDP RRLG NGADEIKNH FF+ L W  +  K Y+PP++P V +A
Sbjct: 571 GFDRDAKDLLIGLLSRDPTRRLGCNGADEIKNHPFFSQLSWKRLLMKGYIPPYKPPVTSA 630

Query: 657 NDTSNFDNEFTKQKPVDSVIDEYLSESVQNQFKGWSY 693
            DTSNFD EFT++KPVDSV+DE+LSESVQ QF GW+Y
Sbjct: 631 IDTSNFDQEFTREKPVDSVVDEFLSESVQKQFGGWTY 667

>CAGL0K03399g complement(310487..312598) highly similar to sp|P12688
           Saccharomyces cerevisiae YKL126w
           Serine/threonine-protein kinase, start by similarity
          Length = 703

 Score =  762 bits (1968), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/548 (64%), Positives = 444/548 (81%), Gaps = 3/548 (0%)

Query: 147 SGLLTVKVYSGSNFTMPVPITSDQGXXXXXXXXXXXXXEGDNNTYAEMEQLITQLSQVHL 206
           +G++T+KVY+G  F +P PITS++                +++T  E+E ++ ++S++ L
Sbjct: 141 TGVMTIKVYNGDGFRLPFPITSNK--KILSRLLESGIASDNHDTSLEVEAILQRISRLEL 198

Query: 207 ANQTSEEQLISNAFSSTFIPAVIKVPGHDDY-PLIYMTVEYDNTMATIYPEGGTISKPVF 265
            N  S E L+    ++  IP+ IK+P      PL+Y T+E+DNT+ATI PE GT+++P+F
Sbjct: 199 TNSNSNENLLPGDIATQSIPSTIKLPNSVPLNPLLYFTIEFDNTVATIEPESGTMAQPIF 258

Query: 266 NKISTFDVTRKLPFLKCSVFIKIPSALLPSMRWQQEAALADPNMRSILETIHAGKEIFLD 325
           NKISTFDVTRKLP L   VF++IPS LLP  +WQQE    D  ++++L+ I+  +++ LD
Sbjct: 259 NKISTFDVTRKLPQLNIDVFVRIPSILLPPKQWQQEMGAQDEKLQALLDKINTNQDVHLD 318

Query: 326 SFTLPVVLDMNSASNFRLFNHQWINLKQGLGTINLTVDFKPSYSKPVGIDDFELLTVLGK 385
           SF LPV L ++SA+  RL+NH W+ L+ GLG IN++VD+KPS +KP+ IDDF+LL V+GK
Sbjct: 319 SFQLPVNLLIDSAATIRLYNHHWVELRDGLGKINISVDYKPSRNKPLSIDDFDLLKVIGK 378

Query: 386 GSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVPLKFTFQ 445
           GS+GKVMQVRKKDT+KIYALKAIRKSYIV+KSEV HTLAERT+LAR++CPFIVPLKF+FQ
Sbjct: 379 GSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPFIVPLKFSFQ 438

Query: 446 TPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVYRDLKPEN 505
           + EKLYLVLACINGGELF+HLQREG FD+SR+RFYA+ELL ALD+LHKMDV+YRDLKPEN
Sbjct: 439 SQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPEN 498

Query: 506 ILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLL 565
           ILLD QGHIALCDFGLCKLNMKD +KT TFCGTPEYLAPE+LLG+GY+KVVDWWTLGVLL
Sbjct: 499 ILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLL 558

Query: 566 YEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRLLNRDPNRRLGANGADE 625
           YEMLTGLPPYYDENV +MYKKIL+ PL+FPDG D DAKDLL  LL+RDP RRLG NGADE
Sbjct: 559 YEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLLIGLLSRDPQRRLGYNGADE 618

Query: 626 IKNHKFFNDLIWDSIWNKEYLPPFRPDVQNANDTSNFDNEFTKQKPVDSVIDEYLSESVQ 685
           IKNH FF+ L W  +  K Y+PP++P V +A DTSNFD EFT++KP+DSV+DEYLSESVQ
Sbjct: 619 IKNHPFFSQLSWKRLLMKGYIPPYKPPVTSATDTSNFDQEFTREKPIDSVVDEYLSESVQ 678

Query: 686 NQFKGWSY 693
            QF GW+Y
Sbjct: 679 KQFGGWTY 686

>Kwal_26.7635
          Length = 691

 Score =  749 bits (1934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/658 (57%), Positives = 476/658 (72%), Gaps = 47/658 (7%)

Query: 47  RPSVERRDTVTAANGSIAPVRVSQ--------DSYMSYFKESNENMSKFDLPSWLRSHKD 98
           R SV+R++T+ A++ SIAPVR+S         DS +S  ++S     ++D          
Sbjct: 53  RESVDRKETIVASSSSIAPVRLSSEVNKFPATDSSVSTVRDSVSTSGEYD---------- 102

Query: 99  XXXXXXXXXXXXXXXXXXXXXXMTDV--TELLNDTAFKSTPFDRIDENMHSGLLTVKVYS 156
                                 M D   +  + D AF S      DE   SG++T+KVY 
Sbjct: 103 ---------------------GMYDGNGSSSVMDEAFDSNN-STTDEPNFSGIMTIKVYG 140

Query: 157 GSNFTMPVPITSDQGXXXXXXXXXXXXXEGDNNTYAEMEQLITQLSQVHLANQTSEEQLI 216
           G    +P PITS+               + D    A  ++L++ LSQ+HL++   EE LI
Sbjct: 141 GEVLRLPFPITSNVQILKKLLHSGVINQDTDE---ASADELVSSLSQLHLSDGGDEENLI 197

Query: 217 SNAFSSTFIPAVIKVPGHDDY-PLIYMTVEYDNTMATIYPEGGTISKPVFNKISTFDVTR 275
               ++ +IPA I +P   D  PL+Y T+E+DNT+ATI PE GTIS   FNKISTFDVTR
Sbjct: 198 DGNTATRYIPATITLPNSTDLNPLLYFTLEFDNTVATIEPESGTISNLTFNKISTFDVTR 257

Query: 276 KLPFLKCSVFIKIPSALLPSMRWQQEAALADPNMRSILETIHAGKEIFLDSFTLPVVLDM 335
           KL FLK  VF +IPS LLPS  WQQ  + +DP+++ IL+ I+  ++I +DS+ LP+ LD 
Sbjct: 258 KLNFLKIDVFARIPSILLPSKSWQQLNS-SDPSLKDILDRINDNQDIHIDSYNLPLTLDF 316

Query: 336 NSASNFRLFNHQWINLKQGLGTINLTVDFKPSYSKPVGIDDFELLTVLGKGSYGKVMQVR 395
           ++AS+FRL+NHQWI L QG G +NL+VD+KP+ ++ + +DDFELL V+GKGS+GKVMQVR
Sbjct: 317 DTASSFRLYNHQWIGLAQGNGKLNLSVDYKPATNRALSVDDFELLKVIGKGSFGKVMQVR 376

Query: 396 KKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVPLKFTFQTPEKLYLVLA 455
           KKDT K+YALKAIRKSYIV+KSEVIHTLAERT+LARVE PFIVPLKFTFQ+P+KLY+VLA
Sbjct: 377 KKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLA 436

Query: 456 CINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIA 515
            INGGELF+HLQREG F +SRAR Y +ELL AL++LH +DV+YRDLKPENILLD QGHIA
Sbjct: 437 FINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIA 496

Query: 516 LCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPY 575
           LCDFGLCKLNMK  +KT+TFCGTPEYLAPE+LLG+GY+KVVDWWTLGVLLYEM+TGLPPY
Sbjct: 497 LCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPY 556

Query: 576 YDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDL 635
           YDE+V +MYKKIL+ PL FPDG D DAKDLL  LL+RDP RRLG NGADEIK+H FF+ L
Sbjct: 557 YDEDVPKMYKKILQEPLRFPDGFDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQL 616

Query: 636 IWDSIWNKEYLPPFRPDVQNANDTSNFDNEFTKQKPVDSVIDEYLSESVQNQFKGWSY 693
            W  +W K Y+PP++P V N+ DTSNFD EFTK+ PVDSV++++LSESVQ QF GW+Y
Sbjct: 617 SWKRLWMKGYIPPYKPPVMNSLDTSNFDQEFTKELPVDSVVNDFLSESVQQQFGGWTY 674

>Scas_717.69
          Length = 674

 Score =  744 bits (1921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/550 (63%), Positives = 439/550 (79%), Gaps = 5/550 (0%)

Query: 147 SGLLTVKVYSGSNFTMPVPITSDQGXXXXXXXXXXXXXEGDNNTYAEMEQLITQLSQVHL 206
           +G++T+KVY+G  F +PV ITS++                  N   E++ LI++LS++ L
Sbjct: 114 AGIMTIKVYNGEGFILPVSITSNE--TILSRLLSSGINSAHVNLSNEVDALISRLSRMQL 171

Query: 207 --ANQTSEEQLISNAFSSTFIPAVIKVPGHDDY-PLIYMTVEYDNTMATIYPEGGTISKP 263
             +    EE+LI+    + +IPA +K+PG +   PL+Y T+E+DNT+ATI PE G ++ P
Sbjct: 172 ETSRNIQEEKLINGETCTKYIPATVKLPGSNRLNPLLYFTIEFDNTVATIEPEYGLMADP 231

Query: 264 VFNKISTFDVTRKLPFLKCSVFIKIPSALLPSMRWQQEAALADPNMRSILETIHAGKEIF 323
           VFNKISTFDVTRKLP+LK  VF +IPS LLPS  WQQ  +  D  M+ IL+ I++ +++ 
Sbjct: 232 VFNKISTFDVTRKLPYLKIDVFARIPSILLPSKLWQQTQSEHDSRMKVILDKINSNQDVH 291

Query: 324 LDSFTLPVVLDMNSASNFRLFNHQWINLKQGLGTINLTVDFKPSYSKPVGIDDFELLTVL 383
           LDS  +P+ L  +SA+N RL+NH W+ L+  LG IN++VD+KPS +K + IDDF+LL V+
Sbjct: 292 LDSLQIPINLKFDSAANIRLYNHHWVTLENTLGRINISVDYKPSKNKRLTIDDFDLLKVI 351

Query: 384 GKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVPLKFT 443
           GKGS+GKVMQVRK+DTQKIYALKAIRKSYIV+KSEV HTLAERT+LARV CPFIVPLKF+
Sbjct: 352 GKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPFIVPLKFS 411

Query: 444 FQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVYRDLKP 503
           FQ+PEKLYLVLACINGGELF+HLQ+EG F++SRARFY +ELL AL++LH +DV+YRDLKP
Sbjct: 412 FQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLDVIYRDLKP 471

Query: 504 ENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGV 563
           ENILLD QGHIALCDFGLCKLNMKD +KT TFCGTPEYLAPE+LL +GY+KVVDWWTLG+
Sbjct: 472 ENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGI 531

Query: 564 LLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRLLNRDPNRRLGANGA 623
           LLYEMLTGLPPYYDE+V +MY+KIL+ PL FP+G D DAKDLL  LL+RDP+RRLG NGA
Sbjct: 532 LLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAKDLLIGLLSRDPDRRLGCNGA 591

Query: 624 DEIKNHKFFNDLIWDSIWNKEYLPPFRPDVQNANDTSNFDNEFTKQKPVDSVIDEYLSES 683
            EIKNH FF+ L W  +WNK Y+PP++P V +A DT NFD EFTK+KP+DSV+DEYLSES
Sbjct: 592 HEIKNHPFFSQLSWKRLWNKGYIPPYKPPVSDAADTRNFDQEFTKEKPIDSVVDEYLSES 651

Query: 684 VQNQFKGWSY 693
           VQ QF GW+Y
Sbjct: 652 VQKQFGGWTY 661

>ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C
           (YPK2) - SH] complement(345955..348123) [2169 bp, 722
           aa]
          Length = 722

 Score =  743 bits (1918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/650 (56%), Positives = 479/650 (73%), Gaps = 18/650 (2%)

Query: 47  RPSVERRDTVTAANGSIAPVRVSQDSYMSYFKESNENMSKFDLPSWLRSHKDXXXXXXXX 106
           R S +R++T+ A   SIAPVR+S D     +   NE +    +PS  R            
Sbjct: 71  RTSKDRKETIVATANSIAPVRLSTDVAAPGW--PNEGVQS-SVPSSFRDAGSETTDVGDE 127

Query: 107 XXXXXXXXXXXXXXMTDVTELLNDTAFKSTPFDRIDENM--HSGLLTVKVYSGSNFTMPV 164
                            V E  N ++  S   +R + +M   +G++T+KVY+G++F +P 
Sbjct: 128 ERAGTSSGSV-------VPEQANHSS-ASVSEERGEASMVNSTGIMTIKVYNGNSFKLPF 179

Query: 165 PITSDQGXXXXXXXXXXXXXEGDNNTYAEMEQLITQLSQVHLANQTSEEQLISNAFSSTF 224
            +TS+                      + +++LI+ + QV L+    E++L+    ++ +
Sbjct: 180 ALTSNPQILGKLLSSGVNAIS--RTGRSSVDELISSVEQVTLSED--EDKLLPGDAATNY 235

Query: 225 IPAVIKVPGHDDY-PLIYMTVEYDNTMATIYPEGGTISKPVFNKISTFDVTRKLPFLKCS 283
           IPA IK+P  +D  PLIY+T+E+DNT+ATI PE G +  PVFNKISTFDVTRKLP+LK +
Sbjct: 236 IPATIKLPDSEDLNPLIYLTIEFDNTVATIEPECGNLKSPVFNKISTFDVTRKLPYLKVN 295

Query: 284 VFIKIPSALLPSMRWQQEAALADPNMRSILETIHAGKEIFLDSFTLPVVLDMNSASNFRL 343
           VF++IPS LLPS  WQQ  A  DP ++ +L+ +++  ++ LDSF LP+ L  NSA++ RL
Sbjct: 296 VFVRIPSILLPSKAWQQVYAAQDPELQDLLKKVNSNMDVQLDSFQLPLNLQFNSATSIRL 355

Query: 344 FNHQWINLKQGLGTINLTVDFKPSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIY 403
           +NHQW+N+++GLG +N+T+D+KPS +KP+ IDDF+LL V+GKGS+GKVMQV+KKDT KIY
Sbjct: 356 YNHQWLNMEKGLGRVNITIDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIY 415

Query: 404 ALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVPLKFTFQTPEKLYLVLACINGGELF 463
           ALKAIRKSYIV+KSEV HTLAERT+LARV+ PFIVPLKF+FQ+PEKLYLVLA INGGELF
Sbjct: 416 ALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELF 475

Query: 464 HHLQREGIFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCK 523
            HLQ+EG FD+SRARFY +ELL AL++LH ++V+YRDLKPENILLD QGHIALCDFGLCK
Sbjct: 476 FHLQKEGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCK 535

Query: 524 LNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEM 583
           LNMKD +KT+TFCGTPEYLAPE+LLG+GY+KVVDWWTLGVLLYEMLTGLPPYYDE+V +M
Sbjct: 536 LNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKM 595

Query: 584 YKKILKSPLIFPDGMDPDAKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDLIWDSIWNK 643
           YKKIL+ PL FPDG D +AK+LL  LL RDP RRLG NGADEIK H FF+ L W  +W K
Sbjct: 596 YKKILQEPLRFPDGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSWKRLWMK 655

Query: 644 EYLPPFRPDVQNANDTSNFDNEFTKQKPVDSVIDEYLSESVQNQFKGWSY 693
            Y+PP++P V +A DTSNFD EFT++KPVDSV++++LSESVQ QF GW+Y
Sbjct: 656 GYIPPYKPPVMSALDTSNFDQEFTREKPVDSVVNDFLSESVQQQFGGWTY 705

>KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces
           cerevisiae YKL126w YPK1 ser/thr-specific protein kinase,
           start by similarity
          Length = 716

 Score =  711 bits (1836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/555 (62%), Positives = 429/555 (77%), Gaps = 7/555 (1%)

Query: 142 DENMHS--GLLTVKVYSGSNFTMPVPITSDQGXXXXXXXXXXXXXEGDNNTYAEMEQLIT 199
           +EN HS  G+LTVKVYSG +F +P+PIT ++                       +E+LI 
Sbjct: 148 NENTHSSNGILTVKVYSGDSFKLPLPITYNEQVLSKLLSSGVDVTS--TTQQDSLEELIQ 205

Query: 200 QLSQVHLANQTSEEQLISNAFSSTFIPAVIKVPGHDDY-PLIYMTVEYDNTMATIYPEGG 258
            +  + L  +  E++L+S   +S FIPA + +PG  +   L+Y T+E+DNT+ATI PE G
Sbjct: 206 SMHGLSLLRE--EDKLLSGEDASHFIPASVILPGSKNLNSLLYFTIEFDNTIATIEPESG 263

Query: 259 TISKPVFNKISTFDVTRKLPFLKCSVFIKIPSALLPSMRWQQEAALADPNMRSILETIHA 318
           T+++P+FNKISTFDVTR+LPFLK  VF +IPS LLPS  WQ+     +  +   ++ I  
Sbjct: 264 TLNRPIFNKISTFDVTRRLPFLKIDVFARIPSILLPSQNWQETQISNNDILGDYVKKIRN 323

Query: 319 GKEIFLDSFTLPVVLDMNSASNFRLFNHQWINLKQGLGTINLTVDFKPSYSKPVGIDDFE 378
             +I LDSF LP+ L ++SASN RL+NH WI L+  +G +NL+VD+KPS  K + IDDF+
Sbjct: 324 NSDIHLDSFHLPLNLKIDSASNIRLYNHHWIELESKMGKLNLSVDYKPSTHKHLSIDDFD 383

Query: 379 LLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPFIV 438
           LL V+GKGS+GKVMQVRK+DT KIYALKAIRKSYIV+KSEV HTLAERT+LARV+ PFIV
Sbjct: 384 LLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIV 443

Query: 439 PLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVY 498
           PLKF+FQ+ EKLYLVLA INGGELF+HLQREG FD+SR+RFY +ELL AL++LH  D++Y
Sbjct: 444 PLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDIIY 503

Query: 499 RDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKVVDW 558
           RDLKPENILLD QGHIALCDFGLCKLNMKD EKT+TFCGTPEYLAPE+LLG+GYTKVVDW
Sbjct: 504 RDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVVDW 563

Query: 559 WTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRLLNRDPNRRL 618
           WTLGVLLYEMLTGLPPYYDE+V +MYKKIL+ PL FPD  D DAKDLL  LL RDP RRL
Sbjct: 564 WTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIGLLCRDPKRRL 623

Query: 619 GANGADEIKNHKFFNDLIWDSIWNKEYLPPFRPDVQNANDTSNFDNEFTKQKPVDSVIDE 678
           G +G+DEIK+H FFN L W  +  K Y+PP++P V  A DTSNFD EFT+++PVDSV+++
Sbjct: 624 GYHGSDEIKSHPFFNQLSWKRLKMKGYIPPYKPPVMGAMDTSNFDQEFTREQPVDSVVND 683

Query: 679 YLSESVQNQFKGWSY 693
           +LSESVQ QF GW+Y
Sbjct: 684 FLSESVQQQFGGWTY 698

>Kwal_47.16761
          Length = 744

 Score =  354 bits (909), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 187/392 (47%), Positives = 261/392 (66%), Gaps = 22/392 (5%)

Query: 318 AGKEIFLDSFTLPVVLDMNSASNFRLFNHQWINLKQGL------GTINLTVDFKPSYSKP 371
           A  ++FL    L   L+  S SN    + QW  L+  +      G I++  DFK +  + 
Sbjct: 273 AHDDMFLGQVRLRPNLESFSHSN----HEQWYKLQSRIVGESVTGHISVKWDFKATMKQH 328

Query: 372 VGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILAR 431
            G  DFE+L +LGKG++G+V QVRKKDT++IYA+K + K  IV K+E+ HT+ ER IL R
Sbjct: 329 YGPQDFEVLRLLGKGTFGQVYQVRKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILVR 388

Query: 432 V---ECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLAL 488
                CPFIV LKF+FQTP  LYLV   ++GGELF HLQ+EG F   RARFY +EL+LAL
Sbjct: 389 TASKSCPFIVGLKFSFQTPADLYLVTDFMSGGELFWHLQKEGRFAEDRARFYIAELVLAL 448

Query: 489 DSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLL 548
           + LH+ D+VYRDLKPENILLD+ G+IALCDFGL K ++KD  +T+TFCGT EYLAPE+LL
Sbjct: 449 EYLHENDIVYRDLKPENILLDANGNIALCDFGLSKADLKD--RTNTFCGTTEYLAPELLL 506

Query: 549 GK-GYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFP-DGMDPDAKDLL 606
            + GYTK+VD+W+LGVL++EM  G  P++ E+  +MY+KI    + FP D + P+ +  +
Sbjct: 507 DESGYTKMVDFWSLGVLIFEMCCGWSPFFAEDNQKMYQKIAFGKVKFPRDVLSPEGRSFV 566

Query: 607 KRLLNRDPNRRLGA-NGADEIKNHKFFNDLIWDSIWNKEYLPPFRPDVQNANDTSNFDNE 665
           K LLNR+P  RLGA +   E++ H FF ++ W+++  K+  PPF+P +    DTSNFD E
Sbjct: 567 KGLLNRNPRHRLGAIDDGRELRAHPFFAEIDWEALRQKKIPPPFKPHLTGETDTSNFDPE 626

Query: 666 FTKQKPV----DSVIDEYLSESVQNQFKGWSY 693
           FT+          +    LS ++Q +F G+++
Sbjct: 627 FTQTSTSFMNKQGIAATPLSPAMQAKFVGFTF 658

>ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH]
           complement(27643..29778) [2136 bp, 711 aa]
          Length = 711

 Score =  349 bits (895), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 191/415 (46%), Positives = 266/415 (64%), Gaps = 26/415 (6%)

Query: 298 WQQEAALADPNMRSILETIHAGKEIFLDSFTLPVVLDMNSASNFRLFNHQWINLKQGL-- 355
           W  E        RS LE I        D F   V L  N+ +   + N QW  L      
Sbjct: 221 WHHETTFDVIGARSELE-ISVYDAAHGDVFLGQVRLRPNTHTKHDVHN-QWSKLNGRTVG 278

Query: 356 ----GTINLTVDFKPSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKS 411
               G I +  ++  +  +  G  DFE+L +LGKG++G+V QVRKKDT++IYA+K + K 
Sbjct: 279 ESVSGEILVRWEYWHTEKRHYGPQDFEVLRLLGKGTFGQVYQVRKKDTKRIYAMKVLSKK 338

Query: 412 YIVAKSEVIHTLAERTILARV---ECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQR 468
            IV K+E+ HT+ ER IL R     CPFIV LKF+FQTP  LYLV   ++GGELF HLQ+
Sbjct: 339 VIVKKNEIAHTIGERNILVRTASKSCPFIVGLKFSFQTPTDLYLVTDFLSGGELFWHLQK 398

Query: 469 EGIFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKD 528
           EG F   RA+FY +EL+LAL+ LH  D+VYRDLKPENILLD+ G+IALCDFGL K ++KD
Sbjct: 399 EGRFTEERAKFYIAELVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLKD 458

Query: 529 NEKTSTFCGTPEYLAPEVLLGK-GYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKI 587
             +T+TFCGT EYLAPE+LL + GYTK+VD+W+LGVL++EM  G  P++ E+  +MY+KI
Sbjct: 459 --RTNTFCGTTEYLAPELLLDETGYTKMVDFWSLGVLIFEMCCGWSPFFAEDNQKMYQKI 516

Query: 588 LKSPLIFP-DGMDPDAKDLLKRLLNRDPNRRLGA-NGADEIKNHKFFNDLIWDSIWNKEY 645
               + FP D + P+ +  +K LLNR+P  RLGA N   E++ H F +D+ W+++ NK+ 
Sbjct: 517 AFGKVKFPRDVLSPEGRSFVKGLLNRNPKHRLGAVNDGAEVRAHPFLSDIDWEALRNKQI 576

Query: 646 LPPFRPDVQNANDTSNFDNEFTK-------QKPVDSVIDEYLSESVQNQFKGWSY 693
            PPF+P + +  DTSNFD EFT+       ++P+ +     LS ++Q +F G+++
Sbjct: 577 PPPFKPHLTSETDTSNFDPEFTQTSTSFMNKQPIAATP---LSPAMQAKFAGFTF 628

>YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway that is probably
           parallel to cAMP pathway, affects life span [2475 bp,
           824 aa]
          Length = 824

 Score =  344 bits (883), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 187/397 (47%), Positives = 262/397 (65%), Gaps = 30/397 (7%)

Query: 318 AGKEIFLDSFTL-PVVLDMNSASNFRLFNHQWINLKQGL------GTINLTVDFKPSYSK 370
           A   +FL    L P++ ++  AS      HQW +LK  +      G I +   +K +  +
Sbjct: 351 AHDHMFLGQVRLYPMIHNLAHASQ-----HQWHSLKPRVIDEVVSGDILIKWTYKQTKKR 405

Query: 371 PVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTIL- 429
             G  DFE+L +LGKG++G+V QV+KKDTQ+IYA+K + K  IV K+E+ HT+ ER IL 
Sbjct: 406 HYGPQDFEVLRLLGKGTFGQVYQVKKKDTQRIYAMKVLSKKVIVKKNEIAHTIGERNILV 465

Query: 430 --ARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLA 487
             A    PFIV LKF+FQTP  LYLV   ++GGELF HLQ+EG F   RA+FY +EL+LA
Sbjct: 466 TTASKSSPFIVGLKFSFQTPTDLYLVTDYMSGGELFWHLQKEGRFSEDRAKFYIAELVLA 525

Query: 488 LDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVL 547
           L+ LH  D+VYRDLKPENILLD+ G+IALCDFGL K ++KD  +T+TFCGT EYLAPE+L
Sbjct: 526 LEHLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLKD--RTNTFCGTTEYLAPELL 583

Query: 548 LGK-GYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFP-DGMDPDAKDL 605
           L + GYTK+VD+W+LGVL++EM  G  P++ EN  +MY+KI    + FP D +  + +  
Sbjct: 584 LDETGYTKMVDFWSLGVLIFEMCCGWSPFFAENNQKMYQKIAFGKVKFPRDVLSQEGRSF 643

Query: 606 LKRLLNRDPNRRLGA-NGADEIKNHKFFNDLIWDSIWNKEYLPPFRPDVQNANDTSNFDN 664
           +K LLNR+P  RLGA +   E++ H FF D+ W+++  K+  PPF+P + +  DTSNFD 
Sbjct: 644 VKGLLNRNPKHRLGAIDDGRELRAHPFFADIDWEALKQKKIPPPFKPHLVSETDTSNFDP 703

Query: 665 EFT--------KQKPVDSVIDEYLSESVQNQFKGWSY 693
           EFT        K +P+ +     LS ++Q +F G+++
Sbjct: 704 EFTTASTSYMNKHQPMMTATP--LSPAMQAKFAGFTF 738

>Scas_703.5
          Length = 749

 Score =  340 bits (873), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 179/367 (48%), Positives = 250/367 (68%), Gaps = 25/367 (6%)

Query: 347 QWINLKQGLGTINLTVD------FKPSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQ 400
           +W  LK  +   N+T D      +  +  +  G +DFE+L +LGKG++G+V QV+KKDT+
Sbjct: 308 KWYPLKSRVLDENVTGDILIKWEYSSTKKRHYGPNDFEVLRLLGKGTFGQVYQVKKKDTK 367

Query: 401 KIYALKAIRKSYIVAKSEVIHTLAERTIL---ARVECPFIVPLKFTFQTPEKLYLVLACI 457
           +IYA+K + K  IV K+EV HT+ ER IL   A    PFIV LKF+FQTP  LYLV   +
Sbjct: 368 RIYAMKVLSKKVIVKKNEVAHTIGERNILVTTATKASPFIVGLKFSFQTPTDLYLVTDFM 427

Query: 458 NGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALC 517
           +GGELF HLQ+EG F   RA+FY +EL+LAL+ LH  D+VYRDLKPENILLD+ G+IALC
Sbjct: 428 SGGELFWHLQKEGRFTEERAKFYIAELVLALEYLHDNDIVYRDLKPENILLDANGNIALC 487

Query: 518 DFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGK-GYTKVVDWWTLGVLLYEMLTGLPPYY 576
           DFGL K ++KD  +T+TFCGT EYLAPE+LL + GYTK+VD+W+LGVL++EM  G  P++
Sbjct: 488 DFGLSKADLKD--RTNTFCGTTEYLAPELLLDEAGYTKMVDFWSLGVLIFEMCCGWSPFF 545

Query: 577 DENVSEMYKKILKSPLIFP-DGMDPDAKDLLKRLLNRDPNRRLGA-NGADEIKNHKFFND 634
            E+  +MY+KI    + FP D + P+ +  +K LLNR+P  RLGA +   E++ H FF D
Sbjct: 546 AEDNQKMYQKIAFGKVKFPRDVLSPEGRSFVKGLLNRNPKHRLGAIDDGRELRAHPFFAD 605

Query: 635 LIWDSIWNKEYLPPFRPDVQNANDTSNFDNEFT--------KQKPVDSVIDEYLSESVQN 686
           + WD++  K+  PPF+P + +  DTSNFD EFT        K +P+ +     LS ++Q 
Sbjct: 606 IDWDALREKKIPPPFKPHLVSETDTSNFDPEFTQTSTSYMNKHQPIAATP---LSPAMQA 662

Query: 687 QFKGWSY 693
           +F G+++
Sbjct: 663 KFAGFTF 669

>KLLA0B03586g complement(326871..329075) similar to sp|P11792
           Saccharomyces cerevisiae YHR205w SCH9 serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway, start by similarity
          Length = 734

 Score =  338 bits (867), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 172/351 (49%), Positives = 244/351 (69%), Gaps = 18/351 (5%)

Query: 356 GTINLTVDFKPSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVA 415
           G I +  ++  +  +  G  DFE+L +LGKG++G+V QVRKKDT +IYA+K + K  IV 
Sbjct: 304 GDILIHWEYTSTKKRQYGPQDFEVLRLLGKGTFGQVYQVRKKDTMRIYAMKVLSKKVIVK 363

Query: 416 KSEVIHTLAERTILARV---ECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIF 472
           K+E+ HT+ ER IL R      PFIV LKF+FQTP  LYLV   ++GGELF HLQ+EG F
Sbjct: 364 KNEIAHTIGERNILVRTASKSSPFIVGLKFSFQTPTDLYLVTDFMSGGELFWHLQKEGRF 423

Query: 473 DISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKT 532
              RA+FY +EL+LAL+ LH  D+VYRDLKPENILLD+ G+IALCDFGL K ++KD  +T
Sbjct: 424 TEDRAKFYIAELVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLKD--RT 481

Query: 533 STFCGTPEYLAPEVLLGK-GYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSP 591
           +TFCGT EYLAPE+L+ + GYTK+VD+W+LGVL++EM  G  P++  +  +MY+KI    
Sbjct: 482 NTFCGTTEYLAPELLMDETGYTKMVDFWSLGVLIFEMCCGWSPFFASDNQKMYQKIAFGK 541

Query: 592 LIFP-DGMDPDAKDLLKRLLNRDPNRRLGA-NGADEIKNHKFFNDLIWDSIWNKEYLPPF 649
           + FP D + P+ +  +K LLNR+P  RLGA +   E++ H FFND+ W+++  K+  PPF
Sbjct: 542 VKFPRDVLSPEGRSFVKGLLNRNPKHRLGAIDDGRELRAHPFFNDIDWEAVRQKKIPPPF 601

Query: 650 RPDVQNANDTSNFDNEFTK-------QKPVDSVIDEYLSESVQNQFKGWSY 693
           +P + +  DTSNFD EFT+       ++P+ +     LS ++Q +F G+++
Sbjct: 602 KPHLISETDTSNFDPEFTQTSTSFMNKQPIAATP---LSPAMQAKFVGFTF 649

>CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces
           cerevisiae YHR205w SCH9 serine/threonine protein kinase,
           start by similarity
          Length = 746

 Score =  335 bits (860), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 181/388 (46%), Positives = 254/388 (65%), Gaps = 23/388 (5%)

Query: 325 DSFTLPVVLDMNSASNFRLFNHQWINLKQGL------GTINLTVDFKPSYSKPVGIDDFE 378
           D F   V L  N  +   + + QW  L+  +      G I +   +  +  +  G  DFE
Sbjct: 282 DMFLGQVRLRPNIHTTSNMSHEQWYPLQSRVMDEKITGEILVKWHYTLTKKRHYGPQDFE 341

Query: 379 LLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVEC---P 435
           +L +LGKG++G+V QV+KKDT++IYA+K + K  IV K+E+ HT+ ER IL        P
Sbjct: 342 VLRLLGKGTFGQVYQVKKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILVTTSSKASP 401

Query: 436 FIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMD 495
           FIV LKF+FQTP  LYLV   ++GGELF HLQREG F   RA+FY +EL+LAL+ LH  D
Sbjct: 402 FIVGLKFSFQTPTDLYLVTDYMSGGELFWHLQREGRFTEDRAKFYIAELVLALEHLHDND 461

Query: 496 VVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGK-GYTK 554
           +VYRDLKPENILLD+ G+IALCDFGL K ++KD  +T+TFCGT EYLAPE+LL + GYTK
Sbjct: 462 IVYRDLKPENILLDANGNIALCDFGLSKADLKD--RTNTFCGTTEYLAPELLLDESGYTK 519

Query: 555 VVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFP-DGMDPDAKDLLKRLLNRD 613
           +VD+W+LGVL++EM  G  P+Y E+  +MY+KI    + FP D + P+ +  +K LLNR+
Sbjct: 520 MVDFWSLGVLIFEMCCGWSPFYAEDNQKMYQKIAFGKVKFPRDILSPEGRSFVKGLLNRN 579

Query: 614 PNRRLGA-NGADEIKNHKFFNDLIWDSIWNKEYLPPFRPDVQNANDTSNFDNEFTKQKPV 672
           P  RLGA +   E++ H FF D+ W+ +  K+  PPF+P + +  DTSNFD EFT+    
Sbjct: 580 PKHRLGAIDDGRELRAHPFFADIDWELLKQKKIPPPFKPHLVSETDTSNFDPEFTQTS-- 637

Query: 673 DSVIDEY-------LSESVQNQFKGWSY 693
            S ++++       LS  +Q +F G+++
Sbjct: 638 TSYMNKHHQMAATPLSPGMQAKFAGFTF 665

>Scas_689.25*
          Length = 409

 Score =  272 bits (696), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 137/293 (46%), Positives = 187/293 (63%), Gaps = 6/293 (2%)

Query: 374 IDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVE 433
           IDDF +L   G GS+G+V  VR     + YALK ++K  +V   +V HT  ER +L+   
Sbjct: 96  IDDFNILRTSGTGSFGRVHLVRSVHNGRFYALKVLKKQTVVRLKQVEHTNDERRMLSVSV 155

Query: 434 CPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHK 493
             FIV L  TFQ  E L++++  + GGELF  L+R   F    A+FYA+E+ LALD LH 
Sbjct: 156 HAFIVRLWGTFQDSEHLFMIMDYVEGGELFSLLRRSQRFPNPVAKFYAAEVCLALDYLHS 215

Query: 494 MDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYT 553
           +D++YRDLKPEN+LLD  GHI + DFG  K      + T T CGTP+Y+APEV+  K Y 
Sbjct: 216 LDIIYRDLKPENLLLDRNGHIKVTDFGFAKYV---PDVTYTLCGTPDYIAPEVISAKPYN 272

Query: 554 KVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRLLNRD 613
           K VDWW+ G+L+YEML+G  P+YD +  + Y+ IL +PL FP    PDA+DLL RL+ RD
Sbjct: 273 KSVDWWSFGILIYEMLSGHTPFYDSSTMKTYENILNAPLKFPKYFTPDAQDLLSRLITRD 332

Query: 614 PNRRLG--ANGADEIKNHKFFNDLIWDSIWNKEYLPPFRPDVQNAN-DTSNFD 663
              RLG   NG ++IKNH +F+++IWD + ++    P+ P +Q    DTS FD
Sbjct: 333 LTERLGNLQNGTEDIKNHAWFSEVIWDKLLDRCIETPYEPPIQQGQGDTSQFD 385

>YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic
           subunit of cAMP-dependent protein kinase 1, protein
           kinase A or PKA [1194 bp, 397 aa]
          Length = 397

 Score =  266 bits (679), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 127/291 (43%), Positives = 189/291 (64%), Gaps = 6/291 (2%)

Query: 376 DFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECP 435
           +F++L  LG GS+G+V  +R +   + YA+K ++K  +V   +V HT  ER +L+ V  P
Sbjct: 86  NFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTNDERLMLSIVTHP 145

Query: 436 FIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMD 495
           FI+ +  TFQ  +++++++  I GGELF  L++   F    A+FYA+E+ LAL+ LH  D
Sbjct: 146 FIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKD 205

Query: 496 VVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKV 555
           ++YRDLKPENILLD  GHI + DFG  K      + T T CGTP+Y+APEV+  K Y K 
Sbjct: 206 IIYRDLKPENILLDKNGHIKITDFGFAKYV---PDVTYTLCGTPDYIAPEVVSTKPYNKS 262

Query: 556 VDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRLLNRDPN 615
           +DWW+ G+L+YEML G  P+YD N  + Y+KIL + L FP   + D KDLL RL+ RD +
Sbjct: 263 IDWWSFGILIYEMLAGYTPFYDSNTMKTYEKILNAELRFPPFFNEDVKDLLSRLITRDLS 322

Query: 616 RRLG--ANGADEIKNHKFFNDLIWDSIWNKEYLPPFRPDVQNAN-DTSNFD 663
           +RLG   NG +++KNH +F +++W+ + ++    P+ P +Q    DTS FD
Sbjct: 323 QRLGNLQNGTEDVKNHPWFKEVVWEKLLSRNIETPYEPPIQQGQGDTSQFD 373

>CAGL0M08404g complement(836791..838179) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3 or
           sp|P06244 Saccharomyces cerevisiae YJL164c SRA3 or
           sp|P06245 Saccharomyces cerevisiae YPL203w TPK2,
           hypothetical start
          Length = 462

 Score =  267 bits (683), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 130/293 (44%), Positives = 189/293 (64%), Gaps = 6/293 (2%)

Query: 374 IDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVE 433
           + DF++L  LG GS+G+V  +R     + YALKA++K  +V   +V HT  ER +L+ V 
Sbjct: 149 LSDFQILRTLGTGSFGRVHLIRSNHNGRFYALKALKKHTVVKLKQVEHTNDERRMLSIVS 208

Query: 434 CPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHK 493
            PFI+ +  TFQ  + +++V+  I GGELF  L++   F    A+FYA+E+ LAL+ LH 
Sbjct: 209 HPFIIRMWGTFQDSQHVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHS 268

Query: 494 MDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYT 553
            +++YRDLKPENILLD  GHI + DFG  K      + T T CGTP+Y+APEV+  K Y 
Sbjct: 269 KEIIYRDLKPENILLDKNGHIKITDFGFAKYVP---DVTYTLCGTPDYIAPEVVSTKPYN 325

Query: 554 KVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRLLNRD 613
           K VDWW+ G+L+YEML G  P+YD N  + Y+ IL S L FP    PD +DLL +L+ RD
Sbjct: 326 KSVDWWSFGILIYEMLAGYTPFYDANTMKTYEHILNSELKFPSFFHPDVQDLLSKLITRD 385

Query: 614 PNRRLG--ANGADEIKNHKFFNDLIWDSIWNKEYLPPFRPDVQNAN-DTSNFD 663
            ++RLG   NG++++KNH +F++++W+ +  +    P+ P +Q    DTS FD
Sbjct: 386 LSKRLGNLQNGSEDVKNHPWFSEVVWEKLLARYIETPYEPPIQQGQGDTSQFD 438

>KLLA0B07205g complement(624606..625973) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3
           cAMP-dependent protein kinase 3, catalytic chain,
           hypothetical start
          Length = 455

 Score =  265 bits (676), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 129/291 (44%), Positives = 189/291 (64%), Gaps = 6/291 (2%)

Query: 376 DFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECP 435
           DF++L  LG GS+G+V  VR     + YA+K ++K+ +V   +V HT  ER +L+ V  P
Sbjct: 144 DFQILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKNTVVKLKQVEHTNDERNMLSIVSHP 203

Query: 436 FIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMD 495
           FI+ +  TFQ  ++L++++  I GGELF  L++   F    A+FYA+E+ LAL+ LH   
Sbjct: 204 FIIRMWGTFQDSQQLFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKG 263

Query: 496 VVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKV 555
           ++YRDLKPENILLD  GHI L DFG  K      + T T CGTP+Y+APEV+  K Y K 
Sbjct: 264 IIYRDLKPENILLDKNGHIKLTDFGFAKYVP---DVTYTLCGTPDYIAPEVVSTKPYNKS 320

Query: 556 VDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRLLNRDPN 615
           VDWW+ GVL+YEML G  P+YD N  + Y+ IL +P+ FP     DA+DL+ +L+ RD +
Sbjct: 321 VDWWSFGVLIYEMLAGYTPFYDSNTIKTYENILNAPVRFPPFFHSDAQDLISKLITRDLS 380

Query: 616 RRLG--ANGADEIKNHKFFNDLIWDSIWNKEYLPPFRPDVQ-NANDTSNFD 663
           +RLG   NG++++KNH +F++++W+ +  K    P+ P +Q    DTS +D
Sbjct: 381 QRLGNLQNGSEDVKNHPWFSEVVWEKLLCKNIETPYEPPIQAGQGDTSQYD 431

>Scas_651.18
          Length = 371

 Score =  262 bits (669), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 129/293 (44%), Positives = 188/293 (64%), Gaps = 6/293 (2%)

Query: 374 IDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVE 433
           ++DF++L  LG GS+G+V  +R     + YALK ++K  IV   +V HT  ER +L+ V 
Sbjct: 56  LNDFQILRTLGTGSFGRVHLIRSNHNGRFYALKVLKKHTIVKLKQVEHTNDERLMLSVVS 115

Query: 434 CPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHK 493
            PF+V +  TFQ  E++++++  I GGELF  L++   F    A+FYA+E+ LAL+ LH 
Sbjct: 116 HPFLVRMWGTFQDFEQVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHS 175

Query: 494 MDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYT 553
           MD++YRDLKPENILLD  GHI + DFG  K      + T T CGTP+Y+APEV+  K Y 
Sbjct: 176 MDIIYRDLKPENILLDKNGHIKITDFGFAKYV---PDITYTLCGTPDYIAPEVVSTKPYN 232

Query: 554 KVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRLLNRD 613
           K VDWW+ G+L+YEML G  P+YD N  + Y+ IL   L FP+    D KDLL +L+ ++
Sbjct: 233 KSVDWWSFGILIYEMLAGYTPFYDSNTMKTYENILNCKLKFPNFFHDDVKDLLSKLITKN 292

Query: 614 PNRRLG--ANGADEIKNHKFFNDLIWDSIWNKEYLPPFRPDVQNAN-DTSNFD 663
              RLG   NG++++K H +F+++IW+ + ++    P+ P +Q    DTS FD
Sbjct: 293 LTERLGNLQNGSEDVKRHPWFSEVIWEKLLSRNIETPYEPPIQQGQGDTSQFD 345

>Kwal_33.13846
          Length = 375

 Score =  262 bits (669), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 126/293 (43%), Positives = 187/293 (63%), Gaps = 6/293 (2%)

Query: 374 IDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVE 433
           ++DF +L  LG GS+G+V  VR     + YA+K ++K  IV   +V HT  ER +L+ V 
Sbjct: 62  LNDFHILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKRTIVKLKQVEHTNDERRMLSVVS 121

Query: 434 CPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHK 493
            PFI+ +  TFQ  E +++++  I GGELF  L++   F    A+FYA+E+ LAL+ LH 
Sbjct: 122 HPFIIRMWGTFQDAEHVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHA 181

Query: 494 MDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYT 553
            D++YRDLKPEN+LLD  GH+ + DFG  K      + T T CGTP+Y+APEV+  K Y 
Sbjct: 182 QDIIYRDLKPENVLLDKNGHVKITDFGFAKFV---PDVTYTLCGTPDYIAPEVVSTKPYN 238

Query: 554 KVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRLLNRD 613
           K VDWW+ G+L++EML G  P+YD N  + Y+ IL + L FP     D +DLL +L+ RD
Sbjct: 239 KSVDWWSFGILIFEMLAGYTPFYDSNTMKTYENILNAELQFPPFFHSDVQDLLSQLITRD 298

Query: 614 PNRRLG--ANGADEIKNHKFFNDLIWDSIWNKEYLPPFRPDVQNAN-DTSNFD 663
            ++RLG   NG++++KNH +F++++W+ +  +    P+ P VQ    DTS +D
Sbjct: 299 LSKRLGNLKNGSEDVKNHAWFSEVVWEKLLCRNIETPYEPPVQAGQGDTSQYD 351

>KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732.1
            Kluyveromyces lactis protein kinase C, start by
            similarity
          Length = 1161

 Score =  276 bits (706), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 140/327 (42%), Positives = 203/327 (62%), Gaps = 6/327 (1%)

Query: 372  VGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTIL-- 429
            V +DDF LL VLGKG++GKV+  R K+T  + A+K ++K  I+   ++    AE+ +   
Sbjct: 829  VSLDDFILLKVLGKGNFGKVLLARSKNTSNLCAIKVLKKDNIIKNHDIESARAEKKVFLL 888

Query: 430  -ARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLAL 488
                + PF+  L  +FQT  ++Y  +  I GG+L  H+Q   +  + RA+FYA+E+LL+L
Sbjct: 889  ATETKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNRRL-SVRRAKFYAAEVLLSL 947

Query: 489  DSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLL 548
               H   V+YRDLK ENILL  +GHI + D+GLCK NM    KTSTFCGTPE++APE+L 
Sbjct: 948  KYFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDNMWYGNKTSTFCGTPEFMAPEILK 1007

Query: 549  GKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKR 608
            G+ YTK VDWWT GVLLY+ML    P+  E+  E++  IL    ++P  M  D   + + 
Sbjct: 1008 GQAYTKAVDWWTFGVLLYQMLLCQSPFSGEDEDEVFNAILTDEPLYPIDMAGDIVQIFQG 1067

Query: 609  LLNRDPNRRLGANGAD--EIKNHKFFNDLIWDSIWNKEYLPPFRPDVQNANDTSNFDNEF 666
            LL +DP +RLGA   D  EI    FF+++ +D I N    PPF P+++ A+DTS F+ EF
Sbjct: 1068 LLTKDPEKRLGAGPKDALEIMAEPFFSNINFDDILNLRVEPPFVPEIKAADDTSYFEKEF 1127

Query: 667  TKQKPVDSVIDEYLSESVQNQFKGWSY 693
            T   P  + +   LS  +Q +F+G+S+
Sbjct: 1128 TSAPPTLTPLPSVLSSVLQEEFRGFSF 1154

>Kwal_27.10581
          Length = 1154

 Score =  273 bits (697), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 134/329 (40%), Positives = 205/329 (62%), Gaps = 6/329 (1%)

Query: 370  KPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTIL 429
            + + +DDF LL VLGKG++GKV+    K+ +++ A+K ++K +I+   ++    AE+ + 
Sbjct: 820  RKISLDDFVLLKVLGKGNFGKVLLAESKNNERLCAIKVLKKDHIIKNHDIESARAEKKVF 879

Query: 430  ---ARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLL 486
                + + PF+  L  +FQT  ++Y  +  I GG+L  H+Q + +  + RA+FYA+E+LL
Sbjct: 880  LLATKAKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQRL-SVRRAKFYAAEVLL 938

Query: 487  ALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEV 546
            AL   H   V+YRDLK ENILL  +GHI + D+GLCK  M    KTSTFCGTPE++APE+
Sbjct: 939  ALKYFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDEMWYGNKTSTFCGTPEFMAPEI 998

Query: 547  LLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLL 606
            L  + YTK VDWW  GVLLY+ML    P+  E+  E++  IL    ++P  M  D   + 
Sbjct: 999  LKEQEYTKAVDWWAFGVLLYQMLLCQSPFSGEDEDEVFNAILTDEPLYPIDMAGDIVQIF 1058

Query: 607  KRLLNRDPNRRLGANGAD--EIKNHKFFNDLIWDSIWNKEYLPPFRPDVQNANDTSNFDN 664
            + LL +DP RRLGA   D  E+    FF ++++D I N    PP+ P+++ A+DTS F+ 
Sbjct: 1059 QGLLTKDPERRLGAGPRDAAEVMAEPFFRNIVFDDILNLRVQPPYIPEIKAADDTSYFEK 1118

Query: 665  EFTKQKPVDSVIDEYLSESVQNQFKGWSY 693
            EFT   P  + +   LS ++Q +F+G+S+
Sbjct: 1119 EFTSAPPTLTPLPSVLSSNLQEEFRGFSF 1147

>ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..683847)
            [3450 bp, 1149 aa]
          Length = 1149

 Score =  270 bits (690), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 133/329 (40%), Positives = 204/329 (62%), Gaps = 6/329 (1%)

Query: 370  KPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTIL 429
            + V +DDF LL VLGKG++GKV+  R K+T ++ A+K ++K +I+   ++    AE+ + 
Sbjct: 815  RKVSLDDFILLKVLGKGNFGKVLLARSKNTDRLCAIKVLKKDHIIQNHDIESARAEKKVF 874

Query: 430  ---ARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLL 486
                + + PF+  L  +FQT  ++Y  +  I GG+L  H+Q + +  + RA+FYA+E+LL
Sbjct: 875  LLATKAKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQRL-SVRRAKFYAAEVLL 933

Query: 487  ALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEV 546
            AL   H   ++YRDLK ENILL  +GHI + D+GLCK  M    +TSTFCGTPE++APE+
Sbjct: 934  ALKYFHDNGIIYRDLKLENILLTLEGHIKIADYGLCKDEMWFGNRTSTFCGTPEFMAPEI 993

Query: 547  LLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLL 606
            L  + YTK VDWW  GVLLY+ML    P+  ++  E++  IL    ++P  M  D   + 
Sbjct: 994  LREQAYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGDIVQIF 1053

Query: 607  KRLLNRDPNRRLGANGAD--EIKNHKFFNDLIWDSIWNKEYLPPFRPDVQNANDTSNFDN 664
            + LL +DP +RLGA   D  E+    FF ++ +D I N    PP+ P ++ A+DTS F+ 
Sbjct: 1054 QGLLTKDPEKRLGAGSRDALEVMEEPFFRNINFDDILNLRVEPPYIPTIKAADDTSYFEK 1113

Query: 665  EFTKQKPVDSVIDEYLSESVQNQFKGWSY 693
            EFT   P  + +   LS ++Q +F+G+S+
Sbjct: 1114 EFTAAPPTLTPLPSILSSNLQEEFRGFSF 1142

>CAGL0G09020g 860266..861351 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, hypothetical start
          Length = 361

 Score =  251 bits (642), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 126/294 (42%), Positives = 182/294 (61%), Gaps = 6/294 (2%)

Query: 374 IDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVE 433
           + DF ++  LG GS+G+V  VR     + YA+K ++K+ +V   ++ HT  ER +L  VE
Sbjct: 48  LQDFHIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKAQVVKMKQIEHTNDERRMLKLVE 107

Query: 434 CPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHK 493
            PF++ +  TFQ    L++V+  I GGELF  L++   F    A+FYA+E+ LAL+ LH 
Sbjct: 108 HPFLIRMWGTFQDSRNLFMVMDYIEGGELFTLLRKSQRFPNPVAKFYAAEVTLALEYLHF 167

Query: 494 MDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYT 553
            +++YRDLKPENILLD  GHI + DFG  K   +    T T CGTP+Y+APEV+  K Y 
Sbjct: 168 HNIIYRDLKPENILLDRNGHIKITDFGFAK---EVETVTWTLCGTPDYIAPEVIATKPYN 224

Query: 554 KVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRLLNRD 613
           K VDWW+LGVL+YEML G  P+YD    + Y+KIL   +++P   + D  DLL +LL  D
Sbjct: 225 KSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILHGKVVYPQFFNSDVIDLLSKLLTAD 284

Query: 614 PNRRLG--ANGADEIKNHKFFNDLIWDSIWNKEYLPPFRPDV-QNANDTSNFDN 664
             RR+G    GA +IK+H +F +++W+ +  K+   P+ P +     DTS FD 
Sbjct: 285 LTRRIGNLQKGAQDIKSHPWFAEVVWEKLLAKDIETPYEPPITAGVGDTSLFDQ 338

>Scas_715.34
          Length = 1150

 Score =  268 bits (686), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 134/334 (40%), Positives = 206/334 (61%), Gaps = 6/334 (1%)

Query: 365  KPSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLA 424
            + S  + V +D+F LL VLGKG++GKV+  R K+T ++ A+K ++K  I+   ++    A
Sbjct: 811  RNSKRRKVSLDNFILLKVLGKGNFGKVILSRSKNTGRLCAIKVLKKDNIIQNHDIESARA 870

Query: 425  ERTIL---ARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYA 481
            E+ +     + + PF+  L  +FQT  ++Y  +  I GG+L  H+Q + +  + RA+FYA
Sbjct: 871  EKKVFLLATKTKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQRL-SVRRAKFYA 929

Query: 482  SELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEY 541
            +E+LLAL   H   V+YRDLK ENILL  QGHI + D+GLCK  M  N KTSTFCGTPE+
Sbjct: 930  AEVLLALKYFHDNGVIYRDLKLENILLTPQGHIKIADYGLCKDEMWYNNKTSTFCGTPEF 989

Query: 542  LAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPD 601
            +APE+L  +GYT+ VDWW  GVLLY+ML    P+  ++  E++  IL    ++P  M  D
Sbjct: 990  MAPEILKEQGYTRAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGD 1049

Query: 602  AKDLLKRLLNRDPNRRLGANGAD--EIKNHKFFNDLIWDSIWNKEYLPPFRPDVQNANDT 659
               + + LL +DP  RLGA   D  E+    FF ++ ++ I N    PP+ P++++  DT
Sbjct: 1050 IVQIFQGLLTKDPENRLGAGQRDALEVMEEPFFRNINFEDILNLRVQPPYVPEIKSPEDT 1109

Query: 660  SNFDNEFTKQKPVDSVIDEYLSESVQNQFKGWSY 693
            S F++EFT   P  + +   L+ + Q +F+G+S+
Sbjct: 1110 SYFEHEFTSAPPTLTPLPSILTTTQQEEFRGFSF 1143

>Kwal_56.24059
          Length = 353

 Score =  251 bits (640), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 123/294 (41%), Positives = 186/294 (63%), Gaps = 6/294 (2%)

Query: 374 IDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVE 433
           ++DF++L  LG GS+G+V  VR     + YA+K ++K  ++   ++ HT  ER +L  V+
Sbjct: 40  LNDFQILRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKEQVIRMKQIEHTNDERRMLKLVD 99

Query: 434 CPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHK 493
            PF++ +  TFQ    L++V+  I GGELF  L++   F    A+FYA+E++LAL+ LH 
Sbjct: 100 HPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHS 159

Query: 494 MDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYT 553
            D++YRDLKPENILLD  GHI + DFG  K   + +  T T CGTP+Y+APEV+  K Y 
Sbjct: 160 HDIIYRDLKPENILLDRNGHIKITDFGFAK---EVDTVTWTLCGTPDYIAPEVIATKPYN 216

Query: 554 KVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRLLNRD 613
           K VDWW+LG+L++EML G  P+YD    + Y+KIL+  + +P    PD  DLL +L+  D
Sbjct: 217 KSVDWWSLGILIFEMLAGYTPFYDATPMKTYEKILQGKVAYPPFFHPDVVDLLCKLITSD 276

Query: 614 PNRRLG--ANGADEIKNHKFFNDLIWDSIWNKEYLPPFRPDV-QNANDTSNFDN 664
             RRLG   +G  ++K+H +F++++W+ +  K+   P+ P +     DTS FD 
Sbjct: 277 LTRRLGNLQSGPQDVKSHPWFSEVVWEKLLAKDIETPYEPPITAGVGDTSLFDQ 330

>AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH]
           complement(274336..275376) [1041 bp, 346 aa]
          Length = 346

 Score =  250 bits (639), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 124/294 (42%), Positives = 186/294 (63%), Gaps = 6/294 (2%)

Query: 374 IDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVE 433
           + DF+++  LG GS+G+V  VR     + YA+K ++K  ++   ++ HT  ER +L  VE
Sbjct: 33  LQDFQIMRTLGTGSFGRVHLVRSIHNGRYYAIKVLKKQQVIRMKQIEHTNDERRMLKVVE 92

Query: 434 CPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHK 493
            PF++ +  TFQ    L++V+  I GGELF  L++   F    A+FYA+E+ LAL+ LH 
Sbjct: 93  HPFLIRMWGTFQDARNLFIVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHA 152

Query: 494 MDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYT 553
            +++YRDLKPENILLD  GHI + DFG  K   + +  T T CGTP+Y+APEV+  K Y 
Sbjct: 153 HNIIYRDLKPENILLDRNGHIKITDFGFAK---EVDTVTWTLCGTPDYIAPEVITTKPYN 209

Query: 554 KVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRLLNRD 613
           K +DWW+LG+L++EML G  P+YD    + Y+KIL   ++FP    PDA DLL +L+  D
Sbjct: 210 KSIDWWSLGILIFEMLAGYTPFYDVTPIKTYEKILAGKVVFPPFFHPDAIDLLGKLITDD 269

Query: 614 PNRRLG--ANGADEIKNHKFFNDLIWDSIWNKEYLPPFRPDV-QNANDTSNFDN 664
             RRLG   +G+ +IK+H +F+++IW+ +  K+   P+ P +     D+S FD 
Sbjct: 270 LTRRLGNLQSGSQDIKSHPWFSEVIWEKLLAKDIETPYEPPITAGVGDSSLFDQ 323

>KLLA0D03190g 267933..269051 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, start by similarity
          Length = 372

 Score =  249 bits (637), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 125/294 (42%), Positives = 183/294 (62%), Gaps = 6/294 (2%)

Query: 374 IDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVE 433
           + DF+++  LG GS+G+V  VR     + YA+K ++K  I+   ++ HT  ER +L  VE
Sbjct: 59  LHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKHQIIRMKQIEHTNDERRMLKLVE 118

Query: 434 CPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHK 493
            PF++ +  TFQ    L++V+  I GGELF  L++   F    A+FYA+E+ LAL+ LH 
Sbjct: 119 HPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHS 178

Query: 494 MDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYT 553
            +++YRDLKPENILLD  GHI + DFG  K  +     T T CGTP+Y+APEV+  K Y 
Sbjct: 179 HNIIYRDLKPENILLDRNGHIKITDFGFAKEVIT---VTWTLCGTPDYIAPEVITTKPYN 235

Query: 554 KVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRLLNRD 613
           K VDWW+LG+L++EML G  P+YD    + Y+KIL   +++P    PD  DLL +L+  D
Sbjct: 236 KSVDWWSLGILIFEMLAGYTPFYDVTPMKTYEKILAGEVVYPPFFHPDVVDLLGKLITAD 295

Query: 614 PNRRLG--ANGADEIKNHKFFNDLIWDSIWNKEYLPPFRPDVQ-NANDTSNFDN 664
             RRLG   +G D+IK+H +F ++IW+ +  K+   P+ P +     D+S FD 
Sbjct: 296 LTRRLGNLQSGPDDIKSHPWFAEVIWEKLVAKDIETPYEPPIAVGVGDSSLFDQ 349

>CAGL0M09361g complement(928484..931918) highly similar to sp|P24583
            Saccharomyces cerevisiae YBL105c PKC1 ser/thr protein
            kinase, start by similarity
          Length = 1144

 Score =  266 bits (679), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 135/327 (41%), Positives = 202/327 (61%), Gaps = 6/327 (1%)

Query: 372  VGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTIL-- 429
            V +D+F LL VLGKG++GKV+  R K+T ++ A+K ++K  I+   ++    AE+ +   
Sbjct: 812  VSLDNFVLLKVLGKGNFGKVILSRSKNTNRLCAIKVLKKDNIIQNHDIESARAEKKVFLL 871

Query: 430  -ARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLAL 488
              + + PF+  L  +FQT  ++Y  +  I GG+L  H+Q + +  + RA+FYA+E+LLAL
Sbjct: 872  ATKTKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQRL-SVRRAKFYAAEVLLAL 930

Query: 489  DSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLL 548
               H   V+YRDLK ENILL  +GHI + D+GLCK  M    KTSTFCGTPE++APE+L 
Sbjct: 931  KFFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDGMWYGNKTSTFCGTPEFMAPELLR 990

Query: 549  GKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKR 608
             + YTK VDWW  GVLLY+ML    P+  ++  E++  IL    ++P  M  D   + + 
Sbjct: 991  EQDYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGDIVQIFQG 1050

Query: 609  LLNRDPNRRLGANGAD--EIKNHKFFNDLIWDSIWNKEYLPPFRPDVQNANDTSNFDNEF 666
            LL +DP +RLGA   D  EI    FF ++ +D + N    PP+ P++++A DTS F+ EF
Sbjct: 1051 LLTKDPEKRLGAGPRDALEIMEEPFFRNINFDDLLNLRIKPPYIPEIKSAEDTSYFEQEF 1110

Query: 667  TKQKPVDSVIDEYLSESVQNQFKGWSY 693
            T   P  + +   LS + Q +F+G+SY
Sbjct: 1111 TSAPPSLTPLPSVLSTTQQEEFRGFSY 1137

>YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase C,
            regulates MAP kinase cascade involved in regulating cell
            wall metabolism [3456 bp, 1151 aa]
          Length = 1151

 Score =  263 bits (673), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 140/386 (36%), Positives = 225/386 (58%), Gaps = 12/386 (3%)

Query: 313  LETIHAGKEIFLDSFTLPVVLDMNSASNFRLFNHQWINLKQGLGTINLTVDFKPSYSKPV 372
            +E  HA KE+  ++ +L       S    R  + Q  + ++   + +     + +  + V
Sbjct: 766  IEQDHASKEVLQETVSLAPT----STHPSRTTDQQ--SPQKSQTSTSAKHKKRAAKRRKV 819

Query: 373  GIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTIL--- 429
             +D+F LL VLGKG++GKV+  + K+T ++ A+K ++K  I+   ++    AE+ +    
Sbjct: 820  SLDNFVLLKVLGKGNFGKVILSKSKNTDRLCAIKVLKKDNIIQNHDIESARAEKKVFLLA 879

Query: 430  ARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALD 489
             + + PF+  L  +FQT  ++Y  +  I GG+L  H+Q + +  + RA+FYA+E+LLAL 
Sbjct: 880  TKTKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQRL-SVRRAKFYAAEVLLALK 938

Query: 490  SLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLG 549
              H   V+YRDLK ENILL  +GHI + D+GLCK  M    +TSTFCGTPE++APE+L  
Sbjct: 939  YFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDEMWYGNRTSTFCGTPEFMAPEILKE 998

Query: 550  KGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRL 609
            + YTK VDWW  GVLLY+ML    P+  ++  E++  IL    ++P  M  +   + + L
Sbjct: 999  QEYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGEIVQIFQGL 1058

Query: 610  LNRDPNRRLGAN--GADEIKNHKFFNDLIWDSIWNKEYLPPFRPDVQNANDTSNFDNEFT 667
            L +DP +RLGA    ADE+    FF ++ +D I N    PP+ P++++  DTS F+ EFT
Sbjct: 1059 LTKDPEKRLGAGPRDADEVMEEPFFRNINFDDILNLRVKPPYIPEIKSPEDTSYFEQEFT 1118

Query: 668  KQKPVDSVIDEYLSESVQNQFKGWSY 693
               P  + +   L+ S Q +F+G+S+
Sbjct: 1119 SAPPTLTPLPSVLTTSQQEEFRGFSF 1144

>Scas_690.13
          Length = 354

 Score =  246 bits (628), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 122/294 (41%), Positives = 183/294 (62%), Gaps = 6/294 (2%)

Query: 374 IDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVE 433
           + DF+++  LG GS+G+V  VR     + YA+K ++K  +V   ++ HT  ER +L  VE
Sbjct: 41  LHDFQVMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVRMKQIEHTNDERRMLKLVE 100

Query: 434 CPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHK 493
            PF++ +  TFQ    L++V+  I GGELF  L++   F    A+FYA+E+ L L+ LH 
Sbjct: 101 HPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLGLEYLHS 160

Query: 494 MDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYT 553
            +++YRDLKPENILLD  GHI + DFG  K   + +  T T CG P+Y+APEV+  K Y 
Sbjct: 161 HNIIYRDLKPENILLDRNGHIKITDFGFAK---EVDTVTWTLCGPPDYIAPEVIATKPYN 217

Query: 554 KVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRLLNRD 613
           K VDWW+LGVL++EML G  P+YD    + Y+KIL+  +++P    PD  DLL +L+  D
Sbjct: 218 KSVDWWSLGVLIFEMLAGYTPFYDTTPMKTYEKILQGKVVYPTFFHPDVVDLLGKLITAD 277

Query: 614 PNRRLG--ANGADEIKNHKFFNDLIWDSIWNKEYLPPFRPDVQNA-NDTSNFDN 664
             RR+G   +G+ +IK H +F++++W+ +  K+   P+ P +     DTS FD 
Sbjct: 278 LTRRIGNLQSGSKDIKCHPWFSEVVWEKLLAKDIETPYEPPITTGIGDTSLFDQ 331

>AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C
           (TPK1) - SH] (405062..406222) [1161 bp, 386 aa]
          Length = 386

 Score =  242 bits (617), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 125/291 (42%), Positives = 183/291 (62%), Gaps = 6/291 (2%)

Query: 376 DFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECP 435
           DF++L  LG GS+G+V  VR     + YA+K ++K  +V   +V HT  ER +L+ V  P
Sbjct: 75  DFQILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKHVVVKLKQVEHTNDERKMLSVVSHP 134

Query: 436 FIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMD 495
           FI+ +  TFQ   ++++++  I GGELF  L++   F    A+FYA+E+ LAL+ LH  D
Sbjct: 135 FIIRMWGTFQDAHQVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKD 194

Query: 496 VVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKV 555
           ++YRDLKPENILLD  GHI L DFG  K      + T T CGTP+Y+APEV+  K Y K 
Sbjct: 195 IIYRDLKPENILLDKNGHIKLTDFGFAKYV---PDVTYTLCGTPDYIAPEVVSTKPYNKS 251

Query: 556 VDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRLLNRDPN 615
           VDWW+ G+L+YEML G  P+YD+N    Y+ IL + + FP   +   +DLL +L+ RD +
Sbjct: 252 VDWWSFGILIYEMLAGYTPFYDQNTMGTYENILNAEVKFPPFFNAKVRDLLSQLITRDLS 311

Query: 616 RRLG--ANGADEIKNHKFFNDLIWDSIWNKEYLPPFRPDVQ-NANDTSNFD 663
           +RLG   NG+ ++K H +F+++IWD +  +    P+ P +     DTS +D
Sbjct: 312 KRLGNLQNGSQDVKAHPWFSEVIWDKLLCRNIETPYEPPIHAGQGDTSQYD 362

>CAGL0C03509g complement(350846..353533) similar to sp|P53739
           Saccharomyces cerevisiae YNR047w or sp|P25341
           Saccharomyces cerevisiae YCR091w KIN82, hypothetical
           start
          Length = 895

 Score =  234 bits (596), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 130/306 (42%), Positives = 180/306 (58%), Gaps = 28/306 (9%)

Query: 372 VGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILAR 431
           VG   FE + +LG+G  GKV  V++K T ++YALK   KS ++ + ++   LAE+ ILA 
Sbjct: 492 VGPQSFEKIRLLGQGDVGKVYLVKEKRTNRLYALKIFSKSEMIKRKKIKRILAEQEILAT 551

Query: 432 VECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISR--ARFYASELLLALD 489
              PF+V L  +FQ+ + LYL +    GGE F  LQ      IS   A+FYASE+  AL+
Sbjct: 552 SNHPFVVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKSKCISEEDAKFYASEVTAALE 611

Query: 490 SLHKMDVVYRDLKPENILLDSQGHIALCDFGLC-----------KLNMK----------D 528
            LH +  +YRDLKPENILL   GHI L DF L            K N +          D
Sbjct: 612 YLHLLGFIYRDLKPENILLHQSGHIMLSDFDLSIQAKDAKVPVVKGNAQSTVVDTKICSD 671

Query: 529 NEKTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKIL 588
             +T++F GT EY+APEV+ G G+T  VDWWTLG+L+YEML G  P+  EN +E +  IL
Sbjct: 672 GFRTNSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPFKGENTNETFSNIL 731

Query: 589 KSPLIFPDG--MDPDAKDLLKRLLNRDPNRRLGAN-GADEIKNHKFFNDLIWDSIWNKEY 645
           K  + FP+   +  + KDL+K+LL ++ ++RLG+  GA +IK H FF  + W  + N+E 
Sbjct: 732 KKDVTFPNNNEVSRNCKDLIKKLLIKNESKRLGSKMGAADIKKHPFFKKVNWTLLRNQE- 790

Query: 646 LPPFRP 651
            PP  P
Sbjct: 791 -PPLIP 795

>KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1
           Kluyveromyces lactis MUP1 protein, hypothetical start
          Length = 774

 Score =  232 bits (591), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 127/307 (41%), Positives = 178/307 (57%), Gaps = 30/307 (9%)

Query: 372 VGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILAR 431
           VG   FE + +LG+G  G+V  VR+K T ++YALK   K  ++ + ++   L E+ ILA 
Sbjct: 374 VGPQSFEKIRLLGQGDVGRVYLVREKQTNRLYALKIFSKPEMIKRKKIKRILTEQEILAT 433

Query: 432 VECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISR--ARFYASELLLALD 489
              PFIV L  +FQT + LYL +    GGE F  LQ      IS   ARFY+SE+  AL+
Sbjct: 434 SNHPFIVTLYHSFQTEDYLYLCMEYCMGGEFFRALQTRKTKCISEDDARFYSSEVTAALE 493

Query: 490 SLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNE------------------- 530
            LH M  +YRDLKPENILL   GHI L DF L  +  KD +                   
Sbjct: 494 YLHLMGFIYRDLKPENILLHQSGHIMLSDFDLS-VQAKDTKNPQVKGNASHSLVDTKICS 552

Query: 531 ---KTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKI 587
              +T++F GT EY+APEV+ G G+T  VDWWTLG+L+YEML G  P+  +N ++ +  I
Sbjct: 553 DGFRTNSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPFKGDNTNQTFSNI 612

Query: 588 LKSPLIFPDGMDPD--AKDLLKRLLNRDPNRRLGAN-GADEIKNHKFFNDLIWDSIWNKE 644
           LK+ ++ P+  +     KDL+++LL ++ N+RLG+  GA +IK H FF +  W  + N+E
Sbjct: 613 LKNEVVIPNNNETSRACKDLIRKLLIKNENKRLGSKLGASDIKKHPFFKNDQWSLLRNQE 672

Query: 645 YLPPFRP 651
             PP  P
Sbjct: 673 --PPLIP 677

>Kwal_23.6458
          Length = 868

 Score =  233 bits (593), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 144/406 (35%), Positives = 213/406 (52%), Gaps = 35/406 (8%)

Query: 291 ALLPSMRWQQEAALADPNMRSILETIHAGKEIFLDSFTLPVVLDMNSASNFRLFNHQWIN 350
           +L P+ +     A ++PN   I++   +          LP     + AS    F+     
Sbjct: 382 SLPPTAKPALRRATSEPNAAKIIDPQSSTNTQLSKGSHLPAATS-SGASPDNAFSVSEPQ 440

Query: 351 LKQGLGTINLTVDFKPSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRK 410
             + L   + +  FK      VG   FE + +LG+G  GKV  V++K T ++YALK   K
Sbjct: 441 RSRRLRNKSFSSKFKEVI---VGPQSFEKIKLLGQGDVGKVYLVKEKKTNRLYALKIFSK 497

Query: 411 SYIVAKSEVIHTLAERTILARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQ--R 468
             ++ + ++   LAE+ ILA    PFIV L  +FQ+ + LYL +    GGE F  LQ  +
Sbjct: 498 EEMIKRKKIKRILAEQEILATSNHPFIVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRK 557

Query: 469 EGIFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKD 528
               D   ARFY+SE++ A++ LH M  +YRDLKPENILL   GHI L DF L  +  KD
Sbjct: 558 TKCIDEDDARFYSSEVVAAIEYLHLMGFIYRDLKPENILLHKSGHIMLSDFDLS-VQAKD 616

Query: 529 NE----------------------KTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLY 566
            +                      +T++F GT EY+APEV+ G G+T  VDWWTLG+L+Y
Sbjct: 617 TKNPVVKGSAQSSLLDTKICSDGFRTNSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIY 676

Query: 567 EMLTGLPPYYDENVSEMYKKILKSPLIFPDG--MDPDAKDLLKRLLNRDPNRRLGAN-GA 623
           EML G  PY  +N ++ +  +LK+ + FP+   +  + KDL+++LL +   RRLG+  GA
Sbjct: 677 EMLFGFTPYKGDNTNKTFSNVLKNEVSFPNNNEVSRNCKDLIRKLLIKSETRRLGSKFGA 736

Query: 624 DEIKNHKFFNDLIWDSIWNKEYLPPFRPDV-QNANDTSNFDNEFTK 668
            +IK H FF  + W  + N+E  PP  P + +N  D +   N   K
Sbjct: 737 SDIKKHPFFKKVQWSLLRNQE--PPLIPVLTENGYDFTRLSNNVNK 780

>YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine
           protein kinase with unknown role [2163 bp, 720 aa]
          Length = 720

 Score =  230 bits (586), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 126/298 (42%), Positives = 180/298 (60%), Gaps = 25/298 (8%)

Query: 377 FELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPF 436
           FE + +LG+G  GKV  +R++DT +I+ALK + K  ++ + ++   L E+ ILA  + PF
Sbjct: 324 FEKIRLLGQGDVGKVYLMRERDTNQIFALKVLNKHEMIKRKKIKRVLTEQEILATSDHPF 383

Query: 437 IVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISR--ARFYASELLLALDSLHKM 494
           IV L  +FQT + LYL +    GGE F  LQ      I+   A+FYASE++ AL+ LH +
Sbjct: 384 IVTLYHSFQTKDYLYLCMEYCMGGEFFRALQTRKSKCIAEEDAKFYASEVVAALEYLHLL 443

Query: 495 DVVYRDLKPENILLDSQGHIALCDFGLC-------KLNMKDNE-----------KTSTFC 536
             +YRDLKPENILL   GH+ L DF L        K  MKD+            +T++F 
Sbjct: 444 GFIYRDLKPENILLHQSGHVMLSDFDLSIQATGSKKPTMKDSTYLDTKICSDGFRTNSFV 503

Query: 537 GTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPD 596
           GT EYLAPEV+ G G+T  VDWWTLG+L+YEML G  P+  +N +E +  IL   + FP 
Sbjct: 504 GTEEYLAPEVIRGNGHTAAVDWWTLGILIYEMLFGCTPFKGDNSNETFSNILTKDVKFPH 563

Query: 597 G--MDPDAKDLLKRLLNRDPNRRLGA-NGADEIKNHKFFNDLIWDSIWNKEYLPPFRP 651
              +  + KDL+K+LLN++  +RLG+ +GA +IK H FF  + W  + N++  PP  P
Sbjct: 564 DKEVSKNCKDLIKKLLNKNEAKRLGSKSGAADIKRHPFFKKVQWSFLRNQD--PPLIP 619

>ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) -
           SH] complement(994583..997204) [2622 bp, 873 aa]
          Length = 873

 Score =  232 bits (591), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 132/306 (43%), Positives = 178/306 (58%), Gaps = 28/306 (9%)

Query: 372 VGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILAR 431
           VG   FE + +LG+G  GKV  VR+K + ++YALK   K+ ++ + ++   LAE+ ILA 
Sbjct: 456 VGPQSFEKIRLLGQGDVGKVYLVREKKSDRLYALKIFGKAEMIKRKKIKRILAEQEILAT 515

Query: 432 VECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISR--ARFYASELLLALD 489
              PFIV L  +FQT + LYL +    GGE F  LQ      IS   ARFYASE+  AL+
Sbjct: 516 SNHPFIVTLYHSFQTEDYLYLCMEYCMGGEFFRALQTRKTKCISEDDARFYASEVTAALE 575

Query: 490 SLHKMDVVYRDLKPENILLDSQGHIALCDFGLC-----------KLNMK----------D 528
            LH M  +YRDLKPENILL   GH+ L DF L            K N +          D
Sbjct: 576 YLHLMGFIYRDLKPENILLHQSGHVMLSDFDLSVQAKGTRNPQVKGNAQSSLVDTKVCSD 635

Query: 529 NEKTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKIL 588
             +T++F GT EY+APEV+ G G+T  VDWWTLG+L YEML G  P+  +N ++ +  IL
Sbjct: 636 GFRTNSFVGTEEYIAPEVIRGNGHTASVDWWTLGILTYEMLFGFTPFKGDNTNQTFSNIL 695

Query: 589 KSPLIFPDGMD--PDAKDLLKRLLNRDPNRRLGAN-GADEIKNHKFFNDLIWDSIWNKEY 645
           K+ + FP+  D     KDL+K+LL +  ++RLG+  GA EIK H FF  + W  + N+E 
Sbjct: 696 KNDVYFPNNNDISRTCKDLIKKLLVKKESKRLGSKFGASEIKKHPFFKTVQWALLRNQE- 754

Query: 646 LPPFRP 651
            PP  P
Sbjct: 755 -PPLIP 759

>Scas_629.16
          Length = 918

 Score =  230 bits (586), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 128/307 (41%), Positives = 178/307 (57%), Gaps = 30/307 (9%)

Query: 372 VGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILAR 431
           VG   FE + +LG+G  GKV  VR+K T ++YALK   KS ++ + ++   LAE+ ILA 
Sbjct: 514 VGPQSFEKIKLLGQGDVGKVYLVREKKTNRLYALKIFSKSEMIKRKKIKRILAEQEILAT 573

Query: 432 VECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISR--ARFYASELLLALD 489
              PF+V L  +FQ+ + LY  +    GGE F  LQ      IS   ARFYASE+  AL+
Sbjct: 574 SNHPFVVTLYHSFQSEDYLYFCMEYCMGGEFFRALQTRRTKCISEDDARFYASEVTAALE 633

Query: 490 SLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNE------------------- 530
            LH +  +YRDLKPENILL   GHI L DF L  +  KD +                   
Sbjct: 634 YLHLLGFIYRDLKPENILLHKSGHIMLSDFDLS-VQAKDAKVPVMKGSAESTVVDTKICS 692

Query: 531 ---KTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKI 587
              +T++F GT EY+APEV+ G G+T  VDWWTLG+L+YEML G  P+   + +E +  I
Sbjct: 693 DGFRTNSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPFKGSSSNETFSNI 752

Query: 588 LKSPLIFPDGMD--PDAKDLLKRLLNRDPNRRLGAN-GADEIKNHKFFNDLIWDSIWNKE 644
           LK+ + FP+  D   + KDL+K+LL ++  +RLG+  GA ++K H FF  + W  + N+E
Sbjct: 753 LKNDVSFPNNNDISRNCKDLIKKLLCKNEAKRLGSKMGAADVKRHPFFKKVQWSFLRNQE 812

Query: 645 YLPPFRP 651
             PP  P
Sbjct: 813 --PPLIP 817

>Scas_720.103
          Length = 804

 Score =  224 bits (570), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 143/421 (33%), Positives = 216/421 (51%), Gaps = 55/421 (13%)

Query: 282 CSVFIKIPSAL-LPSMRWQQEAALADPNMRSILETIHAGKEIFLDSFTLPVVLDMNSASN 340
            S   + PSA   P+M   +  + A+ ++R+   T    +   L + ++P+V    S  N
Sbjct: 297 ASTTTRSPSASNSPTM---ESISTANESIRTNTRTRSGSRPQTLRTHSIPIVKRALSVPN 353

Query: 341 FRL-FNHQWINLKQGLGTINLTVDFKPSYSK--------------PVGIDDFELLTVLGK 385
                NH    ++        ++D +P  S+               V    FE + +LG+
Sbjct: 354 TESDINHTQSEVQISKDKRTYSIDSEPKRSQRLRNKSFGNKFQDIKVNPQSFEKIKLLGQ 413

Query: 386 GSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVPLKFTFQ 445
           G  GKV  V++K T  +YA+K   K  ++ + ++   + E+ ILA    PFIV L  +FQ
Sbjct: 414 GDVGKVFLVKEKKTNGLYAMKIYNKKDMIKREKIKRVITEQEILATSNHPFIVTLYHSFQ 473

Query: 446 TPEKLYLVLACINGGELFHHLQREGIFDISR--ARFYASELLLALDSLHKMDVVYRDLKP 503
           T + LYL +    GGE F  LQ      I    ARFYASE+L AL+ LH +  +YRDLKP
Sbjct: 474 TEDYLYLCMEYCMGGEFFRALQTRDSKCICEDDARFYASEVLAALEYLHLLGFIYRDLKP 533

Query: 504 ENILLDSQGHIALCDFGLCKLNMKDNE----------------------------KTSTF 535
           ENILL   GHI L DF L  ++ KD++                            +T++F
Sbjct: 534 ENILLHKSGHIMLSDFDLS-VHAKDSKNPIFMKDGILPTTNSNLIVDTKICSEGFRTNSF 592

Query: 536 CGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFP 595
            GT EY+APEV+ G G+T  VDWWTLG+L++EML G  P+  +  +E +  IL     FP
Sbjct: 593 VGTEEYIAPEVIRGNGHTVAVDWWTLGILIFEMLFGKTPFKGDTTNETFANILSKDFEFP 652

Query: 596 DGMD--PDAKDLLKRLLNRDPNRRLGAN-GADEIKNHKFFNDLIWDSIWNKEYLPPFRPD 652
           +  D   + K+L+K+LL ++  +RLG+  GA EIK H FF ++ W+ + N+E  PP  P+
Sbjct: 653 NSNDITRNCKNLIKKLLTKNETKRLGSKMGAAEIKKHSFFKNVNWNMLRNEE--PPLIPE 710

Query: 653 V 653
           +
Sbjct: 711 L 711

>CAGL0J06072g complement(572377..574698) similar to sp|P53894
           Saccharomyces cerevisiae YNL161w CBK1, hypothetical
           start
          Length = 773

 Score =  220 bits (561), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 124/350 (35%), Positives = 192/350 (54%), Gaps = 65/350 (18%)

Query: 375 DDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVEC 434
           +DF  + V+GKG++G+V  V+KKDT KIYA+K + KS +  K ++ H  AER +LA  + 
Sbjct: 368 EDFHTVQVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKDQLAHVKAERDVLAGTDS 427

Query: 435 PFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKM 494
           P+IV L ++FQ  + LYL++  + GG+L   L R  +F     RFY +E +LA++++HK+
Sbjct: 428 PWIVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIRWQLFTEDVTRFYMAECILAIETIHKL 487

Query: 495 DVVYRDLKPENILLDSQGHIALCDFGLC-------------------------------- 522
             ++RD+KP+NIL+D +GHI L DFGL                                 
Sbjct: 488 GFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSNYYKKLLQQDEATTKNGAPNDAG 547

Query: 523 --------------KLNMKDNEKTSTF-----------CGTPEYLAPEVLLGKGYTKVVD 557
                          L M + ++  T+            GTP+Y+APE+ L +GY +  D
Sbjct: 548 DGSNNRQTMIVDSINLTMSNRQQIQTWRKSRRLMAYSTVGTPDYIAPEIFLYQGYGQDCD 607

Query: 558 WWTLGVLLYEMLTGLPPYYDENVSEMYKKIL--KSPLIFPDG--MDPDAKDLLKRLLNRD 613
           WW+LG ++YE L G PP+  E   E Y+KI+  +  L FP+   +  +A+DL++RLL   
Sbjct: 608 WWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQFPEDVHISYEAEDLIRRLLTHS 667

Query: 614 PNRRLG-ANGADEIKNHKFFNDLIWDSIWNKEYLPPFRPDVQNANDTSNF 662
            N+RLG   GADEIK+H FF  + W++I  ++   P+ P + +  DT  F
Sbjct: 668 -NQRLGRQGGADEIKSHPFFRGVDWNTI--RQVEAPYIPKLSSITDTRFF 714

>Kwal_56.22788
          Length = 515

 Score =  214 bits (544), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 134/382 (35%), Positives = 194/382 (50%), Gaps = 62/382 (16%)

Query: 374 IDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVA--------------KSEV 419
           ++DF  + VLG+G+YGKV+ V+   T ++YA+K ++K+ I+               +  +
Sbjct: 122 LEDFAPVRVLGRGAYGKVLLVKDSHTSRLYAMKQLKKAEILIHDGSSEEGQPDSNLEKRL 181

Query: 420 IHTLAERTILARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARF 479
             T AERTIL+++E P IV L ++F    KLYL+L  I GGELF+HL+ +G  D     F
Sbjct: 182 ERTFAERTILSQLEHPNIVKLFYSFHDHHKLYLILQFIPGGELFYHLKEQGTLDEDTVAF 241

Query: 480 YASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDN---------- 529
           YA+E+  AL  LHK  VVYRDLKPEN LLD +GH+ L DFGL K++  D+          
Sbjct: 242 YAAEISCALRFLHKRGVVYRDLKPENCLLDERGHLVLTDFGLSKVSASDDSADGGDVNTN 301

Query: 530 -EKTSTFC------GTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSE 582
             +  + C      GTPEY APE+L GK YT+  DW++LG L+++ML G PPY   N   
Sbjct: 302 GHEGESVCTLHSIIGTPEYCAPEILEGKPYTQNCDWYSLGCLIFDMLIGKPPYTGVNHKV 361

Query: 583 MYKKILKSPL-IFPDGMDPDAKDLLKRLLNRDPNRR------------------LGANGA 623
           +  KILK  +   P  +    KD L  LL +D  +R                   G    
Sbjct: 362 ILNKILKDKIPKIPSYLSEGMKDFLAALLKKDVTKRWDVDKFWNTDGPKLKKKKAGQAKT 421

Query: 624 DEIKNHKFFNDLIWDSIWNKEYL----PPFRPDVQNANDTSNFDNEFTKQK--------P 671
              + H  F  + W  +   E       P  P + +     NFD+EFT+ +        P
Sbjct: 422 TSFQAHFVFRKISWLKMETGELQRNTEGPILPIITDWELAENFDSEFTEMRLDSEAQDQP 481

Query: 672 VDSVIDEYLSESVQNQFKGWSY 693
            +  I+ +     ++ FKG+SY
Sbjct: 482 ANLQINGFSRSGDKDVFKGFSY 503

>KLLA0F24618g complement(2288943..2290613) similar to sp|P38070
           Saccharomyces cerevisiae YBR028c, start by similarity
          Length = 556

 Score =  213 bits (541), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 140/389 (35%), Positives = 199/389 (51%), Gaps = 62/389 (15%)

Query: 367 SYSK---PVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVI--- 420
           S+SK   P  +DDF  +  LG+G+YGKV+ V+   + K+YA+K ++K+ I+   + I   
Sbjct: 157 SFSKTGAPRVLDDFVPIRCLGEGAYGKVLLVKDSLSSKLYAMKQLKKAEILISEDSIEKD 216

Query: 421 ----------HTLAERTILARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREG 470
                      T AERTIL+++E P IV L ++F    KLYLVL  I GGELF+HL+ +G
Sbjct: 217 ANTTVEKRIERTFAERTILSQLEHPNIVKLFYSFHDNHKLYLVLQYIPGGELFYHLKEQG 276

Query: 471 IFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNE 530
             D     FYA+EL  AL  LH   +VYRDLKPEN LL+ +GH+ L DFGL K ++ D+ 
Sbjct: 277 TLDEGTVAFYAAELSCALKFLHSKGIVYRDLKPENCLLNERGHLVLTDFGLSKKSVFDDA 336

Query: 531 KTS----------TFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENV 580
            T           +  GTPEY APE+L G+ YT+  DW++LG L+Y+ML G PP+   N 
Sbjct: 337 ATPEEGENVNQLYSIIGTPEYCAPEILAGEPYTQNCDWYSLGCLVYDMLIGKPPFTGVNH 396

Query: 581 SEMYKKIL--KSPLIFPDGMDPDAKDLLKRLLNRDPNRRLGAN---------------GA 623
             +  KI   K+    P  +    KD L  LL +DP +R   +               G 
Sbjct: 397 KIILNKIKQEKTGARIPSYLSDGFKDYLGALLRKDPTKRWDVDKYWAQDGPKTKKKKAGQ 456

Query: 624 DEIKN---HKFFNDLIWDSIWN----KEYLPPFRPDVQNANDTSNFDNEFTKQKPVDSVI 676
            +  N   H  F  +IW  + +    K  + P  P + +     NFD EFT+++   S+ 
Sbjct: 457 AKTTNYIGHFIFRKIIWKQLLSGDLQKISVGPILPIITDWELAENFDTEFTEKRLDTSIY 516

Query: 677 D------------EYLSESVQNQFKGWSY 693
           D            E       + FKG+SY
Sbjct: 517 DNGIEINNPRATKESAFAGSTDYFKGFSY 545

>YBR028C (YBR028C) [220] chr2 complement(294387..295964)
           Serine/threonine protein kinase with similarity to
           Ypk2p/Ykr2p and Ypk1p [1578 bp, 525 aa]
          Length = 525

 Score =  206 bits (525), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 142/395 (35%), Positives = 196/395 (49%), Gaps = 80/395 (20%)

Query: 374 IDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIV-------AKSE-------- 418
           + DF+ + VLG+G+YGKV+ V+  +T K+YA+K +RK+ I+       +K E        
Sbjct: 125 LHDFKPVRVLGQGAYGKVLLVKDVNTSKLYAMKQLRKAEILISQTATDSKREDEDKNDGN 184

Query: 419 -----------VIHTLAERTILARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQ 467
                      +  T AER+IL+ +E P IV L ++F    KLYL+L  I GGELF+HL+
Sbjct: 185 NNDNDDGLSKRLERTFAERSILSEIEHPNIVKLFYSFHDNSKLYLLLQYIPGGELFYHLK 244

Query: 468 REGIFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMK 527
             G  D +   FYA+E+  AL  LH   VVYRDLKPEN LL+ +GH+ L DFGL K +  
Sbjct: 245 EHGTLDETTVSFYAAEISCALRFLHTKGVVYRDLKPENCLLNQRGHLVLTDFGLSKKSAN 304

Query: 528 DN----------EKTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYD 577
           D+              +  GTPEY APE+LLGK Y++  DW++LG LLY+ML G PPY  
Sbjct: 305 DSAVDEEDPENVNALYSIIGTPEYCAPEILLGKAYSQNCDWYSLGCLLYDMLVGKPPYTG 364

Query: 578 ENVSEMYKKIL------KSPLIFPDGMDPDAKDLLKRLLNRDPNRR---------LGAN- 621
            N   +  KI       K P    +GM    KD+L  LL ++  +R          GAN 
Sbjct: 365 SNHKVIINKIQQNKQGPKIPFYLSEGM----KDILNALLKKETAKRWNVDKYWAKTGANN 420

Query: 622 ----------GADEIK---NHKFFNDLIWDSI----WNKEYLPPFRPDVQNANDTSNFDN 664
                     GA        H  F  + W  +      K  L P  P + +     NFD 
Sbjct: 421 KPTKSKKKKSGAARTSLFTEHFIFRKIDWKLLESGQLQKTTLGPIVPVITDLELAENFDT 480

Query: 665 EFTKQKPVDSVIDE------YLSESVQNQFKGWSY 693
           EFT     ++  D        +S+S  + FKG+SY
Sbjct: 481 EFTSMSYEETYTDSKPININSVSKS-PDMFKGFSY 514

>AEL083W [2423] [Homologous to ScYBR028C - SH]
           complement(470964..472574) [1611 bp, 536 aa]
          Length = 536

 Score =  207 bits (526), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 133/364 (36%), Positives = 188/364 (51%), Gaps = 63/364 (17%)

Query: 366 PSYSK---PVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVA------- 415
           PS+ K   P  ++DF+ + VLG+G+YGKV+ V+ + T K++A+K ++K+ IV        
Sbjct: 132 PSFQKRQTPRKLEDFKPVRVLGRGAYGKVLLVKDQLTSKLFAMKQLKKAEIVVTAPEEES 191

Query: 416 -------------KSEVIHTLAERTILARVECPFIVPLKFTFQTPEKLYLVLACINGGEL 462
                        +  V  T AERTIL+++E P IV L ++F    KLYLVL  I GGEL
Sbjct: 192 TDGEDAVLLPAVVEKRVERTFAERTILSQLEHPNIVKLFYSFHDHHKLYLVLQYIPGGEL 251

Query: 463 FHHLQREGIFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLC 522
           F+HL+ +G  D     FYA+E+  AL  LH   +VYRDLKPEN LLD +GH+ L DFGL 
Sbjct: 252 FYHLKEQGTLDEVTVSFYAAEISCALKFLHSKGIVYRDLKPENCLLDDKGHLVLTDFGLS 311

Query: 523 K--LNMKDN-------EKTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLP 573
           K  +N  D+       E+  +  GTPEY APE+L G+ YT+  DW++LG L Y+ML G P
Sbjct: 312 KRGVNQADSPLGGEQVEELYSIIGTPEYCAPEILCGQPYTQNCDWYSLGSLTYDMLIGKP 371

Query: 574 PYYDENVSEMYKKI-----LKSPLIFPDGMDPDAKDLLKRLLNRDPNRRLGAN------- 621
           P+   N   +  KI     +K P    DGM    KD L  LL +D  +R   +       
Sbjct: 372 PFTGANHKVILSKIKQDKGIKIPHYLSDGM----KDYLNALLKKDIGKRWDVDRFWDKEG 427

Query: 622 -----------GADEIKNHKFFNDLIWDSIWN----KEYLPPFRPDVQNANDTSNFDNEF 666
                           ++H  F  + W  + N    +    P  P + +     NFD+EF
Sbjct: 428 TKTKKKKAGQAKTSCYQSHFIFRKINWKLMENGDLQRTTYGPIIPVITDWELAENFDSEF 487

Query: 667 TKQK 670
           T  +
Sbjct: 488 TGMR 491

>CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces
           cerevisiae YBR028c, start by similarity
          Length = 542

 Score =  205 bits (521), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 138/394 (35%), Positives = 189/394 (47%), Gaps = 78/394 (19%)

Query: 374 IDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIV-----AKSE---------- 418
           I DF+ + VLG+G+YGKV+ V+ K T K+YA+K ++K+ I+     A +E          
Sbjct: 142 ISDFKPIRVLGQGAYGKVILVKDKQTSKLYAMKQLKKAEILIAPTDANTESMDKLAELDK 201

Query: 419 ------------VIHTLAERTILARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHL 466
                       +  T AERTIL+++E P IV L ++F    KLYL+L  I GGELF HL
Sbjct: 202 PVDSEDEKLSKRIERTFAERTILSQLEHPNIVKLFYSFHDTSKLYLLLQYIPGGELFFHL 261

Query: 467 QREGIFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNM 526
           +  G  +     FYA+E+  AL  LH   VVYRDLKPEN LL+  GH+ L DFGL K + 
Sbjct: 262 KEHGTLEEDTVAFYAAEISCALKFLHSKGVVYRDLKPENCLLNQNGHLVLTDFGLSKSSA 321

Query: 527 --------------KDNEKTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGL 572
                         +D  +  +  GTPEY APE+LLG+ YT   DW++LG LLY+MLTG 
Sbjct: 322 SNASQEDLGAGNEGEDVNELHSIIGTPEYCAPEILLGQPYTANCDWYSLGCLLYDMLTGK 381

Query: 573 PPYYDENVSEMYKKIL------KSPLIFPDGMDPDAKDLLKRLLNRDPNRRLGANG---- 622
           PPY   N   +  KI       K P    DGM    KD+L  LL  DP +R   +     
Sbjct: 382 PPYTGANHKVIANKIKNDKQGPKIPYYLSDGM----KDVLGALLKSDPKKRWDVDKYWSE 437

Query: 623 -------------------ADEIKNHKFFNDLIWDSIWNKEY----LPPFRPDVQNANDT 659
                                  ++H  F  + W  + + E       P  P + +    
Sbjct: 438 PKKDNSQKKGQKKKKSKERTSPFQSHFVFRKVDWKGLSSGELQNTTFGPIVPVITDWELA 497

Query: 660 SNFDNEFTKQKPVDSVIDEYLSESVQNQFKGWSY 693
            NFD+EFT     +      L     + FKG+S+
Sbjct: 498 ENFDSEFTSMSYEEDDFLHPLHNKSPDAFKGFSF 531

>Scas_593.14d
          Length = 495

 Score =  198 bits (504), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 120/297 (40%), Positives = 164/297 (55%), Gaps = 44/297 (14%)

Query: 374 IDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKS--------------EV 419
           + DF  + VLG+G+YGKV+ V+ K T K+YA+K ++K+ I+                  +
Sbjct: 133 VKDFRPVRVLGQGAYGKVILVKDKLTNKLYAMKQLKKAEILITESPKSNEEDDVNLGKRI 192

Query: 420 IHTLAERTILARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARF 479
             T AE++ILA +E P IV L ++F    KLYL+L  I GGELF HL+ +G  D     F
Sbjct: 193 ERTFAEKSILAELEHPNIVKLFYSFHDNSKLYLLLQYIPGGELFFHLKEQGTLDEDTVAF 252

Query: 480 YASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDN-----EKTS- 533
           YA+E+  AL  LH   +VYRDLKPEN LL+ +GH+ L DFGL K ++  N     E TS 
Sbjct: 253 YAAEISCALKFLHDKGIVYRDLKPENCLLNDKGHLVLTDFGLSKKSVTQNSANPSEVTSL 312

Query: 534 -----------TFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSE 582
                      +  GTPEY APE+L G  Y K  DW++LG L+Y+ML+G PPY   N   
Sbjct: 313 NEPSEDLSTLHSIIGTPEYCAPEILQGLPYNKNCDWYSLGCLIYDMLSGKPPYTGANHKV 372

Query: 583 MYKKILKS------PLIFPDGMDPDAKDLLKRLLNRDPNRRLGAN---GADEIKNHK 630
           +  KI K       P    +GM    KD+L  LL +D ++R   +    A+ IKN K
Sbjct: 373 ILNKIQKDKQGPKIPYYLSEGM----KDMLNWLLKKDQSKRWDVDKYWAAEPIKNGK 425

>CAGL0B04147g 402798..404498 highly similar to sp|P22204
           Saccharomyces cerevisiae YGR092w DBF2 ser/thrprotein
           kinase related to DBF20P or sp|P32328 Saccharomyces
           cerevisiae YPR111w DBF20 cell cycle protein kinase
           related to DBF2P, hypothetical start
          Length = 566

 Score =  185 bits (470), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 120/383 (31%), Positives = 185/383 (48%), Gaps = 62/383 (16%)

Query: 344 FNHQWINLKQGLGTINLTVDFKPSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIY 403
            N +W N  Q    +      KP         DFE++T +G+G YG+V   RK+DT+++ 
Sbjct: 144 LNEEWNNYLQKEHEVLRKRRLKPKNK------DFEMITQVGQGGYGQVYLARKRDTKEVC 197

Query: 404 ALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVPLKFTFQTPEKLYLVLACINGGELF 463
           ALK + K  +V  +E  H L ER IL      ++V L + FQ PE LYL +  + GG+  
Sbjct: 198 ALKILNKKLLVKLNETNHILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFR 257

Query: 464 HHLQREGIFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLC- 522
             L          ARFY SE+  A+++LH++   +RDLKPEN L+D++GHI L DFGL  
Sbjct: 258 TLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAA 317

Query: 523 ---------------------------------------KLNMKDNEKTSTFCGTPEYLA 543
                                                   L   D    ++  G+P+Y+A
Sbjct: 318 GTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMA 377

Query: 544 PEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMY------KKILKSPLIFPDG 597
            EVL GK Y   VD+W+LG +L+E L G  P+   + +E Y      K+ L+ P +  DG
Sbjct: 378 LEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFL-NDG 436

Query: 598 ---MDPDAKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDLIWDSIWNKEYLPPFRPDVQ 654
              +   A +L+ RL+  DP  RL +   + +K   +F+++ +D++  ++  PPF P + 
Sbjct: 437 RSAISDRAWELITRLIA-DPINRLRS--FEHVKRMNYFHEINFDTL--RQLSPPFTPQLD 491

Query: 655 NANDTSNFDNEFTKQKPVDSVID 677
           N  D   FD +FT +  +    D
Sbjct: 492 NETDAGYFD-DFTNEADMAKYAD 513

>Kwal_23.3992
          Length = 571

 Score =  181 bits (458), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 121/379 (31%), Positives = 185/379 (48%), Gaps = 72/379 (18%)

Query: 353 QGLGTINLTVDFKPSYSKPVGI----------DDFELLTVLGKGSYGKVMQVRKKDTQKI 402
           QG+    L+ +++   +K  GI           DFE++T +G+G YG+V   RK+DT++I
Sbjct: 142 QGIVGEELSKEWQAYLTKETGILRKRRLKPKNKDFEMITQVGQGGYGQVYLARKRDTREI 201

Query: 403 YALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVPLKFTFQTPEKLYLVLACINGGEL 462
            ALK + K  ++  +E  H L ER IL      ++V L + FQ P  LYL +  + GG+ 
Sbjct: 202 CALKILNKKLLIKLNETNHVLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDY 261

Query: 463 FHHLQREGIFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLC 522
              L          ARFY SE+  A+D+LH++   +RDLKPEN L+DS+GHI L DFGL 
Sbjct: 262 RTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLA 321

Query: 523 K--------------------------------------LNMKDNE--KTSTFCGTPEYL 542
                                                   N+++N+    S+  G+P+Y+
Sbjct: 322 AGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYM 381

Query: 543 APEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMY------KKILKSPLI--- 593
           A EVL  K Y   VD+W+LG +L+E L G  P+   + +E Y      K++L+ P     
Sbjct: 382 ALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNG 441

Query: 594 ---FPDGMDPDAKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDLIWDSIWNKEYLPPFR 650
              F D       DL+ RL+  DP  RL     + +K  K+F ++ ++++ N    PPF 
Sbjct: 442 RYAFSDR----TWDLIIRLIA-DPISRL--RSFEHVKKMKYFAEISFENLRNVS--PPFI 492

Query: 651 PDVQNANDTSNFDNEFTKQ 669
           P + N  D   FD +FT +
Sbjct: 493 PQLDNETDAGYFD-DFTSE 510

>AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH]
           (249144..250247) [1104 bp, 367 aa]
          Length = 367

 Score =  172 bits (436), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 96/256 (37%), Positives = 149/256 (58%), Gaps = 4/256 (1%)

Query: 374 IDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVE 433
           + DFE+  VLGKG +G+V  VR  ++  + ALKA+ K  I+  +       E  I + + 
Sbjct: 106 LADFEIGKVLGKGKFGRVYCVRHIESGFVCALKAMEKKDIIQYNIEKQFRREVEIQSSLR 165

Query: 434 CPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHK 493
            P +  L   F   +++YL++  +  GEL+ HL+    F+   A +Y  ++  ALD +H+
Sbjct: 166 HPNLTQLYGYFHDEKRVYLLMEYLVNGELYKHLKGRSHFNDVVASYYVYQMADALDYMHE 225

Query: 494 MDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYT 553
            ++++RD+KPENI++     I L DFG   +  K + K  T CGT +YL+PE++  + Y 
Sbjct: 226 RNILHRDIKPENIIIGFNNTIKLTDFGWSVITPKGS-KRKTLCGTVDYLSPELIRSREYN 284

Query: 554 KVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRLLNRD 613
           + VD W LGVL YE+L G PP+ +E+    YK+ILK  LIFPD +D +A+ L+ RLL  D
Sbjct: 285 EKVDVWALGVLTYELLVGSPPFEEESKELTYKRILKRNLIFPDHVDTEARHLISRLLEYD 344

Query: 614 PNRRLGANGADEIKNH 629
           P  R+      E+K H
Sbjct: 345 PGDRIPLK---EVKKH 357

>Scas_705.23
          Length = 553

 Score =  176 bits (446), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 116/379 (30%), Positives = 189/379 (49%), Gaps = 70/379 (18%)

Query: 376 DFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECP 435
           DFE++T +G+G YG+V   RK+DT+++ ALK + K  +   +E  H L ER IL      
Sbjct: 157 DFEMITQVGQGGYGQVYLARKRDTKEVCALKILNKKLLFKLNETNHVLTERDILTTTRSD 216

Query: 436 FIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMD 495
           ++V L + FQ  E LYL +  + GG+    L        + ARFY SE+  A+++LH++ 
Sbjct: 217 WLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELG 276

Query: 496 VVYRDLKPENILLDSQGHIALCDFGLC----------------------------KLNMK 527
             +RDLKPEN L+DS+GHI L DFGL                             + +++
Sbjct: 277 YTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIE 336

Query: 528 DNEK------------TSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPY 575
           D  K             ++  G+P+Y+A EVL GK Y   VD+W+LG +L+E L G  P+
Sbjct: 337 DRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPF 396

Query: 576 YDENVSEMY------KKILKSPLIFPDGMDPDAKDLLKRLLNR---DPNRRLGANGADEI 626
              + +E Y      KK L+ P++  D   P   D    ++ R   DP  RL +   + I
Sbjct: 397 SGSSTNETYENLRHWKKTLRRPVL--DNGRPAFSDRTWDIITRLIADPINRLRS--FEHI 452

Query: 627 KNHKFFNDLIWDSIWNKEYLPPFRPDVQNANDTSNFD---NE---------FTKQKPVDS 674
           K   +F ++ ++++  ++  PPF P + +  D   FD   NE         F +Q  + S
Sbjct: 453 KRMPYFAEVNFNTL--RQSAPPFTPQLDSETDAGYFDDFTNEADMAKYADVFKRQNKLSS 510

Query: 675 VIDEYLSESVQNQFKGWSY 693
           ++D+    +V ++  G+++
Sbjct: 511 MVDD---SAVDSKLVGFTF 526

>CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces
           cerevisiae YPL209c IPL1 ser/thr protein kinase, start by
           similarity
          Length = 358

 Score =  171 bits (433), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 102/266 (38%), Positives = 154/266 (57%), Gaps = 6/266 (2%)

Query: 365 KPSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLA 424
           K +Y+  + + DFE+   LGKG +GKV  VR K +  I ALKAI K+ I+  + +     
Sbjct: 88  KSTYNNKLSLKDFEVGRKLGKGKFGKVYCVRHKKSGFICALKAIEKNEILQFNLLKQLKR 147

Query: 425 ERTILARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASEL 484
           E  I   ++ P I+ L   F   +++YL++     GEL+  L+  G F+   A  Y  ++
Sbjct: 148 EVDIQLGMDHPNIIKLYAHFHDEKRVYLLMEHSINGELYKSLKNNGPFNDVLASHYIYQI 207

Query: 485 LLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAP 544
             AL  +HK  +++RD+KPEN+L+     + L DFG   LN  +  K  T CGT +YL+P
Sbjct: 208 ADALHYMHKKRIIHRDVKPENVLIGFDNVVKLADFGWSILN-PEGSKRKTLCGTIDYLSP 266

Query: 545 EVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEM-YKKILKSPLIFPDGMDPDAK 603
           E++  + Y + VD W LGVL YE++ G+PP ++EN  E+ YK+ILK  L FP+ +  DAK
Sbjct: 267 EMITPREYDEQVDVWALGVLAYELVVGVPP-FEENSKELTYKRILKCDLNFPESISKDAK 325

Query: 604 DLLKRLLNRDPNRRLGANGADEIKNH 629
           DL+ +LL  D  +RL   G   +K H
Sbjct: 326 DLISKLLVTDTTQRLSLTG---VKTH 348

>Kwal_56.24091
          Length = 381

 Score =  169 bits (429), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 99/253 (39%), Positives = 149/253 (58%), Gaps = 1/253 (0%)

Query: 366 PSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAE 425
           P + + + +DDFE+   LGKG +GKV  V+ K T  I ALKA++KS IV  +       E
Sbjct: 112 PVHYQDISLDDFEVGKKLGKGKFGKVYCVKHKRTGFICALKAMKKSEIVQYNVQKQFRRE 171

Query: 426 RTILARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELL 485
             I + ++ P +  L   F   +++YL++  +  GEL+ HL+  G F+   A  +  ++ 
Sbjct: 172 VEIQSSLKHPNLTRLYGYFHDEKRVYLLMEYLVNGELYKHLRSHGPFNDITASHFVHQMA 231

Query: 486 LALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPE 545
            AL+ +H  ++++RD+KPENILL  Q  + L DFG    N+  N K  T CGT +YL+PE
Sbjct: 232 DALNYMHSKNILHRDIKPENILLGFQNTLKLTDFGWSVSNV-GNSKRKTLCGTMDYLSPE 290

Query: 546 VLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDL 605
           ++  + Y   VD W LGVL YE+L G PP+ ++     YK+I+K  L FPD + P A+DL
Sbjct: 291 LIKSREYDNKVDVWALGVLTYELLVGSPPFEEDTKELTYKRIIKRDLRFPDQVSPHARDL 350

Query: 606 LKRLLNRDPNRRL 618
           + RLL  DP  R+
Sbjct: 351 ISRLLEYDPQNRI 363

>YGR092W (DBF2) [2052] chr7 (668191..669909) Serine/threonine
           protein kinase related to Dbf20p, required for events in
           anaphase/telophase, component of the CCR4-NOT
           transcriptional complex [1719 bp, 572 aa]
          Length = 572

 Score =  174 bits (440), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 111/350 (31%), Positives = 169/350 (48%), Gaps = 54/350 (15%)

Query: 376 DFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECP 435
           DFE++T +G+G YG+V   RKKDT+++ ALK + K  +   +E  H L ER IL      
Sbjct: 176 DFEMITQVGQGGYGQVYLARKKDTKEVCALKILNKKLLFKLNETKHVLTERDILTTTRSE 235

Query: 436 FIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMD 495
           ++V L + FQ  + LYL +  + GG+    L          ARFY SE+  A+++LH + 
Sbjct: 236 WLVKLLYAFQDLQSLYLAMEFVPGGDFRTLLINTRCLKSGHARFYISEMFCAVNALHDLG 295

Query: 496 VVYRDLKPENILLDSQGHIALCDFGLC--------------------------------- 522
             +RDLKPEN L+D++GHI L DFGL                                  
Sbjct: 296 YTHRDLKPENFLIDAKGHIKLTDFGLAAGTISNERIESMKIRLEKIKDLEFPAFTEKSIE 355

Query: 523 -------KLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPY 575
                  +L  K+    ++  G+P+Y+A EVL GK Y   VD+W+LG +L+E L G  P+
Sbjct: 356 DRRKMYNQLREKEINYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPF 415

Query: 576 YDENVSEMYKKIL--KSPLIFPDGMDPDAK------DLLKRLLNRDPNRRLGANGADEIK 627
              + +E Y  +   K  L  P   D  A       DL+ RL+  DP  RL     + +K
Sbjct: 416 SGSSTNETYDNLRRWKQTLRRPRQSDGRAAFSDRTWDLITRLIA-DPINRL--RSFEHVK 472

Query: 628 NHKFFNDLIWDSIWNKEYLPPFRPDVQNANDTSNFDNEFTKQKPVDSVID 677
              +F D+ + ++  +  +PPF P + +  D   FD +FT +  +    D
Sbjct: 473 RMSYFADINFSTL--RSMIPPFTPQLDSETDAGYFD-DFTSEADMAKYAD 519

>KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1
           Kluyveromyces lactis DBF2, start by similarity
          Length = 567

 Score =  174 bits (440), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 116/372 (31%), Positives = 181/372 (48%), Gaps = 73/372 (19%)

Query: 376 DFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECP 435
           DFE++T +G+G YG+V   RKKDT++I ALK + K  ++      H L ER IL      
Sbjct: 171 DFEMITQVGQGGYGQVYLARKKDTKEICALKILNKKLLMKLEGTDHVLTERDILTTTRSE 230

Query: 436 FIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMD 495
           ++V L + FQ P+ LYL +  + GG+    L          ARFY SE+  A+++LH++ 
Sbjct: 231 WLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLG 290

Query: 496 VVYRDLKPENILLDSQGHIALCDFGLC--------------------------------- 522
             +RDLKPEN L+DS+GHI L DFGL                                  
Sbjct: 291 YTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMD 350

Query: 523 -------KLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPY 575
                  KL  ++     +  G+P+Y+A EVL  K Y   VD+W+LG +L+E L G  P+
Sbjct: 351 DRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 410

Query: 576 YDENVSEMY------KKILKSP------LIFPDGMDPDAKDLLKRLLNRDPNRRLGANGA 623
              + +E Y      K +L+ P        F D       +L+ RL+  DP  RL +   
Sbjct: 411 SGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDR----TWELITRLIA-DPINRLKS--F 463

Query: 624 DEIKNHKFFNDLIWDSIWNKEYLPPFRPDVQNANDTSNFD---NE---------FTKQKP 671
           + +K  ++F+++ ++++  +   PPF P + N  D   FD   NE         F +Q  
Sbjct: 464 EHVKRMRYFSEIDFNTL--RTIHPPFIPQLDNEEDVGYFDDFTNEEHMARYVDVFKRQDR 521

Query: 672 VDSVIDEYLSES 683
           + +++D+ LS+S
Sbjct: 522 LTAMVDDSLSDS 533

>YDR490C (PKH1) [1306] chr4 complement(1431956..1434256)
           Serine/threonine protein kinase, functions similarly to
           mammalian 3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk1p, required for
           endocytosis [2301 bp, 766 aa]
          Length = 766

 Score =  176 bits (447), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 104/288 (36%), Positives = 160/288 (55%), Gaps = 21/288 (7%)

Query: 372 VGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILAR 431
           +GI DF+    LG GSY  V+    +D+ K YA+K + K Y++ + +V +   E+  L +
Sbjct: 120 MGIKDFKFGEQLGDGSYSSVVLATARDSGKKYAVKVLSKEYLIRQKKVKYVTVEKLALQK 179

Query: 432 VE-CPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDS 490
           +     I  L FTFQ    LY +L     G+    +++ G  + + AR+YAS+++ A+DS
Sbjct: 180 LNGTKGIFKLFFTFQDEASLYFLLEYAPHGDFLGLIKKYGSLNETCARYYASQIIDAVDS 239

Query: 491 LHKMDVVYRDLKPENILLDSQGHIALCDFGLCKL------NMKDNE-------KTSTFCG 537
           LH + +++RD+KPENILLD    + L DFG  K+      N  D +       K+ +F G
Sbjct: 240 LHNIGIIHRDIKPENILLDKNMKVKLTDFGTAKILPEEPSNTADGKPYFDLYAKSKSFVG 299

Query: 538 TPEYLAPEVLLGKGYT-KVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPD 596
           T EY++PE LL   YT    D W  G +LY+ML G PP+   N    ++K++K    F  
Sbjct: 300 TAEYVSPE-LLNDNYTDSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAFTA 358

Query: 597 GMDPDAKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDLIWD--SIWN 642
           G     KDL+K+LL RDPN RL      +IK H FF+++ ++  S+W+
Sbjct: 359 GFPQIVKDLVKKLLVRDPNDRLTIK---QIKAHLFFHEVNFEDGSVWD 403

>ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W
           (DBF20) - SH] complement(764718..766451) [1734 bp, 577
           aa]
          Length = 577

 Score =  172 bits (436), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 114/364 (31%), Positives = 175/364 (48%), Gaps = 67/364 (18%)

Query: 376 DFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECP 435
           DFE++T +G+G YG+V   RKKDT++I ALK + K+ +   +   H L ER IL      
Sbjct: 181 DFEIITQVGQGGYGQVYLARKKDTKEICALKILNKNLLAKLNGTDHVLTERDILTTTRSE 240

Query: 436 FIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMD 495
           ++V L + FQ P  LYL +  + GG+    L          ARFY SE+  A+D+LHK+ 
Sbjct: 241 WLVKLLYAFQDPHSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHKLG 300

Query: 496 VVYRDLKPENILLDSQGHIALCDFGLC--------------------------------- 522
             +RDLKPEN L+DS+GHI L DFGL                                  
Sbjct: 301 YTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMRIRLEEVKNLEFPEFKETSMD 360

Query: 523 -------KLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPY 575
                  ++  K+    S+  G+P+Y+A EVL  K Y   VD+W+LG +L+E L G  P+
Sbjct: 361 YRRKMYHRVREKELNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 420

Query: 576 YDENVSEMY------KKILKSPLIFPDGMDPDAKDLLKRLLNR---DPNRRLGANGADEI 626
              + +E Y      K++L+ P    +   P   D    L+ R   DP  RL     + +
Sbjct: 421 SGSSSNETYENLRRWKQVLRRPRC--ENGRPAFSDRTWELITRLIADPINRL--RSFEHV 476

Query: 627 KNHKFFNDLIWDSIWNKEYLPPFRPDVQNANDTSNFD---NE---------FTKQKPVDS 674
           K  K+F ++ + ++  +   PPF P + +  D   FD   NE         F +Q  +++
Sbjct: 477 KKMKYFAEIDFANL--RSMSPPFIPQLDSETDAGYFDDFTNEADMAKYADVFKRQDKLNA 534

Query: 675 VIDE 678
           +++E
Sbjct: 535 MVEE 538

>KLLA0B02332g complement(206863..207948) similar to sp|P38991
           Saccharomyces cerevisiae YPL209c IPL1 ser/thr protein
           kinase, start by similarity
          Length = 361

 Score =  167 bits (423), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 92/256 (35%), Positives = 148/256 (57%), Gaps = 4/256 (1%)

Query: 374 IDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVE 433
           + DFE+  +LGKG +GKV  V+ ++T  I ALKA+ K  IV  +       E  I    +
Sbjct: 97  LQDFEIGKILGKGKFGKVYCVKHRETGLICALKAMEKKEIVQYTIQKQFRREVEIQGSFK 156

Query: 434 CPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHK 493
              +  L   F   +++YL++  +  GEL+  L+  G  + + A ++  ++  ALD +H 
Sbjct: 157 HKNLTQLYGFFYDEKRVYLLMEYVYYGELYKFLKNNGPLNETLASYFVYQMANALDYMHS 216

Query: 494 MDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYT 553
            ++++RD+KPENIL+     I L DFG    N +D +K  T CGT +YL+PE++  + Y 
Sbjct: 217 KNILHRDIKPENILIGFNNTIKLTDFGWSVYN-EDGQKRKTLCGTIDYLSPELIKSREYN 275

Query: 554 KVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRLLNRD 613
             VD W LGVL YE+L G PP+ ++     Y++IL+  L FP  + P A+DL+ RLL  +
Sbjct: 276 NKVDVWALGVLTYELLVGSPPFEEDTKEMTYRRILRCDLKFPLNVSPQARDLIVRLLQFE 335

Query: 614 PNRRLGANGADEIKNH 629
           P++R+  +   E+K+H
Sbjct: 336 PSKRIPLS---EVKSH 348

>Scas_716.33
          Length = 573

 Score =  172 bits (435), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 117/394 (29%), Positives = 183/394 (46%), Gaps = 68/394 (17%)

Query: 333 LDMNSASNFRLFNHQWINLKQGLGTINLTVDFKPSYSKPVGIDDFELLTVLGKGSYGKVM 392
           +D+NS       N++W    Q    +      KP +       DFE++T +G+G YG+V 
Sbjct: 146 VDLNS------LNNEWNGYIQREHQVLRKRRLKPKHK------DFEMITQVGQGGYGQVY 193

Query: 393 QVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVPLKFTFQTPEKLYL 452
             RKKDT ++ ALK + K  +   +E  H L ER IL      ++V L + FQ  + LYL
Sbjct: 194 LARKKDTNEVCALKILNKKLLFKLNETNHVLTERDILTTTRSQWLVKLLYAFQDTQNLYL 253

Query: 453 VLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQG 512
            +  + GG+    L        + ARFY SE+ LA+++LH +   +RDLKPEN L+D++G
Sbjct: 254 AMEFVPGGDFRTLLINTRFLKSTHARFYISEMFLAVNALHDLGYTHRDLKPENFLIDAKG 313

Query: 513 HIALCDFGLCKLNMKDNEKTS--------------------------------------- 533
           HI L DFGL    + ++   S                                       
Sbjct: 314 HIKLTDFGLAAGTISNDRIQSMKVRLEEVKNLEFPEFSDKSIEDRRQMYQKYRETEVNYA 373

Query: 534 -TFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMY------KK 586
            +  G+P+Y+A EVL GK Y   VD+W+L  +L+E L G  P+   + +E Y      KK
Sbjct: 374 NSMVGSPDYMALEVLEGKKYDFTVDYWSLSCMLFESLVGYTPFSGSSTNETYENLRHWKK 433

Query: 587 ILKSPLIFPDGMDPDAKDLLKRLLNR---DPNRRLGANGADEIKNHKFFNDLIWDSIWNK 643
            L+ P++  D   P   D     + R   DP  RL +   + +K   +F  + ++++  +
Sbjct: 434 TLRRPML--DNGRPAFSDRTWDFITRLIADPINRLRS--FEHVKRMTYFESVDFNTL--R 487

Query: 644 EYLPPFRPDVQNANDTSNFDNEFTKQKPVDSVID 677
           +  PPF P + N  D   FD +FT +  +    D
Sbjct: 488 DLSPPFIPQLDNETDAGYFD-DFTNEADMAKYAD 520

>Kwal_56.22693
          Length = 984

 Score =  173 bits (439), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 98/287 (34%), Positives = 157/287 (54%), Gaps = 16/287 (5%)

Query: 373 GIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARV 432
           GI DF    VLG GSY  VM  R  D+ K YA+K + K Y++ + +V +   E+  L R+
Sbjct: 154 GIKDFRFGEVLGDGSYSTVMLARSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKNTLQRL 213

Query: 433 -ECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSL 491
            +   ++ L FTFQ    LY +L     G+    +++ G      A +Y++++L A+D L
Sbjct: 214 NDGRGVIKLYFTFQDEASLYFLLEYAPNGDFLSVIKKFGSLSQECAVYYSAQILDAIDYL 273

Query: 492 HKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDN--------EKTSTFCGTPEYLA 543
           H   +V+RD+KPENILLD    + L DFG  ++  KD         E++ +F GT EY++
Sbjct: 274 HHKGIVHRDIKPENILLDKDMKVKLTDFGTARILEKDETTQTFNLLERSKSFVGTAEYVS 333

Query: 544 PEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAK 603
           PE+L         D W  G +L++M+ G PP+   N    ++K++K    F  G     +
Sbjct: 334 PELLNDNYVDYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLVIR 393

Query: 604 DLLKRLLNRDPNRRLGANGADEIKNHKFFNDLIWD--SIWNKEYLPP 648
           DL+K++L + P +RL A+   +IK H FF D+ ++  S+W+ +  PP
Sbjct: 394 DLIKKILVKSPEQRLDAS---QIKKHHFFKDVNFNDGSVWDSD--PP 435

>Kwal_33.14554
          Length = 714

 Score =  169 bits (427), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 112/360 (31%), Positives = 181/360 (50%), Gaps = 75/360 (20%)

Query: 375 DDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVEC 434
           +DF+ + V+GKG++G+V  V+KKDT KIYA+K + KS +  K ++ H  AER +LA  + 
Sbjct: 301 EDFQTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKDQLAHVKAERDVLAGSDS 360

Query: 435 PFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFY------ASELLLAL 488
           P++V L ++FQ  + LYL++  + GG+L   L R  IF     RFY      A E +  L
Sbjct: 361 PWVVSLYYSFQDTQYLYLIMEFLPGGDLMTMLIRWQIFTEDVTRFYMAECILAIEAIHKL 420

Query: 489 DSLHK--------MDV----------------------VYRDLKPENILLDSQGHIALCD 518
             +H+        +D+                       Y+ L  ++ +  + G +    
Sbjct: 421 GFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSNYYKKLLQQDEVNAAAGSLQKPQ 480

Query: 519 FGLC--------------------KLNMKDNEKTSTF-----------CGTPEYLAPEVL 547
            G+                      L M + ++  T+            GTP+Y+APE+ 
Sbjct: 481 MGIVAGNNGGGSGNNRNTMFVDAIHLTMTNRQQIQTWRKSRRLMAYSTVGTPDYIAPEIF 540

Query: 548 LGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKIL--KSPLIFPDG--MDPDAK 603
           L +GY +  DWW+LG ++YE L G PP+  E   E Y+KI+  +  L FPD   +  +A+
Sbjct: 541 LYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQFPDDIHISYEAE 600

Query: 604 DLLKRLLNRDPNRRLGAN-GADEIKNHKFFNDLIWDSIWNKEYLPPFRPDVQNANDTSNF 662
           DL++RLL    ++RLG + GADEIK+H FF  + W++I  ++   P+ P + +  DT  F
Sbjct: 601 DLIRRLLTH-ADQRLGRHGGADEIKSHPFFRGVDWNTI--RQVEAPYIPKLSSITDTRFF 657

>AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)
           [2181 bp, 726 aa]
          Length = 726

 Score =  168 bits (426), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 95/282 (33%), Positives = 155/282 (54%), Gaps = 15/282 (5%)

Query: 376 DFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERT---ILARV 432
           DF     LG GSY  V +V ++ +Q  YA+K   K +I+ +++V +   E+    +L + 
Sbjct: 9   DFLFREELGHGSYSTVYRVVERSSQHQYAIKICSKRHIIGENKVKYVTIEKNTLNLLGQA 68

Query: 433 ECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLH 492
             P I+ L +TF   E LY V+    GGEL   L+R+ +F  + AR Y  +L+  ++ +H
Sbjct: 69  NHPGIIKLYYTFHDQENLYFVMDLAPGGELLQLLRRQRVFSEAWARHYMCQLVDTVEYIH 128

Query: 493 KMDVVYRDLKPENILLDSQGHIALCDFGLCKL-----NMKDNEKTST-FCGTPEYLAPEV 546
            M V++RDLKPEN+LLD +G + + DFG            D +K +T F GT EY++PE+
Sbjct: 129 SMGVIHRDLKPENVLLDKEGRLMIADFGAAYTVGQSDAGSDGDKPATSFVGTAEYVSPEL 188

Query: 547 LLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLL 606
           LL        D W LG +LY+ L G PP+  +N  E +++I+     +    +P A  L+
Sbjct: 189 LLENKSYYSSDVWALGCMLYQFLQGTPPFRGQNEMETFEQIVNLDYTWRIPANPLAAGLV 248

Query: 607 KRLLNRDPNRRLGANGADEIKNHKFFNDLIWDS---IWNKEY 645
            ++L  DP++R      ++IK HK+F+ + W++   IW   +
Sbjct: 249 SKILVLDPSQRY---TLEQIKKHKWFSGVDWNNKEKIWRGSW 287

>KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, start by
           similarity
          Length = 925

 Score =  167 bits (424), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 96/288 (33%), Positives = 158/288 (54%), Gaps = 17/288 (5%)

Query: 373 GIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARV 432
           GI+DF+    LG GSY  V+     ++ K YA+K + K Y++ + +V +   E+  L R+
Sbjct: 151 GINDFKFGETLGDGSYSTVLLATSIESNKKYAVKILNKEYLIKQKKVKYVNIEKNTLQRL 210

Query: 433 E-CPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSL 491
           +    I+ L FTFQ    LY +L     G+L   +++ G  +    ++YA++++ AL  +
Sbjct: 211 KNTKGIISLYFTFQDESSLYFLLEYAPNGDLLSLMRKHGSVNEKCTQYYAAQIIDALGFM 270

Query: 492 HKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNE---------KTSTFCGTPEYL 542
           H   V++RDLKPENILLD    + L DFG  +L    +E         ++++F GT EY+
Sbjct: 271 HDKGVIHRDLKPENILLDVDMKVKLTDFGTARLLDSTSEDDLKYDLLTRSNSFVGTAEYV 330

Query: 543 APEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDA 602
           +PE+L         D W  G +L++M+ G PP+   N    ++K++K    F  G     
Sbjct: 331 SPELLNDNYVDFRCDIWAFGCILFQMIAGKPPFKANNEYLTFQKVMKVQFAFTAGFPMTV 390

Query: 603 KDLLKRLLNRDPNRRLGANGADEIKNHKFFNDLIW--DSIWNKEYLPP 648
           +DL+K +L ++P RRL  N   +IK H+FF D+ +   S+W+K+  PP
Sbjct: 391 RDLVKNILIKNPERRLLIN---QIKAHQFFADVNFGNGSVWDKD--PP 433

>KLLA0E03487g complement(323764..325707) similar to sgd|S0002874
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 647

 Score =  165 bits (418), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 97/279 (34%), Positives = 149/279 (53%), Gaps = 15/279 (5%)

Query: 375 DDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERT---ILAR 431
            DF     LG GSY  V +   + T +++A+K   K +I+++++V +   E+    +LA 
Sbjct: 8   QDFSFKERLGHGSYSTVYKAVDRSTGQLFAIKVCSKKHIISENKVKYVTIEKNTLNLLAH 67

Query: 432 VECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSL 491
              P I+ L +TF   E LY VL    GGEL   LQ +G F+ +  + +  +L+ AL+ +
Sbjct: 68  GNHPGIIKLYYTFHDSENLYFVLDFAPGGELLQLLQTQGRFNEAWTKHFMCQLIDALEYI 127

Query: 492 HKMDVVYRDLKPENILLDSQGHIALCDFGLCK-LNMKDN-EKTSTFCGTPEYLAPEVLLG 549
           H   VV+RDLKPEN+LL S+G + + DFG+   L   DN   TS+F GT EY++PE+LL 
Sbjct: 128 HGCKVVHRDLKPENLLLSSEGKLMITDFGVASNLAATDNLSSTSSFVGTAEYVSPELLLQ 187

Query: 550 KGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRL 609
                  D W +G +LY+   G PP+  EN    ++KI+     +   +     DL+ ++
Sbjct: 188 NKSNFCSDIWAVGCMLYQFTQGTPPFRGENELAAFEKIVNLDYHWIYMVSQHITDLVSKI 247

Query: 610 LNRDPNRRLGANGADEIKNHKFFN-------DLIWDSIW 641
           L  DP+ R       +IKNH +F        +LIW  IW
Sbjct: 248 LVLDPDSRY---TLPQIKNHAWFQGIDWTNKELIWKGIW 283

>CAGL0G04609g complement(437162..440059) similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, hypothetical
           start
          Length = 965

 Score =  166 bits (419), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 97/292 (33%), Positives = 159/292 (54%), Gaps = 22/292 (7%)

Query: 373 GIDDFELLTVLGKGSYGKV-MQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILAR 431
           GI DF+   +LG GSY +V +   K D+ K YA+K + K Y++ + +V +   E+T L  
Sbjct: 114 GIKDFKFGDMLGDGSYSQVFLATSKTDSSKTYAVKVLNKEYLIKQKKVKYVNIEKTALQN 173

Query: 432 VE-CPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDS 490
           ++    ++ L FTFQ    LY +L     G+    +++ G  +     +Y+++++ A+ S
Sbjct: 174 LKSVTGVINLSFTFQDEANLYFLLEYAPNGDFLSLIKKFGTLNEECTIYYSAQIIDAIGS 233

Query: 491 LHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEK-----------TSTFCGTP 539
           +H   +++RD+KPENILLD    I L DFG  KL  K ++K           +S+F GT 
Sbjct: 234 MHSHGIIHRDIKPENILLDGNMKIKLTDFGTAKLLQKKSDKNGKPHYNLLTRSSSFVGTA 293

Query: 540 EYLAPEVLLGKGYTKV-VDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGM 598
           EY++PE LL   YT    D W  G L+Y+M+ G PP+   N    ++K++K    F  G 
Sbjct: 294 EYVSPE-LLSDNYTDYKCDIWAFGCLVYQMIAGKPPFKATNEYLTFQKVMKVQFAFTAGF 352

Query: 599 DPDAKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDLIW--DSIWNKEYLPP 648
               +DL+K +L + P +RL      +IK H  F ++ +  +S+WN++  PP
Sbjct: 353 PTIIRDLVKNILVKQPEKRL---TIPQIKEHCLFENINFSDNSVWNRD--PP 399

>CAGL0G03047g 282299..283918 highly similar to sp|P22204
           Saccharomyces cerevisiae YGR092w DBF2 ser/thrprotein
           kinase or sp|P32328 Saccharomyces cerevisiae YPR111w
           DBF20, hypothetical start
          Length = 539

 Score =  160 bits (406), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 109/378 (28%), Positives = 177/378 (46%), Gaps = 66/378 (17%)

Query: 375 DDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVEC 434
           +DFE+LT +G+G YG+V   RK+DT+++ ALK + K  +   +E  H L ER IL     
Sbjct: 142 NDFEMLTQVGQGGYGQVYLARKRDTKEVCALKILNKKLLHRLNETNHVLTERDILTTTRS 201

Query: 435 PFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKM 494
            ++V L + FQ    LYL +  + GG+    L        + ARFY SE+  A+++LH++
Sbjct: 202 EWLVKLLYAFQDSSSLYLAMEFVPGGDFRTLLINTKYLKSTHARFYISEMFCAVNALHEL 261

Query: 495 DVVYRDLKPENILLDSQGHIALCDFGLCK------------------------------- 523
              +RDLKPEN L+D++GHI L DFGL                                 
Sbjct: 262 GYTHRDLKPENFLIDAKGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTERPI 321

Query: 524 ---------LNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPP 574
                    L   D    ++  G+P+Y+A EVL GK Y   VD+W+LG +L+E L    P
Sbjct: 322 EDRRKMYHDLRDTDINYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVSFTP 381

Query: 575 YYDENVSEMY------KKILKSPLIFPDGMD-PDAKDLLKRLLNRDPNRRLGANGADEIK 627
           +     +E Y      +K L+ P +        D        L  DP  RL +   + +K
Sbjct: 382 FSGATTNETYENLRHWRKTLRRPRLGNGRYAVSDRTWAFITSLIADPINRLKS--FEHVK 439

Query: 628 NHKFFNDLIWDSIWNKEYLPPFRP------------DVQNANDTSNFDNEFTKQKPVDSV 675
              +F+++ +  +  +E  PPF P            D  N  D + + + F +Q  ++++
Sbjct: 440 RMPYFSEIDFSKL--REMSPPFIPQLDSEVDAGYFDDFTNEADMAKYADVFKRQNKLNAM 497

Query: 676 IDEYLSESVQNQFKGWSY 693
           ID+    +V ++  G+++
Sbjct: 498 IDD---SAVDSKLVGFTF 512

>AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C
           (PKH1) - SH] (1046762..1049863) [3102 bp, 1033 aa]
          Length = 1033

 Score =  162 bits (410), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 92/283 (32%), Positives = 150/283 (53%), Gaps = 16/283 (5%)

Query: 373 GIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARV 432
           GI DF+    LG GSY  V+     ++ K YA K + K Y++ + +V +   E+  L R+
Sbjct: 196 GIKDFKFGEALGDGSYSTVVLATCIESGKKYAAKILNKEYLIKQKKVKYVNIEKNTLQRL 255

Query: 433 ---ECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALD 489
                P ++ L FTFQ    LY +L     G+    ++R G       ++Y +++L A+ 
Sbjct: 256 NSSRVPGVIKLYFTFQDEANLYFLLEYAPNGDFLSVMKRFGTLSEECTKYYGAQILDAIH 315

Query: 490 SLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNE--------KTSTFCGTPEY 541
            LHK  +++RD+KPENILLD    I L DFG  KL  +++E        ++ +F GT EY
Sbjct: 316 HLHKQGIIHRDVKPENILLDKTMKIKLTDFGTAKLIGREDENKPYDLNTRSKSFVGTAEY 375

Query: 542 LAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPD 601
           ++PE+L         D W  G +L++M+ G PP+   N    ++K+++    F  G    
Sbjct: 376 VSPELLNDNYVDSRCDIWAFGCILFQMVAGKPPFKATNEYLTFQKVMRVQYAFTAGFPMI 435

Query: 602 AKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDLIW--DSIWN 642
            +DL+K+LL + P +RL      +I+ H FFND+ +   S+W+
Sbjct: 436 LRDLIKQLLVKKPEQRL---TILQIEKHHFFNDINFRNGSVWS 475

>CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces
           cerevisiae YOL100w PKH2, start by similarity
          Length = 1076

 Score =  158 bits (399), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 87/283 (30%), Positives = 148/283 (52%), Gaps = 17/283 (6%)

Query: 373 GIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARV 432
           GI DF+   ++G G+Y  VM    KD+ K YA+K + K Y++ + +V +   E+  L R+
Sbjct: 178 GIKDFKFGEMVGDGAYSTVMLATAKDSGKKYAVKVLNKEYLIKQKKVKYVNIEKNALQRL 237

Query: 433 E-CPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSL 491
                IV L FTFQ    LY +L     G+    +++ G       R+Y+++++  +  L
Sbjct: 238 NNSRGIVKLFFTFQDESSLYFLLEYAPNGDFLSVMKKYGSLSEDCTRYYSAQIIDGIKYL 297

Query: 492 HKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNE-----------KTSTFCGTPE 540
           H   +++RD+KPENILLD    + + DFG  K+    NE           ++ +F GT E
Sbjct: 298 HSKGIIHRDIKPENILLDKDMKVKITDFGTAKILEPKNEDEDNPEFNLLTRSKSFVGTAE 357

Query: 541 YLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDP 600
           Y++PE+L         D W  G ++++M+ G PP+   N    ++K++K    F  G   
Sbjct: 358 YVSPELLNDSYVDARCDIWAFGCMVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPV 417

Query: 601 DAKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDLIWD--SIW 641
             +DL+KR+L + P +RL      +I+ H F+ D+ ++  S+W
Sbjct: 418 VVRDLVKRILLKVPEQRL---TIPQIEKHHFYKDISFEDGSVW 457

>Scas_627.7
          Length = 349

 Score =  149 bits (377), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 94/250 (37%), Positives = 143/250 (57%), Gaps = 1/250 (0%)

Query: 370 KPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTIL 429
           KP+ +DDFE+   LGKG +GKV  VR K+T  I ALK + K+ IV  +       E  I 
Sbjct: 84  KPLSLDDFEIGKKLGKGKFGKVYCVRHKETGFICALKVMDKAEIVQYNLQKQFRREVEIQ 143

Query: 430 ARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALD 489
             +  P +  L   F   +++YL++  +  GEL+  L+  G F+   A  +  ++  AL+
Sbjct: 144 TSLNHPNLTKLYGHFHDEKRVYLLMEYLVYGELYKLLRSHGPFNDVIASRFVFQIADALN 203

Query: 490 SLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLG 549
            LH   +++RDLKPENIL+     I L DFG   +N +   K  T CGT +YL+PE++  
Sbjct: 204 YLHDKQIIHRDLKPENILIGFNNVIKLTDFGWSIINPR-GVKRKTLCGTIDYLSPEMIRS 262

Query: 550 KGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRL 609
           + Y   VD W LGVL YE++ G PP+ ++     YK+ILK+ + FP+ +  D KDL+ +L
Sbjct: 263 REYDDKVDVWALGVLTYELIVGSPPFEEDTKELTYKRILKNDIKFPETVSHDVKDLISKL 322

Query: 610 LNRDPNRRLG 619
           L  +P+ R+ 
Sbjct: 323 LKYNPSERIS 332

>KLLA0F13552g complement(1252906..1256709)
           gi|33386566|emb|CAD87727.1 Kluyveromyces lactis protein
           kinase, start by similarity
          Length = 1267

 Score =  154 bits (389), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 91/263 (34%), Positives = 145/263 (55%), Gaps = 13/263 (4%)

Query: 377 FELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTL-----AERTILAR 431
           ++L   LGKGS G+V   +  +T K+ A+K + K ++  KS  I  L      E  I+  
Sbjct: 73  WKLGKTLGKGSSGRVRLAKNMETGKLSAIKIVPKKFV--KSNQIKQLPYGIEREIIIMKL 130

Query: 432 VECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSL 491
           +  P ++ L   ++   +LYLVL  + GGELF +L  +G    S A  Y  +++ A+   
Sbjct: 131 ISHPNVMGLYEVWENKSELYLVLEYVEGGELFDYLVSKGKLPESEAIHYFKQIVQAVAYC 190

Query: 492 HKMDVVYRDLKPENILLDSQGH-IALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGK 550
           H  ++ +RDLKPEN+LLD +   I + DFG+  L   D +   T CG+P Y +PE++LG+
Sbjct: 191 HGFNICHRDLKPENLLLDKKKRSIKIADFGMAALETSD-KLLETSCGSPHYASPEIVLGR 249

Query: 551 GY-TKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRL 609
            Y     D W+ G++L+ +LTG  P+ D+NV ++  K+       P  +  +AKDL+ R+
Sbjct: 250 KYHGSPSDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQWLSVEAKDLISRI 309

Query: 610 LNRDPNRRLGANGADEIKNHKFF 632
           L  DPNRR+     D+I  H+  
Sbjct: 310 LVVDPNRRI---TIDQILQHELL 329

>Scas_660.20
          Length = 957

 Score =  153 bits (386), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 94/293 (32%), Positives = 156/293 (53%), Gaps = 32/293 (10%)

Query: 376 DFELLTVLGKGSYGKVMQ-VRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERT---ILAR 431
           DF     LG GSY  V + + K++T++I+A+K   K++I+ +S+V +   E+    +LA+
Sbjct: 10  DFIFKEELGHGSYSTVYKAIDKRNTKRIFAIKVCSKAHIIKESKVKYVTIEKNTLNLLAK 69

Query: 432 VECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSL 491
              P IV L +TF   E LY VL  + GGEL   L +   F    ++ +  +L+  L+ +
Sbjct: 70  AHHPGIVKLYYTFHDEENLYYVLDYLPGGELLSLLHKMKTFSEVWSKHFTVQLVDTLEFI 129

Query: 492 HKMDVVYRDLKPENILLDSQGHIALCDFGLCKL----NMKDNEKTSTFCGTPEYLAPEVL 547
           H   V++RDLKPEN+LLD  G + + DFG        N   N+ +S+F GT EY++PE+L
Sbjct: 130 HSQGVIHRDLKPENVLLDRDGKLMITDFGAAYTTTAGNNDANKSSSSFVGTAEYVSPELL 189

Query: 548 LGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFP------------ 595
           L    +   D W LG ++++ +TG PP+  EN  + ++KI+   L +P            
Sbjct: 190 LHNQCSFSSDVWALGCMIFQFVTGSPPFRGENELKTFEKIVA--LDYPWSSTNIHNNKFL 247

Query: 596 DGMDPDAKDLLKRLLNRDPNRRLGANGADEIKNHKFF-------NDLIWDSIW 641
           + ++P   +L++++L  +P  RL      +IK   +F        + IW  IW
Sbjct: 248 NNINPLIINLVRKILVLEPKDRL---SLKKIKQDPWFATVNWNDRNTIWKGIW 297

>YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine
           protein kinase of unknown function [2697 bp, 898 aa]
          Length = 898

 Score =  152 bits (385), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 98/308 (31%), Positives = 157/308 (50%), Gaps = 44/308 (14%)

Query: 376 DFELLTVLGKGSYGKVMQ-VRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERT---ILAR 431
           DF     LG GSY  V + + KK   KIYA+K   K +I+ +++V +   E+    +LA+
Sbjct: 10  DFIFKEELGHGSYSTVFKALDKKSPNKIYAIKVCSKKHIIKEAKVKYVTIEKNTMNLLAQ 69

Query: 432 VECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSL 491
                I+ L +TF   E LY VL    GGEL   L + G F+    R + ++L+ AL+ +
Sbjct: 70  KHHAGIIKLYYTFHDEENLYFVLDFAPGGELLSLLHKMGTFNDIWTRHFTAQLIDALEFI 129

Query: 492 HKMDVVYRDLKPENILLDSQGHIALCDFGL------------CKLN-----MKDNEKTST 534
           H   +++RDLKPEN+LLD  G + + DFG              K N      KDN+  ++
Sbjct: 130 HSHGIIHRDLKPENVLLDRDGRLMITDFGAAATIDPSLSGDSAKFNSDSNGSKDNQNCAS 189

Query: 535 FCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIF 594
           F GT EY++PE+LL        D W LG ++Y+ + G PP+  EN  + ++KI+   L +
Sbjct: 190 FVGTAEYVSPELLLYNQCGYGSDIWALGCMIYQFVQGQPPFRGENELKTFEKIVA--LDY 247

Query: 595 PDG-----------MDPDAKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDL-------I 636
           P G           ++P   +L++++L  + N R+     ++IK H +F+ +       I
Sbjct: 248 PWGPNNRINNSTSPINPLVINLVQKILVIEVNERI---SLEQIKRHPYFSKVDWNDKIKI 304

Query: 637 WDSIWNKE 644
           W  IW  +
Sbjct: 305 WRGIWQSQ 312

>Scas_502.2
          Length = 1116

 Score =  152 bits (384), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 91/284 (32%), Positives = 149/284 (52%), Gaps = 20/284 (7%)

Query: 373 GIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARV 432
           GI DF+   +LG G+Y  VM     D+ K YA+K + K Y++ + +V +   E+  L R+
Sbjct: 170 GIKDFKFGEMLGDGAYSTVMLATSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKLALQRL 229

Query: 433 E-CPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSL 491
                I+ L FTFQ    LY +L     G+L   +++ G  +     +Y ++++ A+  +
Sbjct: 230 NNSRSIIRLFFTFQDEASLYFLLEYAPNGDLLSLMKKFGSLNEECCCYYGAQIIDAIKFM 289

Query: 492 HKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNE----------KTSTFCGTPEY 541
           H   +++RD+KPENILLD    + + DFG  K+   DN+          ++ +F GT EY
Sbjct: 290 HSKGIIHRDIKPENILLDKDMKVKITDFGTAKI--LDNKPPGTSYDLLTRSKSFVGTAEY 347

Query: 542 LAPEVLLGKGYTKV-VDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDP 600
           ++PE LL   YT    D W  G ++++M+ G PP+   N    ++K++K    F  G   
Sbjct: 348 VSPE-LLNDNYTDARSDIWAFGCIVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPT 406

Query: 601 DAKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDLIWD--SIWN 642
             +DL+KR+L + P +RL     + I+ H FF    +   SIWN
Sbjct: 407 VVRDLVKRILIKAPEQRL---TIEAIEKHHFFRSKNFQDSSIWN 447

>Kwal_47.18233
          Length = 598

 Score =  145 bits (365), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 100/310 (32%), Positives = 162/310 (52%), Gaps = 18/310 (5%)

Query: 374 IDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTI--LAR 431
           I  ++++  LG+GS+GKV       T +  ALK I K  ++AKS+ +    ER I  L  
Sbjct: 28  IGKYQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKK-VLAKSD-MQGRIEREISYLRL 85

Query: 432 VECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSL 491
           +  P I+ L    ++ +++ +V+    G ELF ++ +      + AR +  +++ A++  
Sbjct: 86  LRHPHIIKLYDVVKSKDEIVMVIEYA-GNELFDYIVQRDKMSENEARRFFQQIISAVEYC 144

Query: 492 HKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKG 551
           H+  +V+RDLKPEN+LLD   ++ + DFGL  + M D     T CG+P Y APEV+ GK 
Sbjct: 145 HRHKIVHRDLKPENLLLDEHLNVKIADFGLSNI-MTDGNFLRTSCGSPNYAAPEVISGKL 203

Query: 552 YTK-VVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRLL 610
           Y    VD W+ GV+LY ML    P+ DE++  ++K I       P  + P A +L+KR+L
Sbjct: 204 YAGPEVDVWSSGVILYVMLCRRLPFDDESIPVLFKNISNGIYTLPKFLSPGAANLIKRML 263

Query: 611 NRDPNRRLGANGADEIKNHKFFNDLIWDSIWNKEYLPPFRPDVQNANDTSNFDNEFTKQK 670
             +P  R        I  H+   D  W  +  ++YL P  PD++N  +    D E   Q 
Sbjct: 264 IVNPLNR--------ITIHEIMQDE-WFKVDMQDYLIP--PDLKNEAENHGHDGEQQGQN 312

Query: 671 PVDSVIDEYL 680
             +  +D+ L
Sbjct: 313 DAEEEVDDSL 322

>Kwal_47.18307
          Length = 621

 Score =  145 bits (365), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 95/325 (29%), Positives = 165/325 (50%), Gaps = 20/325 (6%)

Query: 375 DDFELLTVLGKGSYGKVMQ-VRKKDTQKIYALKAIRKSYIVAKSEVIHTLAER---TILA 430
           D +  L  LG+GSY  V + V + ++ + YA+K   K +I+ + +V +   E+    +LA
Sbjct: 8   DSYVFLDRLGQGSYSTVYRAVERSNSGRNYAIKVCSKKHIIREKKVKYVTIEKDLLNMLA 67

Query: 431 RVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDS 490
           +     IV L  TF   E LY VL  ++GGEL   +QR G      +R   ++L+  +D 
Sbjct: 68  KGGHLGIVKLFCTFHDIENLYFVLEYVSGGELLALIQRLGRLTEDLSRHITAQLVDTVDY 127

Query: 491 LHKMDVVYRDLKPENILLDSQGHIALCDFG-LCKL---NMKDNEKTSTFCGTPEYLAPEV 546
           +H   V++RDLKPEN+LL  +G + + DFG  C       ++ ++T++F GT EY++PE+
Sbjct: 128 MHSKGVIHRDLKPENVLLSQEGRVVITDFGAACTAADRKFENTKRTASFVGTAEYVSPEL 187

Query: 547 LLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLL 606
           LL        D W LG ++Y++  G PP+  EN  + ++KI+     +     P    ++
Sbjct: 188 LLHSQCGFSSDIWALGCIIYQLNQGKPPFRGENELQTFEKIVALDYKWLFSNSPQVVSIV 247

Query: 607 KRLLNRDPNRRLGANGADEIKNHKFFNDLIWD---SIWNKEYLPPFRPDVQNANDTSNFD 663
           + +L  DP +R     A ++K + +F  + WD   S+W   +    +  V      S+ +
Sbjct: 248 QSILVTDPLKR---PSAAQLKQNPWFASIDWDNRSSLWKGIWELAGKNTVPRGAQQSHTN 304

Query: 664 N------EFTKQKPVDSVIDEYLSE 682
                    T++KPV +     ++E
Sbjct: 305 GVPAGGLRITRRKPVQATGTTAIAE 329

>CAGL0M08910g complement(887703..889541) highly similar to sp|Q00372
           Saccharomyces cerevisiae YDR477w carbon catabolite
           derepressing ser/thr protein kinase, hypothetical start
          Length = 612

 Score =  143 bits (360), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 97/310 (31%), Positives = 160/310 (51%), Gaps = 21/310 (6%)

Query: 374 IDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTI--LAR 431
           + +++++  LG+GS+GKV       T +  ALK I K  ++AKS+ +    ER I  L  
Sbjct: 36  VGNYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKK-VLAKSD-MQGRIEREISYLRL 93

Query: 432 VECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSL 491
           +  P I+ L    ++ +++ +V+    G ELF ++ +        AR +  +++ A++  
Sbjct: 94  LRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRNKMSEQEARRFFQQIISAVEYC 152

Query: 492 HKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKG 551
           H+  +V+RDLKPEN+LLD   ++ + DFGL  + M D     T CG+P Y APEV+ GK 
Sbjct: 153 HRHKIVHRDLKPENLLLDEHLNVKIADFGLSNI-MTDGNFLKTSCGSPNYAAPEVISGKL 211

Query: 552 YTK-VVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRLL 610
           Y    VD W+ GV+LY ML    P+ DE++  ++K I       P  + P A DL+KR+L
Sbjct: 212 YAGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGASDLIKRML 271

Query: 611 NRDPNRRLGANGADEIKNHKFFNDLIWDSIWNKEYLPPFRPDVQNANDTSNFDNEFTKQK 670
             +P  R+          H+   D  W  +   EYL P     Q+      F+ +   ++
Sbjct: 272 IVNPLNRISI--------HEIMQDE-WFKVDLAEYLVP-----QDLKQQEQFNKKSGNEE 317

Query: 671 PVDSVIDEYL 680
            V+ + DE +
Sbjct: 318 NVEEIDDEMV 327

>YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine
           protein kinase essential for derepression of
           glucose-repressed genes, acts in concert with Snf4p,
           involved in aging [1902 bp, 633 aa]
          Length = 633

 Score =  142 bits (359), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 103/321 (32%), Positives = 165/321 (51%), Gaps = 20/321 (6%)

Query: 365 KPSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLA 424
           K S +    I +++++  LG+GS+GKV       T +  ALK I K  ++AKS+ +    
Sbjct: 43  KSSLADGAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKK-VLAKSD-MQGRI 100

Query: 425 ERTI--LARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYAS 482
           ER I  L  +  P I+ L    ++ +++ +V+    G ELF ++ +        AR +  
Sbjct: 101 EREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEARRFFQ 159

Query: 483 ELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYL 542
           +++ A++  H+  +V+RDLKPEN+LLD   ++ + DFGL  + M D     T CG+P Y 
Sbjct: 160 QIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNI-MTDGNFLKTSCGSPNYA 218

Query: 543 APEVLLGKGYTK-VVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPD 601
           APEV+ GK Y    VD W+ GV+LY ML    P+ DE++  ++K I       P  + P 
Sbjct: 219 APEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPG 278

Query: 602 AKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDLIWDSIWNKEYLPPFRPDVQNANDTSN 661
           A  L+KR+L  +P  R+          H+   D  W  +   EYL P  PD++   +  N
Sbjct: 279 AAGLIKRMLIVNPLNRISI--------HEIMQD-DWFKVDLPEYLLP--PDLKPHPEEEN 327

Query: 662 FDNEFTK--QKPVDSVIDEYL 680
            +N+  K    P +  ID+ L
Sbjct: 328 ENNDSKKDGSSPDNDEIDDNL 348

>KLLA0D07810g complement(669095..671251)
           gi|401646|sp|P31034|YL44_KLULA Kluyveromyces lactis
           Hypothetical 31.8 kDa protein in L44/L41 3 region, start
           by similarity
          Length = 718

 Score =  142 bits (359), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 101/148 (68%)

Query: 375 DDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVEC 434
           DDF  + V+GKG++G+V  V+KKDT KIYA+K + KS +  K ++ H  AER +LA  + 
Sbjct: 301 DDFNSVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYNKDQLAHVKAERDVLAGSDS 360

Query: 435 PFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKM 494
           P++V L ++FQ  + LYL++  + GG+L   L R  IF     RFY +E +LA++ +HK+
Sbjct: 361 PWVVSLYYSFQDSQYLYLIMEFLPGGDLMTMLIRWQIFTEDVTRFYMAECILAIEVIHKL 420

Query: 495 DVVYRDLKPENILLDSQGHIALCDFGLC 522
             ++RD+KP+NIL+D +GHI L DFGL 
Sbjct: 421 GFIHRDIKPDNILIDIRGHIKLSDFGLS 448

 Score =  109 bits (272), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 80/131 (61%), Gaps = 6/131 (4%)

Query: 536 CGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKIL--KSPLI 593
            GTP+Y+APE+ L +GY +  DWW+LG ++YE L G PP+  E   E Y+KI+  +  L 
Sbjct: 531 VGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQ 590

Query: 594 FPDG--MDPDAKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDLIWDSIWNKEYLPPFRP 651
           FPD   +  +A+DL++RLL    NR     GADEIK H FF+ + W++I  ++   P+ P
Sbjct: 591 FPDDIHISYEAEDLIRRLLTHSENRLGRHGGADEIKAHPFFSGVDWNTI--RQVEAPYIP 648

Query: 652 DVQNANDTSNF 662
            + +  DT  F
Sbjct: 649 KLSSVTDTRFF 659

>AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH]
           complement(498529..500688) [2160 bp, 719 aa]
          Length = 719

 Score =  142 bits (358), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 66/148 (44%), Positives = 102/148 (68%)

Query: 375 DDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVEC 434
           +DF  + V+GKG++G+V  V+KKDT KIYA+K + KS +  K ++ H  AER +LA  + 
Sbjct: 308 EDFHTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKDQLAHVKAERDVLAGSDS 367

Query: 435 PFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKM 494
           P++V L ++FQ  + LYL++  + GG+L   L R  IF     RFY +E +LA++++HK+
Sbjct: 368 PWVVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIRWQIFTEDVTRFYMAECILAIEAIHKL 427

Query: 495 DVVYRDLKPENILLDSQGHIALCDFGLC 522
             ++RD+KP+NIL+D +GHI L DFGL 
Sbjct: 428 GFIHRDIKPDNILIDIRGHIKLSDFGLS 455

 Score =  114 bits (284), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 55/131 (41%), Positives = 85/131 (64%), Gaps = 7/131 (5%)

Query: 536 CGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKIL--KSPLI 593
            GTP+Y+APE+ L +GY +  DWW+LG ++YE L G PP+  E   E Y+KI+  +  L+
Sbjct: 532 VGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLV 591

Query: 594 FPDG--MDPDAKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDLIWDSIWNKEYLPPFRP 651
           FPD   +  +A+DL++RLL+   + RLG +GA+EIKNH FF  + W++I  ++   P+ P
Sbjct: 592 FPDDIHISYEAEDLIRRLLSH-ADERLGRHGANEIKNHPFFRGVDWETI--RQVGAPYIP 648

Query: 652 DVQNANDTSNF 662
            + +  DT  F
Sbjct: 649 KLSSVTDTRFF 659

>Scas_616.10
          Length = 1461

 Score =  142 bits (359), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 101/345 (29%), Positives = 164/345 (47%), Gaps = 50/345 (14%)

Query: 331 VVLDMNSASNFRL------FNHQWINLKQGLGTINLTVDFKPSYSKPVG-IDDFELLTVL 383
           V  D N+ +N  L       N     L Q     + + D K S  K    +  ++L   L
Sbjct: 48  VPKDSNAKTNAHLERVIQSVNDATKRLSQQDSQFSTSTDTKSSKRKSRDTVGPWKLGKTL 107

Query: 384 GKGSYGKVMQVRKKDTQKIYALKAIRK-------------SYIVAKSEV---IHTLA--- 424
           GKGS G+V   +  +T ++ A+K + K             S+  A S     I TLA   
Sbjct: 108 GKGSSGRVRLAKNIETGQLAAIKIVPKKHKLFMKSSHSNVSFFSAASNSNSNISTLATSP 167

Query: 425 ------------------ERTILARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHL 466
                             E  I+  +  P ++ L   ++   +LYLVL  ++GGELF +L
Sbjct: 168 PMNNGSEKNQPNPYGIEREIVIMKLISHPNVMALYEVWENKSELYLVLEYVDGGELFDYL 227

Query: 467 QREGIFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGH-IALCDFGLCKLN 525
             +G      A  Y  +++  +   H  ++ +RDLKPEN+LLD +   I + DFG+  L 
Sbjct: 228 VSKGKLSEKEAVHYFKQIIQGVSYCHSFNICHRDLKPENLLLDKKNKSIKIADFGMAALE 287

Query: 526 MKDNEKTSTFCGTPEYLAPEVLLGKGY-TKVVDWWTLGVLLYEMLTGLPPYYDENVSEMY 584
           +  N+   T CG+P Y +PE+++GK Y     D W+ G++L+ +LTG  P+ D+N+ ++ 
Sbjct: 288 LP-NKLLQTSCGSPHYASPEIVMGKSYHGGPSDVWSCGIILFALLTGHLPFNDDNIKKLL 346

Query: 585 KKILKSPLIFPDGMDPDAKDLLKRLLNRDPNRRLGANGADEIKNH 629
            K+       P  + P+A+DL+ R+L  DP++R+     D I NH
Sbjct: 347 LKVQAGKFRMPSTLSPEAQDLISRILVIDPSKRI---TTDRILNH 388

>YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kinase
           required for induction of Rnr3p and DNA repair genes
           after DNA damage [1542 bp, 513 aa]
          Length = 513

 Score =  138 bits (348), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 101/301 (33%), Positives = 148/301 (49%), Gaps = 34/301 (11%)

Query: 365 KPSYSKPVGI-DDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTL 423
           K + ++PV   D + L   LG G Y  V + + K T +  A+K         + +     
Sbjct: 187 KLNKTRPVSFFDKYLLGKELGAGHYALVKEAKNKKTGQQVAVKIFHAQQNDDQKKNKQFR 246

Query: 424 AERTILARVECPFIVPLKFTFQTPE-----KLYLVLACINGGELFHHLQREGIFDISRAR 478
            E  IL RV+ P IV L  +F  P      + YLVL  I+ GELF  + R+       ++
Sbjct: 247 EETNILMRVQHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQDESK 306

Query: 479 FYASELLLALDSLHKMDVVYRDLKPENILLD-------SQGH------------IALCDF 519
               +LL  L  LH+ ++++RD+KPENILL+       SQ              + + DF
Sbjct: 307 ALFKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADF 366

Query: 520 GLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDE- 578
           GL K    + + T+T CGTP Y+APEVL  KGYT  VD W+ GV+LY  L G PP+ D+ 
Sbjct: 367 GLAKF-TGEMQFTNTLCGTPSYVAPEVLTKKGYTSKVDLWSAGVILYVCLCGFPPFSDQL 425

Query: 579 NVSEMYKKILKSPLIFP----DGMDPDAKDLLKRLLNRDPNRRLGANGADEIKNHKFFND 634
               + ++IL++   F     D +D     L+  LL  +P+ R      DE  NH +FND
Sbjct: 426 GPPSLKEQILQAKYAFYSPYWDKIDDSVLHLISNLLVLNPDERY---NIDEALNHPWFND 482

Query: 635 L 635
           +
Sbjct: 483 I 483

>Kwal_56.22476
          Length = 697

 Score =  139 bits (350), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 89/274 (32%), Positives = 142/274 (51%), Gaps = 9/274 (3%)

Query: 366 PSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAE 425
           PS  K  G  D+     LG+G + +  Q+ K D  KI+A K + K  I ++      L+E
Sbjct: 69  PSLIKTRG-RDYHRGHFLGEGGFARCFQI-KDDGGKIFAAKTVAKISIKSEKTRKKLLSE 126

Query: 426 RTILARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELL 485
             I   +    IV     F+    +Y++L     G L   L+R  +      RF+ ++++
Sbjct: 127 IQIHKSMRHTNIVQFVDCFEDDTNVYILLEICPNGSLMDLLKRRKMLTEPEVRFFTTQIV 186

Query: 486 LALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPE 545
            A+  +H   V++RDLK  NI  D   ++ + DFGL  +   D E+  T CGTP Y+APE
Sbjct: 187 GAVKYMHSRRVIHRDLKLGNIFFDKHYNLKVGDFGLAAVLANDRERKYTVCGTPNYIAPE 246

Query: 546 VLLGK--GYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDG--MDPD 601
           VL GK  G++  VD W+ GV++Y +L G PP+  + V+ +Y++I     +FP    + P+
Sbjct: 247 VLTGKHTGHSYEVDIWSCGVMIYALLIGKPPFQAKEVNIIYERIKCGDFVFPKDKFISPE 306

Query: 602 AKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDL 635
           A  L+K +L+ DP  R      DEI ++ +F  L
Sbjct: 307 ALVLIKDILSIDPLER---PSLDEIIDYVWFRGL 337

>CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4 ser/thr protein kinase or
           tr|Q03002 Saccharomyces cerevisiae YPL141c, start by
           similarity
          Length = 661

 Score =  139 bits (349), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 83/259 (32%), Positives = 140/259 (54%), Gaps = 20/259 (7%)

Query: 381 TVLGKGSYGKVM----------QVRKKDTQKIYALKAIRKSYIVAKSEV-IHTLAERTIL 429
           + LG+G +GKV             ++    K  A+K IR+  IV  SE  I    E   L
Sbjct: 48  STLGEGEFGKVKLGWTRTPSTGPEQRPAVSKQVAIKLIRRDTIVKNSEKEIKIYREINAL 107

Query: 430 ARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALD 489
             +  P +V L+   Q  + + +VL   +GGE + ++QR+     S A    ++L+  + 
Sbjct: 108 KHLTHPNVVRLEEVLQNSKYIGIVLEYASGGEFYKYIQRKRRLKESTACRLFAQLISGVT 167

Query: 490 SLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLG 549
            +H  ++V+RDLK EN+LLD   ++ + DFG     + DNE   T CG+P Y APE+++ 
Sbjct: 168 YMHSKNLVHRDLKLENLLLDKNENLVITDFGFVNEFLPDNEYMKTSCGSPCYAAPELVIS 227

Query: 550 -KGY-TKVVDWWTLGVLLYEMLTGLPPYYD-------ENVSEMYKKILKSPLIFPDGMDP 600
            + Y  +  D W+ G++LY ML G  P+ D       +++ ++Y+ I ++PL FP+ + P
Sbjct: 228 TRPYVARKADVWSCGIILYAMLAGYLPWDDDSTNPEGDDIGKLYQYITRTPLKFPEYITP 287

Query: 601 DAKDLLKRLLNRDPNRRLG 619
             +DLL+++L  DPN+R+ 
Sbjct: 288 IPRDLLRKILVPDPNKRVN 306

>Kwal_26.7788
          Length = 1267

 Score =  140 bits (353), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 78/251 (31%), Positives = 135/251 (53%), Gaps = 4/251 (1%)

Query: 374 IDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILAR-V 432
           I  ++L   LGKGS G+V   +  +T K+ A+K + K+       + + +    I+ + +
Sbjct: 55  IGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKTKSSRTGSLPYGIEREIIIMKLI 114

Query: 433 ECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLH 492
             P ++ L   ++   +L+LVL  ++GGELF +L   G      A  Y  +++      H
Sbjct: 115 SHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLPEKEAIHYFRQIIEGTAYCH 174

Query: 493 KMDVVYRDLKPENILLDSQG-HIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKG 551
             ++ +RDLKPEN+LLD +   I + DFG+  L    N+   T CG+P Y +PE+++GK 
Sbjct: 175 GFNICHRDLKPENLLLDKKNKRIKIADFGMAALQT-SNKLLETSCGSPHYASPEIVMGKN 233

Query: 552 YT-KVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRLL 610
           Y     D W+ G++L+ +LTG  P+ D+N+  +  K+       P  +   A+DL+ R+L
Sbjct: 234 YNGGPSDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMPQSVSSGAQDLISRIL 293

Query: 611 NRDPNRRLGAN 621
             DP++R+  N
Sbjct: 294 VVDPDKRISIN 304

>Scas_654.12
          Length = 737

 Score =  139 bits (349), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 101/148 (68%)

Query: 375 DDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVEC 434
           +DF  + V+GKG++G+V  V+K DT KIYA+K + KS +  K ++ H  AER +LA  + 
Sbjct: 317 EDFHTVKVIGKGAFGEVRLVQKIDTGKIYAMKTLLKSEMYKKDQLAHVKAERDVLAGSDS 376

Query: 435 PFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKM 494
           P++V L ++FQ  + LYL++  + GG+L   L R  +F     RFY +E +LA++++HK+
Sbjct: 377 PWVVSLYYSFQDTQYLYLIMEFLPGGDLMTMLIRWQLFTEDVTRFYMAECILAIETIHKL 436

Query: 495 DVVYRDLKPENILLDSQGHIALCDFGLC 522
             ++RD+KP+NIL+D +GHI L DFGL 
Sbjct: 437 GFIHRDIKPDNILIDIRGHIKLSDFGLS 464

 Score =  105 bits (262), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 55/132 (41%), Positives = 84/132 (63%), Gaps = 8/132 (6%)

Query: 536 CGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKIL--KSPLI 593
            GTP+Y+APE+ L +GY +  DWW+LG ++YE L G PP+  E   E Y+KI+  +  L 
Sbjct: 548 VGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQ 607

Query: 594 FPDG--MDPDAKDLLKRLLNRDPNRRLGAN-GADEIKNHKFFNDLIWDSIWNKEYLPPFR 650
           FPD   +  +A+DL++RLL    ++RLG + GADEIK+H FF  + W++I  ++   P+ 
Sbjct: 608 FPDDIHISYEAEDLIRRLLTH-ADQRLGRHGGADEIKSHPFFRGVDWNTI--RQVEAPYI 664

Query: 651 PDVQNANDTSNF 662
           P + +  DT  F
Sbjct: 665 PKLSSITDTRFF 676

>ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH]
           complement(344395..346521) [2127 bp, 708 aa]
          Length = 708

 Score =  139 bits (349), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 82/256 (32%), Positives = 136/256 (53%), Gaps = 6/256 (2%)

Query: 366 PSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAE 425
           PS  K  G  D+     LG+G + +  Q+ K D+ K++A K + K  I ++      L+E
Sbjct: 63  PSLIKTKG-RDYHRGMFLGEGGFARCFQM-KDDSGKVFAAKTVAKISIKSEKTRKKLLSE 120

Query: 426 RTILARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELL 485
             I   ++ P IV     F+    +Y++L     G L   L++         RF+ ++++
Sbjct: 121 IQIHKSMKHPNIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPEVRFFTTQIV 180

Query: 486 LALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPE 545
            A+  +H   +++RDLK  NI  D   ++ + DFGL  +   D E+  T CGTP Y+APE
Sbjct: 181 GAIKYMHSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIAPE 240

Query: 546 VLLGK--GYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDG--MDPD 601
           VL GK  G++  VD W++GV++Y +L G PP+  + V+ +Y++I      FP    +  +
Sbjct: 241 VLTGKHTGHSFEVDIWSIGVMIYALLIGKPPFQAKEVNTIYERIKVCDFSFPKDKPISSE 300

Query: 602 AKDLLKRLLNRDPNRR 617
           AK L+K +L+ DP  R
Sbjct: 301 AKVLIKDILSLDPLER 316

>KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication, start by similarity
          Length = 708

 Score =  138 bits (347), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 84/256 (32%), Positives = 133/256 (51%), Gaps = 6/256 (2%)

Query: 366 PSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAE 425
           PS  K  G  D+     LG+G + +  Q+ K D  K++A K + K  I ++      L+E
Sbjct: 80  PSLIKTRG-RDYHRGHFLGEGGFARCFQM-KDDKGKVFAAKTVAKLSIKSEKTRRKLLSE 137

Query: 426 RTILARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELL 485
             I   ++ P IV     F+    +Y++L     G +   L++         RF   +++
Sbjct: 138 IQIHKSMKHPNIVQFTDCFEDDTNVYILLEICPNGSVMELLRQRKHLTEPEVRFCMIQII 197

Query: 486 LALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPE 545
            A+  +H   V++RDLK  NI  D + ++ + DFGL  +   D E+  T CGTP Y+APE
Sbjct: 198 GAIRYMHSRRVIHRDLKLGNIFFDKEYNLKIGDFGLAAVLANDKERKYTICGTPNYIAPE 257

Query: 546 VLLGK--GYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDG--MDPD 601
           VL GK  G++  VD W++GV+LY +L G PP+  + V  +Y++I     IFP    +  D
Sbjct: 258 VLTGKHTGHSYEVDIWSIGVMLYALLFGKPPFQAKEVETIYERIKCRDFIFPADKPVSSD 317

Query: 602 AKDLLKRLLNRDPNRR 617
           AK+L+  LL  +P  R
Sbjct: 318 AKNLISHLLQLNPAAR 333

>AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH]
           complement(198401..200227) [1827 bp, 608 aa]
          Length = 608

 Score =  137 bits (345), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 92/279 (32%), Positives = 147/279 (52%), Gaps = 9/279 (3%)

Query: 345 NHQWINLKQGLGTINLTVDFKPSYSKPVG--IDDFELLTVLGKGSYGKVMQVRKKDTQKI 402
           NH     K   G  N+        S P+G  I  ++++  LG+GS+GKV       T + 
Sbjct: 5   NHHHQQQKMYTGGRNMPHGMHRPGSIPIGQRIGKYQVIKTLGEGSFGKVKLAHHVSTGQK 64

Query: 403 YALKAIRKSYIVAKSEVIHTLAERTI--LARVECPFIVPLKFTFQTPEKLYLVLACINGG 460
            ALK I K  ++AKS+ +    ER I  L  +  P I+ L    ++ +++ +V+    G 
Sbjct: 65  VALKIINKK-VLAKSD-MQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GN 121

Query: 461 ELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFG 520
           ELF ++ +      + AR +  +++ A++  H+  +V+RDLKPEN+LLD   ++ + DFG
Sbjct: 122 ELFDYIVQRDKMSENEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFG 181

Query: 521 LCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTK-VVDWWTLGVLLYEMLTGLPPYYDEN 579
           L  + M D     T CG+P Y APEV+ GK Y    VD W+ GV+LY ML    P+ DE+
Sbjct: 182 LSNI-MTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDES 240

Query: 580 VSEMYKKILKSPLIFPDGMDPDAKDLLKRLLNRDPNRRL 618
           +  ++K I       P  +   A +L+KR+L  +P  R+
Sbjct: 241 IPVLFKNISNGVYSIPKFLSQGAANLIKRMLIVNPLNRI 279

>ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH]
           complement(333434..337711) [4278 bp, 1425 aa]
          Length = 1425

 Score =  139 bits (349), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 78/249 (31%), Positives = 132/249 (53%), Gaps = 8/249 (3%)

Query: 377 FELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLA-----ERTILAR 431
           ++L   LGKGS G+V   +   + K+ A+K + K  +    + +  L      E  I+  
Sbjct: 61  WKLGKTLGKGSSGRVRLAKNMQSGKLAAIKIVPKRNVRHNQKQVTALPYGIEREIIIMKL 120

Query: 432 VECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSL 491
           +  P I+ L   ++   +LYLVL  + GGELF +L   G      A  Y  +++  +   
Sbjct: 121 ITHPNIMALYEVWENKSELYLVLEYVEGGELFDYLIARGKLPEQEAIHYFKQIVQGVSYC 180

Query: 492 HKMDVVYRDLKPENILLDSQGH-IALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGK 550
           H  ++ +RDLKPEN+LLD +   + + DFG+  L    N    T CG+P Y +PE+++G+
Sbjct: 181 HNFNICHRDLKPENLLLDKKNKTVKIADFGMAALETT-NRLLETSCGSPHYASPEIVMGQ 239

Query: 551 GY-TKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRL 609
            Y     D W+ G++L+ +LTG  P+ D+NV ++  K+       P  +  +AKDL+ ++
Sbjct: 240 KYHGSPSDVWSCGIILFALLTGHLPFNDDNVRKLLLKVQHGRYQMPSNVSKEAKDLISKI 299

Query: 610 LNRDPNRRL 618
           L  DP +R+
Sbjct: 300 LVVDPEKRI 308

>CAGL0J11638g complement(1128620..1130860) highly similar to
           sp|P32562 Saccharomyces cerevisiae YMR001c CDC5 involved
           in regulation of DNA replication, hypothetical start
          Length = 746

 Score =  136 bits (343), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 85/288 (29%), Positives = 142/288 (49%), Gaps = 19/288 (6%)

Query: 366 PSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAE 425
           PS  K  G  D+     LG+G + +  Q+ K D+ KI+A K + K  I ++      L+E
Sbjct: 71  PSLIKTRG-RDYHRGQFLGEGGFARCFQI-KDDSGKIFAAKTVAKISIKSEKTRKKLLSE 128

Query: 426 RTILARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELL 485
             I   +    IV     F+    +Y++L     G L   +++         RF+ +++ 
Sbjct: 129 IQIHKSMSHTNIVQFIDCFEDNVNVYILLEICPNGSLMELIKKRKTITEPEVRFFMTQIC 188

Query: 486 LALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPE 545
             +  +H   V++RDLK  NI  D   ++ + DFGL  +   D E+  T CGTP Y+APE
Sbjct: 189 GGIQYMHSNRVIHRDLKLGNIFFDEHYNLKIGDFGLAAVLANDRERKFTICGTPNYIAPE 248

Query: 546 VLLGK--GYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFP--DGMDPD 601
           VL+GK  G++  VD W++GV+LY +L G PP+  ++V+ +Y++I +    +P    +  D
Sbjct: 249 VLMGKHSGHSYEVDIWSIGVMLYALLIGKPPFQAKDVNTIYERIKQRNFAYPKDKKISQD 308

Query: 602 AKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDLIWDSIWNKEYLPPF 649
           AK L+  +L+ +P  R                  I D +W +   PP+
Sbjct: 309 AKYLIDDILSLNPMERPSIQE-------------IMDYVWFRGTFPPY 343

>Scas_700.34
          Length = 864

 Score =  136 bits (343), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 96/296 (32%), Positives = 150/296 (50%), Gaps = 28/296 (9%)

Query: 381 TVLGKGSYGKVMQVRKK----------DTQKIYALKAIRKSYIVA-KSEVIHTLAERTIL 429
           + LG+G +GKV     K          D  K  A+K IR+  I    S+ I    E   L
Sbjct: 52  STLGEGEFGKVKLGWPKNSLPSSSSGIDVPKQVAIKLIRRDTISKDSSKEIKIYREINAL 111

Query: 430 ARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALD 489
             +  P IV L+   Q  + + +VL   +GGE + ++QR+       A    ++L+  + 
Sbjct: 112 KHLTHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQRKKRLKEGPACRLFAQLINGVH 171

Query: 490 SLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLG 549
            +H   +V+RDLK EN+LLD   ++ + DFG         E   T CG+P Y APE+++ 
Sbjct: 172 YIHSKGLVHRDLKLENLLLDKHENLIITDFGFVSEFYSHGELMKTSCGSPCYAAPELVVS 231

Query: 550 -KGY-TKVVDWWTLGVLLYEMLTGLPPYYD-------ENVSEMYKKILKSPLIFPDGMDP 600
            K Y  K  D W+ GV+LY ML G  P+ D       +++S +Y  I ++PL FPD ++P
Sbjct: 232 TKPYEAKKADIWSCGVILYAMLAGYLPWDDDAGNPDGDDISRLYHYITQTPLKFPDYINP 291

Query: 601 DAKDLLKRLLNRDPNRRLGANGADE---IKNHKFFNDLI---WDSIWNKEYLPPFR 650
             +DLL+R+L  DP RR+     ++   +K H  F  +    WD+I +K++  P R
Sbjct: 292 IPRDLLRRILISDPRRRITIKYIEKHEWLKPHSAFLSITPEEWDTIMHKKF--PLR 345

>Kwal_0.96
          Length = 427

 Score =  131 bits (329), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 86/258 (33%), Positives = 136/258 (52%), Gaps = 14/258 (5%)

Query: 372 VGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTL-AERTILA 430
           V   D+     LG GS+G V Q R+  + +  A+K + K  +  K   +  L  E +IL 
Sbjct: 41  VNKSDYIFGKTLGAGSFGVVRQARQVSSGENVAIKILLKKALKGKDVELQMLYDELSILQ 100

Query: 431 RVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDS 490
           +++ P IV  K  F++ +K Y+V     GGELF  + ++G F    A     ++L A++ 
Sbjct: 101 KLDHPNIVKFKDWFESKDKFYIVTQLATGGELFDRILKQGKFTEEDAVRIVYQILKAVEY 160

Query: 491 LHKMDVVYRDLKPENIL-----LDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPE 545
           LH  ++V+RDLKPEN+L      DSQ  + L DFG+ K    D+E      G+  Y+APE
Sbjct: 161 LHSRNIVHRDLKPENLLYLTEAADSQ--LVLGDFGIAKELKNDDELIHKAAGSMGYVAPE 218

Query: 546 VLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKK--ILKSPLIFP----DGMD 599
           V+   G+ K  D W+LGV+ Y +L G  P+  E+V    ++  I ++P+ F       + 
Sbjct: 219 VVTTSGHGKPCDIWSLGVVTYTLLCGYSPFVAESVEGFLEECTIGRTPVTFHKPYWSNIS 278

Query: 600 PDAKDLLKRLLNRDPNRR 617
            +AKD + R L  +P+ R
Sbjct: 279 NEAKDFILRALTVNPHDR 296

>KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235.1
           Kluyveromyces lactis putative kinase, start by
           similarity
          Length = 602

 Score =  133 bits (335), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 84/248 (33%), Positives = 136/248 (54%), Gaps = 7/248 (2%)

Query: 374 IDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTI--LAR 431
           I  ++++  LG+GS+GKV       T +  ALK I K  ++AKS+ +    ER I  L  
Sbjct: 32  IGKYQIIKTLGEGSFGKVKLAYHISTGQKVALKIINKK-VLAKSD-MQGRIEREISYLRL 89

Query: 432 VECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSL 491
           +  P I+ L    ++ +++ +V+    G ELF ++ +        AR +  +++ A+D  
Sbjct: 90  LRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMPEQEARRFFQQIISAVDYC 148

Query: 492 HKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKG 551
           H+  +V+RDLKPEN+LLD   ++ + DFGL  + M D     T CG+P Y APEV+ GK 
Sbjct: 149 HRHKIVHRDLKPENLLLDEHLNVKIADFGLSNI-MTDGNFLKTSCGSPNYAAPEVISGKL 207

Query: 552 YTK-VVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRLL 610
           Y    VD W+ GV+LY ML    P+ DE++  ++K I       P+ +   A  L+K++L
Sbjct: 208 YAGPEVDVWSSGVILYVMLCRRLPFDDESIPVLFKNISNGVYTIPNFLSQGAASLIKKML 267

Query: 611 NRDPNRRL 618
             +P  R+
Sbjct: 268 IVNPVNRI 275

>CAGL0K06479g 636296..639271 some similarities with tr|Q03306
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 991

 Score =  135 bits (339), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 94/301 (31%), Positives = 151/301 (50%), Gaps = 45/301 (14%)

Query: 383 LGKGSYGKVMQVRKKDTQKI-YALKAIRKSYIVAKSEVIHTLAERT---ILARVECPFIV 438
           LG GSY  V +   K   K  YA+K   K +I+ +++V +   E+    +LAR   P IV
Sbjct: 17  LGHGSYSTVYKALDKKDLKKPYAIKVCSKRHIIKEAKVKYVTIEKNTLNLLARGNHPGIV 76

Query: 439 PLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVY 498
            L +TF   E LY VL   +GGEL   L + G F  S A+ +A++L+  L+ +H   V++
Sbjct: 77  KLYYTFHDEENLYFVLDYASGGELLSLLHKMGTFTDSWAKHFAAQLVDTLEFMHARGVIH 136

Query: 499 RDLKPENILLDSQGHIALCDFGLC----KLNMKDNEKT--------------------ST 534
           RDLKPEN+LL  +G + + DFG        + KDN ++                    S+
Sbjct: 137 RDLKPENVLLSKEGILMITDFGAAATQNNFSDKDNTRSNANEGIPKDDVPSSGDKTECSS 196

Query: 535 FCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIF 594
           F GT EY++PE+LL    +   D W LG ++Y+ + G PP+  EN  + ++KI+     +
Sbjct: 197 FVGTAEYVSPELLLYNKCSFGSDIWALGCMVYQFIQGFPPFRGENELKTFEKIVSLDYSW 256

Query: 595 -PD------GMDPDAKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDL-------IWDSI 640
            P+       ++    +L++R+L  D  +R      D+IK   +F ++       +W  I
Sbjct: 257 NPERQTNFGTINIQVVNLVRRMLTIDTTQRA---TIDQIKRDPWFANVDWGDKKKLWRGI 313

Query: 641 W 641
           W
Sbjct: 314 W 314

>Scas_660.28
          Length = 623

 Score =  133 bits (335), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 86/257 (33%), Positives = 139/257 (54%), Gaps = 7/257 (2%)

Query: 365 KPSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLA 424
           K S S    I +++++  LG+GS+GKV       T +  ALK I K  ++AKS+ +    
Sbjct: 34  KSSLSDGSHIGNYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKK-VLAKSD-MQGRI 91

Query: 425 ERTI--LARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYAS 482
           ER I  L  +  P I+ L    ++ +++ +V+    G ELF ++ +        AR +  
Sbjct: 92  EREISYLRLLRHPHIIKLYDVIKSKDEIIMVMEYA-GNELFDYIVQRDKMSEDEARRFFQ 150

Query: 483 ELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYL 542
           +++ A++  H+  +V+RDLKPEN+LLD   ++ + DFGL  + M D     T CG+P Y 
Sbjct: 151 QIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNI-MTDGNFLKTSCGSPNYA 209

Query: 543 APEVLLGKGYTK-VVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPD 601
           APEV+ GK Y    VD W+ GV+LY ML    P+ DE++  ++K I       P  +   
Sbjct: 210 APEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNINNGVYTIPKFLSQG 269

Query: 602 AKDLLKRLLNRDPNRRL 618
           A  L+K++L  +P  R+
Sbjct: 270 ASTLIKKMLIVNPLNRI 286

>AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W
           (KCC4) - SH] (1721689..1725117) [3429 bp, 1142 aa]
          Length = 1142

 Score =  135 bits (339), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 87/261 (33%), Positives = 143/261 (54%), Gaps = 17/261 (6%)

Query: 374 IDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKS---------EVIHTLA 424
           I  ++L   LG GS GKV+  +  +T +I A+K I KS   A+          +V+    
Sbjct: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGI 75

Query: 425 ERTI--LARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYAS 482
           ER I  +  +  P ++ L   ++T + LY+VL  +  GELF+ L + G    + A  +  
Sbjct: 76  EREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFR 135

Query: 483 ELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYL 542
           ++++ +   H + +V+RDLKPEN+LLD + +I L DFG+  L  KD +   T CG+P Y 
Sbjct: 136 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKD-KLLETSCGSPHYA 194

Query: 543 APEVLLGKGYTKV-VDWWTLGVLLYEMLTGLPPYYDE--NVSEMYKKILKSPLIFP--DG 597
           APE++ G  Y     D W+ GV+LY +LTG  P+ +E  N+  +  K+       P  D 
Sbjct: 195 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDE 254

Query: 598 MDPDAKDLLKRLLNRDPNRRL 618
           + P+A+DL+ ++L  +P +R+
Sbjct: 255 ISPEARDLIVQILTVEPEQRI 275

>CAGL0M02519g complement(290723..292993) highly similar to tr|Q03002
           Saccharomyces cerevisiae YPL141c or sp|Q01919
           Saccharomyces cerevisiae YOR233w KIN4, hypothetical
           start
          Length = 756

 Score =  133 bits (334), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 97/356 (27%), Positives = 170/356 (47%), Gaps = 41/356 (11%)

Query: 366 PSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDT--------------------QKIYAL 405
           P + K V    + +   LG+G +GKV     K                       K  A+
Sbjct: 37  PKHRKHVTFGPYVIGATLGEGEFGKVKLAWSKSAYQQCDNTEGNAGNKPMTFKVPKQVAI 96

Query: 406 KAIRKSYIVAK-SEVIHTLAERTILARVECPFIVPLKFTFQTPEKLYLVLACINGGELFH 464
           K I++ +I    S+      E   L  +  P IV L+   Q  + + +VL    GGE + 
Sbjct: 97  KLIKRDFITKDPSKETKIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYAAGGEFYK 156

Query: 465 HLQREGIFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKL 524
            +QR+     + A    S+L+ A+  +H   +V+RDLK EN+LLD++ ++ + DFG    
Sbjct: 157 FIQRKRRLKENHACRLFSQLISAVHYIHSKGLVHRDLKLENLLLDNEENLIITDFGFVNE 216

Query: 525 NMKDNEKTSTFCGTPEYLAPEVLLG-KGY-TKVVDWWTLGVLLYEMLTGLPPYYDE---- 578
            ++ N    T CG+P Y APE+++  + Y  +  D W+ G++L+ ML G  P+ D+    
Sbjct: 217 FLRQNGMMKTSCGSPCYAAPELVVSNRPYDARKADTWSCGIILFAMLAGYLPWDDDPKNP 276

Query: 579 ---NVSEMYKKILKSPLIFPDGMDPDAKDLLKRLLNRDPNRRLGANGADE---IKNHKFF 632
              ++S +Y  IL +PL FP+ ++P  +DLL+++L  DP +R+     ++   +++H  F
Sbjct: 277 DGHDISRLYNYILNTPLKFPEYINPVPRDLLRKILVIDPKKRINIRSIEKHPWLESHSTF 336

Query: 633 NDLI---WDSIWNKEYL-----PPFRPDVQNANDTSNFDNEFTKQKPVDSVIDEYL 680
             +    WD + N + +     P F P+ +  +  SN+ +     K    +ID  L
Sbjct: 337 LSITPDEWDRLSNTKNIYRKSKPQFYPNKRPGSTYSNYSSGSKDNKRDSLIIDSAL 392

>Scas_644.15
          Length = 726

 Score =  132 bits (332), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 84/287 (29%), Positives = 141/287 (49%), Gaps = 19/287 (6%)

Query: 366 PSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAE 425
           PS  K  G  D+     LG+G + +  Q+ K ++ KI+A K + K  I  +      L+E
Sbjct: 82  PSLIKTRG-RDYRRGHFLGEGGFARCFQI-KDESGKIFAAKTVAKISIKTEKTKKKLLSE 139

Query: 426 RTILARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELL 485
             I   ++ P IV     F+    +Y++L   + G L   +++         RF+ +++ 
Sbjct: 140 IQIHKSMKHPNIVHFVDCFEDDTNVYILLEICSNGSLMDLMKKRKTLTEPEVRFFTTQIC 199

Query: 486 LALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPE 545
            A+  +H   V++RDLK  NI  D   ++ + DFGL  +   + E+  T CGTP Y+APE
Sbjct: 200 GAVKYMHSRRVIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANNRERKYTVCGTPNYIAPE 259

Query: 546 VLLGK--GYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDG--MDPD 601
           VL+GK  G++  VD W++GV++Y +L G PP+  ++V+ +Y +I      +P    +  +
Sbjct: 260 VLMGKHAGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNVIYDRIKACQYGYPKDKYVSSE 319

Query: 602 AKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDLIWDSIWNKEYLPP 648
           AK L+  +L  DP  R                  I D +W +   PP
Sbjct: 320 AKTLIADILCVDPVERPSIRE-------------IIDDVWFRGIFPP 353

>CAGL0K08514g complement(853314..857783) similar to sp|P34244
           Saccharomyces cerevisiae YKL101w
           serine/threonine-protein kinase, hypothetical start
          Length = 1489

 Score =  133 bits (335), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 72/207 (34%), Positives = 118/207 (57%), Gaps = 6/207 (2%)

Query: 425 ERTILARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASEL 484
           E  I+  +  P ++ L   ++   +LYLVL  ++GGELF +L  +G      A  Y +++
Sbjct: 176 EIVIMKLISHPNVMGLLEVWENKSELYLVLEYVDGGELFDYLVSKGKLSEPEAVHYFTQI 235

Query: 485 LLALDSLHKMDVVYRDLKPENILLDSQGH-IALCDFGLCKLNMKDNEKTSTFCGTPEYLA 543
           +  +   H  ++ +RDLKPEN+LLD +   I + DFG+  L +  N+   T CG+P Y +
Sbjct: 236 IQGVSYCHSFNICHRDLKPENLLLDKKNKVIKIADFGMAALELP-NKLLETSCGSPHYAS 294

Query: 544 PEVLLGKGY-TKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDA 602
           PE+++GK Y     D W+ G++L+ +LTG  P+ D+N+ ++  K+       P  +  DA
Sbjct: 295 PEIVMGKPYHGGPSDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGRFQLPPYLTNDA 354

Query: 603 KDLLKRLLNRDPNRRLGANGADEIKNH 629
           KDL+ R+L  +P +RL  N   EI NH
Sbjct: 355 KDLITRILVTNPEKRLTIN---EILNH 378

>Kwal_26.8709
          Length = 829

 Score =  132 bits (333), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 95/298 (31%), Positives = 151/298 (50%), Gaps = 25/298 (8%)

Query: 381 TVLGKGSYGKVMQVRKK------DTQKIYALKAIRKSYIVAKSEV-IHTLAERTILARVE 433
           + LG+G +GKV     K      D  K  A+K IR+  I   SE  I    E   L  + 
Sbjct: 44  STLGEGEFGKVKLGWSKTSNSSMDVPKQVAIKLIRRDTIPKNSEKEIKIYREINALKHLN 103

Query: 434 CPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHK 493
            P IV L+   Q  + + +VL   +GGE + ++Q++       A    ++L+  +  +H 
Sbjct: 104 HPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKEGPACRLFAQLISGVYYMHS 163

Query: 494 MDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPE-VLLGKGY 552
             +V+RDLK EN+LLD   ++ + DFG     + +NE   T CG+P Y APE V+  + Y
Sbjct: 164 KGLVHRDLKLENLLLDKNENLLITDFGFVNEFLPENELMKTSCGSPCYAAPELVVTARPY 223

Query: 553 -TKVVDWWTLGVLLYEMLTGLPPYYD-------ENVSEMYKKILKSPLIFPDGMDPDAKD 604
             +  D W+ GV+LY ML G  P+ D       +++ ++Y+ I ++PL FPD + P  +D
Sbjct: 224 EARKADVWSCGVILYAMLAGYLPWDDDPENPDGDDIGKLYRYITRTPLKFPDYIAPVPRD 283

Query: 605 LLKRLLNRDPNRRLGANGADE---IKNHKFFNDLI---WDSIWNKEYL---PPFRPDV 653
           LL+ +L  DP RR+  +   +   ++ H  F  ++   WD +   E L   PP R D 
Sbjct: 284 LLREILIPDPKRRITISKTLKHQWLQPHMPFLTVMPEEWDHVSKNEGLLRQPPQRRDT 341

>Kwal_26.8796
          Length = 796

 Score =  131 bits (329), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 83/259 (32%), Positives = 138/259 (53%), Gaps = 23/259 (8%)

Query: 382 VLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLA-ERTILARVECPFIVPL 440
           V+G+G++  V +  ++ T K +A+K I K  +V    V+  +A E  +L R++ P IV L
Sbjct: 193 VVGQGAFATVKKAIERKTGKTHAVKIISKRKVVG---VMDGVARELEVLQRLDHPRIVSL 249

Query: 441 KFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVYRD 500
           K  ++  +  YLV+  ++GG+L   +   G       R    ++L A+  +H M + +RD
Sbjct: 250 KGFYEDKDSHYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVKYIHSMGISHRD 309

Query: 501 LKPENILL--DSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKG------- 551
           LKP+NIL+  D    + + DFGL K+   +     TFCGT  Y+APEV+ GK        
Sbjct: 310 LKPDNILIERDDPVLVKITDFGLAKI-QGNGTFMKTFCGTLAYVAPEVISGKNSGEKEGN 368

Query: 552 -YTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDG------MDPDAKD 604
            Y+ +VD W++G L+Y +LTG  P+     +++YK+I      + +G      +  DA+D
Sbjct: 369 TYSSLVDMWSIGCLVYVILTGHLPFSGSTQNDLYKQITAGS--YHEGPLKDYRISDDARD 426

Query: 605 LLKRLLNRDPNRRLGANGA 623
            ++  L  DP  R+ A  A
Sbjct: 427 FIESFLQVDPRNRMTAEQA 445

>AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C
           (CMK1) - SH] complement(358947..360308) [1362 bp, 453
           aa]
          Length = 453

 Score =  127 bits (319), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 79/251 (31%), Positives = 130/251 (51%), Gaps = 10/251 (3%)

Query: 376 DFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECP 435
           D+     LG G++G V Q R     +  A+K + K  +   +E+     E +IL +++ P
Sbjct: 55  DYIFGKTLGAGAFGVVRQARNSKQNQNVAIKILLKRALKG-NELQMLYDELSILQKLDHP 113

Query: 436 FIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMD 495
            IV  K  F++ EK Y+V     GGELF  + ++G F  + A     ++L A++ +H  +
Sbjct: 114 NIVKFKDWFESREKFYIVTQLATGGELFDRILKKGKFTETDAVKIVVQMLTAVEYMHSQN 173

Query: 496 VVYRDLKPENIL-LD--SQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGY 552
           VV+RDLKPEN+L LD   +  + + DFG+ K    +++      G+  Y+APEVL   G+
Sbjct: 174 VVHRDLKPENVLYLDPSDESQLVISDFGIAKQLSSESQLIHRAAGSMGYVAPEVLTTSGH 233

Query: 553 TKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKS--PLIFP----DGMDPDAKDLL 606
            K  D W+LGV+ Y +L G  P+  E+     +++     P+ F     + +  +AK  +
Sbjct: 234 GKPCDIWSLGVITYTLLCGYSPFIAESTEGFLEEVFSGSDPVTFHSPYWNNISKEAKQFI 293

Query: 607 KRLLNRDPNRR 617
            R L   P RR
Sbjct: 294 LRALTLTPARR 304

>KLLA0E01584g 149713..150960 highly similar to sp|P39009
           Saccharomyces cerevisiae YDL101c DUN1 protein kinase,
           start by similarity
          Length = 415

 Score =  126 bits (317), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 93/270 (34%), Positives = 124/270 (45%), Gaps = 30/270 (11%)

Query: 383 LGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVPLKF 442
           LG G Y  V + R K+T +  A+K                  E  IL  ++ P IV L  
Sbjct: 107 LGTGHYAIVKEARNKETGETVAVKIFHPQQNDDDKRTKKFTEETKILLSIQHPNIVKLID 166

Query: 443 TFQTPE-----KLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVV 497
            F  P      + YLVL  IN GELF  + R+        +    +LL  L  LH  +++
Sbjct: 167 RFVEPVSKTQIQTYLVLEKINDGELFERIVRKNNLREDETKALFRQLLNGLKYLHSRNII 226

Query: 498 YRDLKPENILLD-----SQGHIAL--------------CDFGLCKLNMKDNEKTSTFCGT 538
           +RD+KPENILL      S   IAL               DFGL K    + + T+T CGT
Sbjct: 227 HRDIKPENILLSISKRRSPEEIALGPWDDDELDIQVKIADFGLAKFT-GEMKFTNTLCGT 285

Query: 539 PEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENV-SEMYKKILKSPLIFP-- 595
           P Y+APEVL+  GYT  VD W+ GVLLY  L G PP+ ++     M ++IL+    F   
Sbjct: 286 PSYVAPEVLVKTGYTSRVDMWSAGVLLYVCLCGFPPFSEQLAPPSMKEQILQGKFAFYSP 345

Query: 596 --DGMDPDAKDLLKRLLNRDPNRRLGANGA 623
             D +D     L+  LL  +P  R   N A
Sbjct: 346 YWDNIDDSVLHLISNLLVVNPASRFSVNDA 375

>KLLA0F11143g complement(1026129..1028570) similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, start by similarity
          Length = 813

 Score =  130 bits (326), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 78/260 (30%), Positives = 141/260 (54%), Gaps = 22/260 (8%)

Query: 381 TVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVPL 440
           +++G+G++  V +  ++ T K +A+K I K  ++ K + +    E  +L ++  P IV L
Sbjct: 196 SIVGQGAFATVKKAVERSTGKTFAVKIIHKRKVMDKFDGVKR--ELDVLQKLNHPRIVKL 253

Query: 441 KFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVYRD 500
           K  F+  +  Y+++  ++GG+L   +   G       R    ++L A+  +H   + +RD
Sbjct: 254 KDFFEDNDNYYMLMEFVSGGDLMDFVAAHGTVGEDAGREITRQVLEAVKYMHDQGISHRD 313

Query: 501 LKPENILL--DSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKG------- 551
           LKP+NI++  D    I + DFGL K+    N   +TFCGT  Y+APEV+ GK        
Sbjct: 314 LKPDNIMIEQDDPVLIKITDFGLAKV-QNQNTFLNTFCGTLAYVAPEVIDGKNAEDKTNR 372

Query: 552 --YTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDG------MDPDAK 603
             Y+ +VD W++G L+Y +LTG  P+  ++ +E++K+I +    + +G      +  +A+
Sbjct: 373 DLYSSLVDMWSIGCLVYVILTGHLPFSGQSQNELFKQIKRGS--YHEGPLKDYRISEEAR 430

Query: 604 DLLKRLLNRDPNRRLGANGA 623
           + +  LLN DP  R+ A  A
Sbjct: 431 NFIDCLLNVDPKERMNAGKA 450

>CAGL0K05709g complement(555903..559214) similar to sp|Q12263
           Saccharomyces cerevisiae YDR507c GIN4, start by
           similarity
          Length = 1103

 Score =  130 bits (326), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 87/263 (33%), Positives = 141/263 (53%), Gaps = 21/263 (7%)

Query: 374 IDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVA------KSEVIHTL---- 423
           I  ++L   LG GS GKV+    + T++  A+K I K+   A        +  + L    
Sbjct: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNI 76

Query: 424 -AERTILARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYAS 482
             E  I+  +  P ++ L   ++T   LYLVL     GELF+ L   G    + A     
Sbjct: 77  EQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFR 136

Query: 483 ELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYL 542
           ++++ +   H + VV+RDLKPEN+LLD++ +I + DFG+  L  +D +   T CG+P Y 
Sbjct: 137 QIIIGISYCHSLGVVHRDLKPENLLLDNKLNIKIADFGMAALESED-KLLETSCGSPHYA 195

Query: 543 APEVLLG---KGYTKVVDWWTLGVLLYEMLTGLPPYYDE--NVSEMYKKILKSPLIFPDG 597
           APE++ G   +G++   D W+ GV+L+ +LTG  P+ +E  N+  +  K+ K     PD 
Sbjct: 196 APEIISGLPYEGFSS--DVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDD 253

Query: 598 --MDPDAKDLLKRLLNRDPNRRL 618
             +  +A+DLL RLL  DP++R+
Sbjct: 254 DEITKEAQDLLARLLTVDPSKRI 276

>Scas_618.8
          Length = 427

 Score =  125 bits (314), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 80/252 (31%), Positives = 129/252 (51%), Gaps = 10/252 (3%)

Query: 376 DFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTL-AERTILARVEC 434
           D+E    LG GS+G V +  KK   +  A+K + K  +      +  L  E TIL ++  
Sbjct: 26  DYEFGKTLGAGSFGVVREATKKSNNEEVAIKILLKKALEGNQVQLQMLYDELTILKKLHH 85

Query: 435 PFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKM 494
           P IV  K  F+T +K+Y+V     GGELF  + ++G F    A     ++L A++ +H  
Sbjct: 86  PNIVEFKNWFETDDKIYIVTQLATGGELFDRIIKKGRFSEDDAVKILIQILSAVEYIHSR 145

Query: 495 DVVYRDLKPENILLDSQ---GHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKG 551
           D+V+RDLKPEN+L  ++     + + DFG+ K   K  +      G+  Y+APEVL   G
Sbjct: 146 DIVHRDLKPENLLYLTEKEDSELVIADFGIAKELKKGEQLIFKAAGSLGYVAPEVLTVDG 205

Query: 552 YTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKS--PLIFP----DGMDPDAKDL 605
           + K  D W++GV+ Y +L+G   +  E V     +      P+ F     D +  DAK+ 
Sbjct: 206 HGKPCDIWSIGVITYTLLSGYAAFVAETVEGFLDECTSGDYPVKFHKPYWDNISDDAKNF 265

Query: 606 LKRLLNRDPNRR 617
           + + L+ +P +R
Sbjct: 266 ILKALDLNPQKR 277

>KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces
           cerevisiae YDR507c GIN4 ser/thr protein kinase, start by
           similarity
          Length = 1112

 Score =  129 bits (323), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 85/261 (32%), Positives = 139/261 (53%), Gaps = 17/261 (6%)

Query: 374 IDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKS---------EVIHTLA 424
           I  ++L + LG GS GKV+    +   +  A+K I KS   A+          +V+    
Sbjct: 14  IGPWKLGSTLGVGSTGKVVMAYNETKGQQAAVKIISKSIFNAQGSTMIGGNDPDVLPYGI 73

Query: 425 ERTI--LARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYAS 482
           ER I  +  +  P ++ L   ++T + LY+VL  +  GELF+ L   G    + A  +  
Sbjct: 74  EREIIIMKLLNHPNVLRLYDVWETSKDLYMVLEYVEKGELFNLLVERGPLPENEAVRFFR 133

Query: 483 ELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYL 542
           ++++ +   H + +V+RDLKPEN+LLD + ++ L DFG+  L  KD +   T CG+P Y 
Sbjct: 134 QIIIGISYCHALGIVHRDLKPENLLLDHKFNVKLADFGMAALESKD-KLLETSCGSPHYA 192

Query: 543 APEVLLGKGYTKV-VDWWTLGVLLYEMLTGLPPYYDE--NVSEMYKKILKSPLIFP--DG 597
           APE++ G  Y     D W+ GV+LY +LTG  P+ +E  N+  +  K+       P  D 
Sbjct: 193 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKFEMPGDDE 252

Query: 598 MDPDAKDLLKRLLNRDPNRRL 618
           +  +A+DL+ R+L  DP +R+
Sbjct: 253 ISSEAQDLIARILTVDPEQRI 273

>CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces
           cerevisiae YDL101c DUN1 protein kinase, start by
           similarity
          Length = 506

 Score =  126 bits (316), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 90/284 (31%), Positives = 137/284 (48%), Gaps = 31/284 (10%)

Query: 370 KPVGI-DDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTI 428
           KP+   D + L   LG G Y  V + + K T +  A+K         + +      E TI
Sbjct: 185 KPLSFFDKYLLGKDLGSGHYAIVKEAKNKTTGETVAVKIFHPQQNDDQKKNKQFREETTI 244

Query: 429 LARVECPFIVPLKFTF-----QTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASE 483
           L ++  P IV L  +F     +T  + YLVL  I+ GELF  + ++       ++    +
Sbjct: 245 LMKIHHPNIVNLLDSFVEPISKTQIQKYLVLEKIDDGELFDRIVKKTSLPQEESKAIFKQ 304

Query: 484 LLLALDSLHKMDVVYRDLKPENILLDSQG-------------------HIALCDFGLCKL 524
           +L  L  LH  ++++RD+KPENILL+ +                     + + DFGL K 
Sbjct: 305 ILTGLKYLHSQNIIHRDIKPENILLNIRRRQSPDERQLGPWDEDEIDIQVKIADFGLAKF 364

Query: 525 NMKDNEKTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDE-NVSEM 583
              + + T+T CGTP Y+APEVL+ KGYT  VD W+ GV+LY  L G PP+ D+     +
Sbjct: 365 T-GEMQFTNTLCGTPSYVAPEVLVKKGYTSKVDLWSAGVILYVCLCGFPPFSDQLGPPSL 423

Query: 584 YKKILKSPLIFP----DGMDPDAKDLLKRLLNRDPNRRLGANGA 623
            ++I+ +   F     D +D  A  L+  LL  DP  R   + A
Sbjct: 424 KEQIMSAKYAFYSPYWDEIDDAALHLISNLLVLDPENRYDVDAA 467

>KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, start by similarity
          Length = 427

 Score =  124 bits (311), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 81/256 (31%), Positives = 128/256 (50%), Gaps = 10/256 (3%)

Query: 372 VGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTL-AERTILA 430
           V   D+     LG G++G V Q R   + +  A+K + K  +  +S  +  L  E +IL 
Sbjct: 41  VNKSDYIFGKTLGAGTFGVVRQARCISSGENVAVKILLKKALKGQSVQLQMLYDELSILQ 100

Query: 431 RVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDS 490
           ++  P IV  K  F++ EK Y+V     GGELF  +  +G F    A F   ++L  +  
Sbjct: 101 QLNHPNIVRFKDWFESKEKFYIVTQLATGGELFDRILEKGKFCEVDAVFIVKQILQGVQY 160

Query: 491 LHKMDVVYRDLKPENILLDSQGH---IALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVL 547
           LH+ ++V+RDLKPENIL  ++     + + DFG+ K    DNE      G+  Y+APEVL
Sbjct: 161 LHQRNIVHRDLKPENILYLNKSDDSPLVIGDFGIAKELKDDNELIHKAAGSMGYVAPEVL 220

Query: 548 LGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKS--PLIFP----DGMDPD 601
              G+ K  D W++GV+ Y +L G  P+  E+     ++      P++F     + +   
Sbjct: 221 TSSGHGKPCDIWSIGVITYTLLCGYSPFLAESADGFIEECTSGQYPVVFHKPYWNNVSKT 280

Query: 602 AKDLLKRLLNRDPNRR 617
           AK+ +   L   P RR
Sbjct: 281 AKEFILWALTVSPKRR 296

>Scas_613.5
          Length = 517

 Score =  125 bits (313), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 90/289 (31%), Positives = 137/289 (47%), Gaps = 33/289 (11%)

Query: 375 DDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVEC 434
           D + L   LG G Y  V +   K T +  A+K         + +      E  IL R+  
Sbjct: 202 DKYVLGKDLGSGHYATVKEGINKVTGQTVAVKIFHPQQNDDEKKSKQFREETNILMRIHH 261

Query: 435 PFIVPLKFTFQTPE-----KLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALD 489
           P IV L   F  P      + YLVL  I+ GELF  + ++        +   +++L+ L 
Sbjct: 262 PNIVNLLDFFIEPVSKSQIQKYLVLDKIDDGELFERIVKKTCLRQDETKAIFNQILMGLK 321

Query: 490 SLHKMDVVYRDLKPENILLDSQG-------------------HIALCDFGLCKLNMKDNE 530
            LH+ ++++RD+KPENILL+                       + + DFGL K    + +
Sbjct: 322 HLHQQNIIHRDIKPENILLNITRRTNPEQKQLGPWDEDEIDIQVKIADFGLAKFT-GEMQ 380

Query: 531 KTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDE-NVSEMYKKILK 589
            T+T CGTP Y+APEVL  KGYT  VD W+ GV+LY  L G PP+ ++     + ++IL+
Sbjct: 381 FTNTLCGTPSYVAPEVLTKKGYTSKVDMWSAGVILYVCLCGFPPFSEQLGPPSLKEQILQ 440

Query: 590 SPLIFP----DGMDPDAKDLLKRLLNRDPNRRLGANGADEIKNHKFFND 634
           +   F     D +D +   L+  LL  D + R      ++  NH +FND
Sbjct: 441 AKFAFYTPYWDNIDDNVLHLISHLLVLDADARY---SVEDTINHPWFND 486

>KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 843

 Score =  126 bits (316), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 77/248 (31%), Positives = 130/248 (52%), Gaps = 10/248 (4%)

Query: 374 IDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVE 433
           I ++++   +G+GS+GKV     + T +   LK   K       EV +         + +
Sbjct: 34  IGNYKISKFIGEGSFGKVYLATHRLTHQKVVLKTGNKRDPNVVREVFYH-------RQFD 86

Query: 434 CPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHK 493
            P+I  L     T  ++++VL   +G EL+ HL +E    +  ++   S++  A+   H+
Sbjct: 87  FPYITKLYEVIVTESRVWMVLEYCSGHELYEHLLKEQRLSLEESKKLFSQIASAVYYAHE 146

Query: 494 MDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYT 553
           +  V+RDLK EN+LLD  GH  L DFG  +  M    +  T CGT  Y+APE++  K Y 
Sbjct: 147 LKCVHRDLKLENVLLDGNGHAKLTDFGFTR-EMATRSQLETICGTTVYMAPELIERKCYD 205

Query: 554 KV-VDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIF-PDGMDPDAKDLLKRLLN 611
              VD W+LG++LY M+ G  P+ +++  +   KI+   L F  + +  DA DL++ +L 
Sbjct: 206 GFKVDIWSLGIILYTMINGYMPFDEDDDIKTKLKIVNDELDFNQEWISDDAIDLIQGMLR 265

Query: 612 RDPNRRLG 619
           ++PN R+ 
Sbjct: 266 KNPNERIS 273

>Scas_700.54
          Length = 698

 Score =  125 bits (314), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 78/260 (30%), Positives = 137/260 (52%), Gaps = 21/260 (8%)

Query: 382 VLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVPLK 441
           V+G+G++  V +  ++ T K +A+K I K  ++   E +    E  +L +++ P IV LK
Sbjct: 228 VVGQGAFATVKKAVERSTGKTFAVKIISKRKVMGNMEGVSR--ELEVLQQLDHPRIVRLK 285

Query: 442 FTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVYRDL 501
             ++  +  Y+V+  ++GG+L   +   G       +  + ++L A+  +H   + +RDL
Sbjct: 286 GFYEDKDSYYMVMEFVSGGDLMDFVAAHGAVGEEAGKEISRQILEAVKYIHSKGISHRDL 345

Query: 502 KPENILL--DSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKG-------- 551
           KP+NIL+  D    + + DFGL K+   +     TFCGT  Y+APEV+ GKG        
Sbjct: 346 KPDNILIEQDDPVLVKITDFGLAKVQ-GNGSFMKTFCGTLAYVAPEVIGGKGETNEERNE 404

Query: 552 YTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDG------MDPDAKDL 605
           Y+ +VD W++G L+Y +LTG  P+      ++YK+I +    + +G      +  +A+  
Sbjct: 405 YSSLVDMWSMGCLVYVILTGHLPFSGSTQEQLYKQISRGS--YHEGPLKDFRISDEARSF 462

Query: 606 LKRLLNRDPNRRLGANGADE 625
           +  LL  +P  RL A  A E
Sbjct: 463 IDSLLQVNPGNRLTAARALE 482

>CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces
           cerevisiae YHR102w NRK1 ser/thr protein kinase, start by
           similarity
          Length = 1072

 Score =  126 bits (316), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 82/260 (31%), Positives = 133/260 (51%), Gaps = 10/260 (3%)

Query: 377 FELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARV-ECP 435
           F+   V+G+G +G V +     T+++YA+K +  +   ++ EV     E   LA + + P
Sbjct: 16  FKRTEVIGRGKFGIVYKGYHVKTKQVYAIKVL--NLDSSEDEVEDVQREIQFLASLKQIP 73

Query: 436 FIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMD 495
            I     ++     L++++    GG L   L R G  D         ELL+AL  +HK +
Sbjct: 74  NITRYYGSYLRGTSLWIIMEYCAGGSL-RSLLRPGKIDEKYIGVIMRELLVALKVIHKDN 132

Query: 496 VVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLL-GKGYTK 554
           V++RD+K  N+L+ ++G + LCDFG+     + + +  T  GTP ++APEV++ G  Y  
Sbjct: 133 VIHRDIKAANVLITNEGQVKLCDFGVAAQLNQTSLRRQTMAGTPYWMAPEVIMEGVYYDT 192

Query: 555 VVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKS--PLIFPDGMDPDAKDLLKRLLNR 612
            VD W+LG+  YE+ TG PPY D       + I+KS  P +      P  K+ +   L+ 
Sbjct: 193 KVDIWSLGITAYEIATGNPPYCDVEALRAMQLIIKSKPPRLEERNYTPQLKEFIALCLDE 252

Query: 613 DPNRRLGANGADEIKNHKFF 632
           DP  RL    A+E+   KF 
Sbjct: 253 DPQERL---SAEELLKTKFI 269

>ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH]
           complement(597519..600032) [2514 bp, 837 aa]
          Length = 837

 Score =  125 bits (314), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 81/261 (31%), Positives = 137/261 (52%), Gaps = 25/261 (9%)

Query: 382 VLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVPLK 441
           V+G+G++  V +  +++T K +A+K I K  ++   + +    E  +L R+  P IV LK
Sbjct: 222 VVGQGAFATVKKAVERNTGKTFAVKIINKRKVMGNVDGV--TRELEVLRRLNHPRIVSLK 279

Query: 442 FTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVYRDL 501
             ++  E  YL++  ++GG+L   +   G       R    ++L A+  +H+  + +RDL
Sbjct: 280 GFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVRYIHEQGISHRDL 339

Query: 502 KPENILL--DSQGHIALCDFGLCKLNMKDNEK-TSTFCGTPEYLAPEVLLGKG------- 551
           KP+NIL+  D    + + DFGL K+  +DN     TFCGT  Y+APEV+ GK        
Sbjct: 340 KPDNILIEQDDPVLVKITDFGLAKI--QDNTTFMKTFCGTLAYVAPEVIGGKNPEGNGAN 397

Query: 552 ---YTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDG------MDPDA 602
              Y+ +VD W++G L+Y +LTG  P+      ++YK+I      + +G      +  +A
Sbjct: 398 GNLYSSLVDMWSIGCLVYVILTGHLPFSGSTQEQLYKQIANGS--YHEGPLKDYWISDEA 455

Query: 603 KDLLKRLLNRDPNRRLGANGA 623
           +D +  LL  +P  RL A  A
Sbjct: 456 RDFIDSLLQINPVDRLTAERA 476

>KLLA0F09031g 839103..841004 similar to sp|P43565 Saccharomyces
           cerevisiae YFL033c RIM15 protein kinase involved in
           expression of meiotic genes, hypothetical start
          Length = 633

 Score =  124 bits (311), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 98/169 (57%), Gaps = 20/169 (11%)

Query: 513 HIALCDFGLCKLNMKDNEK---------TSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGV 563
           H +  +  L + N+ D+ K         +  F GTP+YLAPE + G G +   DWW++G 
Sbjct: 32  HHSRTNSNLSETNVHDSPKDLSLFNPNESKNFFGTPDYLAPETIKGTGESDTCDWWSVGC 91

Query: 564 LLYEMLTGLPPYYDENVSEMYKKILKSPLI---FPDG------MDPDAKDLLKRLLNRDP 614
           + +E L G PP++   V E+++ I+   +    FPD       + PDAKDL+ +LL  DP
Sbjct: 92  IFFEFLFGYPPFHGTTVDEVFENIIGGVIRWPEFPDAETEMEYISPDAKDLVIKLLVLDP 151

Query: 615 NRRLGANGADEIKNHKFFNDLIWDSIWNKEYLPPFRPDVQNANDTSNFD 663
           N+RLGA+G+ EIK H +F D+ WD +++++  P F P V++  DT  FD
Sbjct: 152 NKRLGASGSQEIKEHPYFKDVDWDHVYDEQ--PSFVPRVEHPEDTEYFD 198

>YDR507C (GIN4) [1321] chr4 complement(1462346..1465774)
           Serine/threonine-protein kinase required for septin
           organization at the bud neck, has similarity to Ycl024p
           [3429 bp, 1142 aa]
          Length = 1142

 Score =  125 bits (314), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 83/264 (31%), Positives = 136/264 (51%), Gaps = 20/264 (7%)

Query: 374 IDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYI----VAKSEVIHTLA----- 424
           I  ++L   LG GS GKV   R   T +  A+K I K+      V+ + ++ +       
Sbjct: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALP 75

Query: 425 -----ERTILARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARF 479
                E  I+  +  P ++ L   ++T   LYLVL     GELF+ L   G      A  
Sbjct: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR 135

Query: 480 YASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTP 539
           +  ++++ +   H + +V+RDLKPEN+LLD + +I + DFG+  L   + +   T CG+P
Sbjct: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET-EGKLLETSCGSP 194

Query: 540 EYLAPEVLLGKGYTKVV-DWWTLGVLLYEMLTGLPPYYDE--NVSEMYKKILKSPLIFP- 595
            Y APE++ G  Y     D W+ GV+L+ +LTG  P+ +E  N+  +  K+ K     P 
Sbjct: 195 HYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPS 254

Query: 596 -DGMDPDAKDLLKRLLNRDPNRRL 618
            D +  +A+DL++++L  DP RR+
Sbjct: 255 DDEISREAQDLIRKILTVDPERRI 278

>Scas_707.3
          Length = 1598

 Score =  125 bits (313), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 59/145 (40%), Positives = 91/145 (62%), Gaps = 11/145 (7%)

Query: 528  DNEKTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKI 587
            D+++   F GTP+YLAPE + G G     DWW++G +++E+L G PP++      +++KI
Sbjct: 998  DSKQDKKFFGTPDYLAPETIEGTGEGDQCDWWSVGCIMFELLFGYPPFHTNTPEGVFRKI 1057

Query: 588  LKSPLIFP---------DGMDPDAKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDLIWD 638
            L   + +P         + + P+AKDL+ +LL  DP++RLGANGADEIK H +F D+ WD
Sbjct: 1058 LSGKIEWPQFDSIEEEREILSPEAKDLIMKLLVVDPSKRLGANGADEIKQHPYFKDVNWD 1117

Query: 639  SIWNKEYLPPFRPDVQNANDTSNFD 663
             ++++E    F P V+N  DT  FD
Sbjct: 1118 HVYDEEA--SFVPTVENPEDTDYFD 1140

 Score =  112 bits (279), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 96/154 (62%), Gaps = 1/154 (0%)

Query: 374 IDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTIL-ARV 432
           I D+ +L  + KG+YG V   RKK T   +A+K ++KS ++AK++V +  +ER I+  + 
Sbjct: 696 IKDYTILKPISKGAYGSVYLARKKITGDYFAIKVLKKSDMIAKNQVTNVKSERAIMMVQS 755

Query: 433 ECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLH 492
           + P++  L  TFQ  E L+LV+  + GG+L   ++  G       + Y +E+++ +D +H
Sbjct: 756 DKPYVARLFATFQNKENLFLVMEYLPGGDLATLIKMMGYLPDQWVKQYLTEIIVGVDDMH 815

Query: 493 KMDVVYRDLKPENILLDSQGHIALCDFGLCKLNM 526
           +  +++ DLKP+N+L+D+ GH+ L DFGL +  +
Sbjct: 816 RNWIIHHDLKPDNLLIDNLGHVKLTDFGLSRAGL 849

>YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine
           protein kinase with similarity to Cmk1p, Cmk2p, and
           Cmk3p [1539 bp, 512 aa]
          Length = 512

 Score =  122 bits (306), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 99/358 (27%), Positives = 163/358 (45%), Gaps = 67/358 (18%)

Query: 305 ADPNMRSILETIHAGKEIFLDSFTLPVVLD--MNSASNFRLFNHQWINLKQGLGTINLTV 362
           ++ + +S LE      E F D F+  + LD   N ++++   NHQ               
Sbjct: 67  SEKSEQSCLENNSQEDEYFCDIFSTELKLDETSNKSTDYSSSNHQ--------------- 111

Query: 363 DFKPSYSKPVGIDDFELLTVLGKGSYGKVMQVR--KKDTQKIYALKAIRKS-----YIVA 415
                Y + + + +++LL  +G+G++ +V +      D Q   A+KAI K       I+ 
Sbjct: 112 -----YPEQLELHNYKLLNKIGEGAFSRVFKAVGINTDDQAPVAIKAIIKKGISSDAILK 166

Query: 416 KSEVIHTLAERTILARVECPFIVP------LKF-TFQ-TPEKLYLVLACINGGELFHHLQ 467
            ++ I   + + +L  V    +V        KF  FQ +    YLV   + GGE+F  + 
Sbjct: 167 GNDRIQGSSRKKVLNEVAIHKLVSKNNPHCTKFIAFQESANYYYLVTELVTGGEIFDRIV 226

Query: 468 REGIFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLD------------------ 509
           +   F    AR   +++ +A+  +H M +V+RD+KPEN+L +                  
Sbjct: 227 QLTCFSEDLARHVITQVAIAIKHMHYMGIVHRDVKPENLLFEPIPFYGLDGDMQKEDEFT 286

Query: 510 ------SQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGV 563
                   G + L DFGL K    +  KT   CGT EY+A EV   K Y+  VD W++G 
Sbjct: 287 LGVGGGGIGLVKLMDFGLAKKLRNNTAKTP--CGTIEYVASEVFTSKRYSMKVDMWSIGC 344

Query: 564 LLYEMLTGLPPYYDENVSEMYKKILKSPLIFP----DGMDPDAKDLLKRLLNRDPNRR 617
           +L+ +L G PP+Y++N   + KKI +    F     D +   AK+ +  LL  DPN+R
Sbjct: 345 VLFTLLCGYPPFYEKNEKTLLKKISRGDYEFLAPWWDNISSGAKNAVTHLLEVDPNKR 402

>Scas_693.17
          Length = 1049

 Score =  124 bits (312), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 81/290 (27%), Positives = 139/290 (47%), Gaps = 36/290 (12%)

Query: 372 VGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIR--------KSYIVAKSEVIHTL 423
             + D++ +  +G GS GKV   + + T ++ A+K +         K Y    +     L
Sbjct: 66  TSLGDWDFVETVGAGSMGKVKLAKNRRTNEVCAIKIVNRATKIFLSKEYAAKHNGYTIPL 125

Query: 424 AERTILARVEC-----------------------PFIVPLKFTFQTPEKLYLVLACINGG 460
           +E+ ++ R +                        P I  L          Y++   ++GG
Sbjct: 126 SEKEVIERQKNLEKEASRDKRTVREASLGQILYHPHICRLYEMHTLSNHFYMLFEYVSGG 185

Query: 461 ELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFG 520
           +L  ++ + G    SRAR +  ++  AL  LH  ++V+RDLK ENI++   G+I L DFG
Sbjct: 186 QLLDYIIQHGSLKESRARTFTRQICSALKYLHSHNIVHRDLKIENIMISKDGNIKLIDFG 245

Query: 521 LCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYT-KVVDWWTLGVLLYEMLTGLPPYYDEN 579
           L  L  K N K  T+CG+  + APE+L    Y    +D W+ GV+LY ++ G  P+ DEN
Sbjct: 246 LSNLYDKCN-KLKTYCGSLYFAAPELLKATPYIGPEIDVWSFGVVLYVLVCGKVPFDDEN 304

Query: 580 VSEMYKKILKSPLIFPDGMDPDAKDLLKRLLNRDPNRRLGANGADEIKNH 629
            + +++KI +  + +P  +  +   LL ++L  DP +R      D++ NH
Sbjct: 305 SNVLHEKIKQGKVFYPQFLSIEVISLLSKMLVVDPFKRA---TLDQVMNH 351

>KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase, start by
           similarity
          Length = 1104

 Score =  124 bits (311), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 87/304 (28%), Positives = 149/304 (49%), Gaps = 35/304 (11%)

Query: 357 TINLTVDFKPSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIR---KSYI 413
           + N  V  KP + K +G  D++ L  +G GS GKV   + + T ++ A+K +    KSY+
Sbjct: 80  SFNDVVSNKPFHRKSLG--DWDFLETVGAGSMGKVKLAKHRLTNEVCAIKIVNRAAKSYM 137

Query: 414 VAKSEVIHTLAERTILARVE-----------------------CPFIVPLKFTFQTPEKL 450
             ++++     E  ++ R +                        P I  L          
Sbjct: 138 HKQNQLPPPKTEEELMERKKKLEKELSRDRRTIREASLGQILYHPHICRLFEMCTMSNHF 197

Query: 451 YLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDS 510
           Y++   ++GG+L  ++ + G      AR +   +  AL  LH  ++V+RDLK ENI++ +
Sbjct: 198 YMLFEYVSGGQLLDYIIQHGSLRERHARKFVRGIASALQYLHLNNIVHRDLKIENIMIST 257

Query: 511 QGHIALCDFGLCKLNMKDNEKT-STFCGTPEYLAPEVLLGKGYT-KVVDWWTLGVLLYEM 568
            G I + DFGL   N+ DN+K   TFCG+  + APE+L    Y    VD W+ GV++Y +
Sbjct: 258 SGEIKIIDFGLS--NLYDNKKQLHTFCGSLYFAAPELLKANPYIGPEVDIWSFGVVIYVL 315

Query: 569 LTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRLLNRDPNRRLGANGADEIKN 628
           + G  P+ DEN S +++KI K  + +P  +  +   LL ++L  DP +R       ++ N
Sbjct: 316 VCGKVPFDDENASVLHEKIKKGKVEYPQHLSIECISLLSKMLVVDPLKRASLK---QVCN 372

Query: 629 HKFF 632
           H++ 
Sbjct: 373 HQWM 376

>ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH]
           (157357..160200) [2844 bp, 947 aa]
          Length = 947

 Score =  123 bits (309), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 85/277 (30%), Positives = 136/277 (49%), Gaps = 10/277 (3%)

Query: 377 FELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARV-ECP 435
           F+   V+G+G +G V +     T+++YA+K +  +    + EV     E   LA + + P
Sbjct: 25  FKRTEVIGRGKFGVVYKAYHAKTKQVYAVKVL--NLDCPEDEVEDVQKEIQFLASLKQVP 82

Query: 436 FIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMD 495
            I     ++    KL++++    GG L   L R G  D         +LL+AL  +HK +
Sbjct: 83  NITRYYGSYLYDTKLWVIMEYCAGGSL-RTLLRPGKIDEKYLGVIVRKLLIALVYIHKDN 141

Query: 496 VVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLL-GKGYTK 554
           V++RD+K  N+L+ ++GH+ LCDFG+       N K  T  GTP ++APEV++ G  Y  
Sbjct: 142 VIHRDIKAANVLITNEGHVKLCDFGVAAQLTAANHKRQTMAGTPYWMAPEVIMEGVYYNT 201

Query: 555 VVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKS--PLIFPDGMDPDAKDLLKRLLNR 612
             D W+LG+  YE+ TG PPY D       + I KS  P +      P  K+ +   L+ 
Sbjct: 202 KADIWSLGITAYEIATGNPPYCDVEALRAMQLITKSKPPRLEGRNYSPLLKEFIALCLDE 261

Query: 613 DPNRRLGAN---GADEIKNHKFFNDLIWDSIWNKEYL 646
           DP  R  A     +  +K HK  +  I   + ++  L
Sbjct: 262 DPEERPTAEDLLSSKFVKAHKGSSATILKELISRYLL 298

>CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, hypothetical start
          Length = 442

 Score =  120 bits (301), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 81/247 (32%), Positives = 126/247 (51%), Gaps = 14/247 (5%)

Query: 383 LGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTL-AERTILARVECPFIVPLK 441
           LG G++G V Q R   T +  A+K + K  +      +  L  E +IL  ++ P IV  K
Sbjct: 51  LGAGTFGVVRQARYSPTNEDVAVKILLKKALKGNDVQLQMLYDELSILQMLKHPNIVEFK 110

Query: 442 FTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVYRDL 501
             F++ +K Y+V     GGELF  +  +G F    A     ++L A+D +H  +VV+RDL
Sbjct: 111 DWFESKDKFYIVTQLAVGGELFDRILAKGKFTERDAVSITMQILSAVDYMHSKNVVHRDL 170

Query: 502 KPENILL-----DSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKVV 556
           KPEN+L      DSQ  + + DFG+ K    +++      G+  Y+APEVL   G+ K  
Sbjct: 171 KPENVLYIDKSDDSQ--LVIADFGIAKQLQDNDDLIFKAAGSLGYVAPEVLTNNGHGKPC 228

Query: 557 DWWTLGVLLYEMLTGLPPYYDENVSEMYKKIL--KSPLIFP----DGMDPDAKDLLKRLL 610
           D W++GV++Y +L G   +  E V    ++    K P+ F     D +  +AK+ + R L
Sbjct: 229 DIWSIGVIVYTLLCGYSAFVAETVDGFLEECTQNKYPVTFHKPYWDNISDEAKNFILRAL 288

Query: 611 NRDPNRR 617
             DP  R
Sbjct: 289 TLDPAER 295

>Scas_564.7
          Length = 1210

 Score =  123 bits (309), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 81/273 (29%), Positives = 137/273 (50%), Gaps = 30/273 (10%)

Query: 373 GIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIR---KSYIVAKSEVIHTLAERTIL 429
            + D++ L  +G GS GKV   R   T++I A+K +    K+++  +  +     E+ +L
Sbjct: 158 SLGDWDFLETVGAGSMGKVKLARHHQTKEICAIKIVNRAMKAFLHKEQSMPPPRTEQEVL 217

Query: 430 ARVE-----------------------CPFIVPLKFTFQTPEKLYLVLACINGGELFHHL 466
            R +                        P I  L          Y++   ++GG+L  ++
Sbjct: 218 ERQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 277

Query: 467 QREGIFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNM 526
            + G      AR +A  +  AL+ +H  ++V+RDLK ENI++ + G I + DFGL   N+
Sbjct: 278 IQHGSLREHHARKFARGIASALEYIHANNIVHRDLKIENIMISTSGEIKIIDFGLS--NV 335

Query: 527 KDNEKT-STFCGTPEYLAPEVLLGKGYT-KVVDWWTLGVLLYEMLTGLPPYYDENVSEMY 584
            D +K   TFCG+  + APE+L    YT   VD W+ GV+LY ++ G  P+ DEN S ++
Sbjct: 336 FDRKKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSVLH 395

Query: 585 KKILKSPLIFPDGMDPDAKDLLKRLLNRDPNRR 617
           +KI +  + +P+ +  +   LL ++L  DP RR
Sbjct: 396 EKIKQGKVDYPNHLSIEVISLLSKMLVVDPLRR 428

>AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W
           (KIN1) - SH] complement(823632..826847) [3216 bp, 1071
           aa]
          Length = 1071

 Score =  122 bits (307), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 87/283 (30%), Positives = 142/283 (50%), Gaps = 34/283 (12%)

Query: 365 KPSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIR---KSYI-------- 413
           KP + K +G  D++ L  +G GS GKV   + + T ++ A+K +    KS++        
Sbjct: 44  KPFHRKSLG--DWDFLETVGAGSMGKVKLAKHRYTNELCAIKIVNRATKSFMHKQQLQGL 101

Query: 414 ---VAKSEVI--------------HTLAERTILARVECPFIVPLKFTFQTPEKLYLVLAC 456
                + E++               T+ E ++   +  P I  L          Y++   
Sbjct: 102 PPPATEEELLERRKKLEKEVSRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEY 161

Query: 457 INGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIAL 516
           ++GG+L  ++ + G      AR +A  +  AL  LH  ++V+RDLK ENI++ S G I +
Sbjct: 162 VSGGQLLDYIIQHGSLRERHARKFARGIASALQYLHLNNIVHRDLKIENIMISSSGEIRI 221

Query: 517 CDFGLCKLNMKDNEKT-STFCGTPEYLAPEVLLGKGYTK-VVDWWTLGVLLYEMLTGLPP 574
            DFGL   NM D +K   TFCG+  + APE+L    YT   VD W+ GV+LY ++ G  P
Sbjct: 222 IDFGLS--NMYDPKKQLHTFCGSLYFAAPELLKAHPYTGPEVDIWSFGVVLYVLVCGKVP 279

Query: 575 YYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRLLNRDPNRR 617
           + DEN S +++KI +  + +P  +  D   LL ++L  DP +R
Sbjct: 280 FDDENASVLHEKIKQGKVEYPQHLSIDVISLLSKMLVVDPYKR 322

>KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062
           Saccharomyces cerevisiae YPL141c, start by similarity
          Length = 909

 Score =  122 bits (307), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 79/251 (31%), Positives = 132/251 (52%), Gaps = 15/251 (5%)

Query: 382 VLGKGSYGKVM---QVRKKDTQKIYALKAIRKSYIVAKSEV-IHTLAERTILARVECPFI 437
            LG+G +GKV         D  K  A+K IR+  I   SE  +    E   L  +  P I
Sbjct: 61  TLGEGEFGKVKLGWSKSNSDESKNVAIKLIRRDTIPKNSEKEVKIYREINALKHLAHPNI 120

Query: 438 VPLKFTFQTPEKLYLVLACINGGELFHHLQREG-IFDISRARFYASELLLALDSLHKMDV 496
           V L+   Q  + + +VL   +GGE + ++Q++  + + +  R +A +L+  +  +H   +
Sbjct: 121 VTLEEVLQNSKYIGIVLHYASGGEFYKYIQKKRRLKEPAACRLFA-QLISGVHYMHHKGL 179

Query: 497 VYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPE-VLLGKGY-TK 554
            +RDLK EN+LLD   ++ + DFG        N+   T CG+P Y APE V+  K Y  +
Sbjct: 180 AHRDLKLENLLLDEHENLIITDFGFVNEFSSRNDLMKTSCGSPCYAAPELVVTTKAYEAR 239

Query: 555 VVDWWTLGVLLYEMLTG-------LPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLK 607
             D W+ GV+LY ML G             ++++++Y  I K+ L FP+ ++P  +D+L+
Sbjct: 240 KADVWSCGVILYAMLAGYLPWDDDPDNPDGDDIAKLYNYITKTSLKFPEYINPIPRDILR 299

Query: 608 RLLNRDPNRRL 618
           R+L  DP++R+
Sbjct: 300 RILVSDPSKRI 310

>AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH]
           (1769897..1771219) [1323 bp, 440 aa]
          Length = 440

 Score =  119 bits (298), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 81/265 (30%), Positives = 135/265 (50%), Gaps = 21/265 (7%)

Query: 377 FELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTI-LARVECP 435
           +E+L  +G+G++G V + R   + +I A+K +    +    E I  LA+    L+ +  P
Sbjct: 20  YEILQCIGRGNFGDVYKARDLTSNEIVAIKVVN---LEDTDEPIDLLAQEIFFLSELRSP 76

Query: 436 FIVPLKFTFQTPEKLYLVLACINGG---ELFHHLQREGIFDISRARFYASELLLALDSLH 492
           +I   K  F     +++V+    GG   EL  +     + +  +  F  SE+L+ LD LH
Sbjct: 77  YITNYKTAFLVDVSMWIVMEYCGGGSCAELLKYTPEHKVTE-EQCAFIVSEVLIGLDYLH 135

Query: 493 KMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVL--LGK 550
               ++RD+K  NILL   GH+ L DFG+    M    K  TF GTP ++APEV+    +
Sbjct: 136 SQRKIHRDIKSANILLTDNGHVKLGDFGVSG-QMMVTRKRDTFVGTPFWMAPEVIDRNKQ 194

Query: 551 GYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMD----PDAKDLL 606
           GY ++ D W+LG+ + E+L G PP    +  +  K ++  P   P  +D      A+D +
Sbjct: 195 GYNEMADIWSLGITVIELLMGHPPL---DKYDAMKALMAIPKRDPPKLDKRFSSHARDFV 251

Query: 607 KRLLNRDPNRRLGANGADEIKNHKF 631
            + L +DP++R     A E+  H+F
Sbjct: 252 AQCLIKDPSQR---PTAAELLKHRF 273

>Scas_493.2
          Length = 1117

 Score =  122 bits (306), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 85/264 (32%), Positives = 134/264 (50%), Gaps = 20/264 (7%)

Query: 374 IDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAK------SEVIHT----- 422
           I  ++L   LG GS GKV     + T +  A+K I KS    K      S V +T     
Sbjct: 19  IGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLP 78

Query: 423 ---LAERTILARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARF 479
                E  I+  +    ++ L   ++T   LY++L     GELF+ L  +G      A  
Sbjct: 79  YGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVR 138

Query: 480 YASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTP 539
           +  ++++ +   H + +V+RDLKPEN+LLD + +I + DFG+  L  +D +   T CG+P
Sbjct: 139 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETED-KLLETSCGSP 197

Query: 540 EYLAPEVLLGKGYTKV-VDWWTLGVLLYEMLTGLPPYYDE--NVSEMYKKILKSPLIFPD 596
            Y APE++ G  Y     D W+ GV+L+ +LTG  P+ +E  N+  +  K+       PD
Sbjct: 198 HYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPD 257

Query: 597 G--MDPDAKDLLKRLLNRDPNRRL 618
              M  DA+DL+ R+L  DP +R+
Sbjct: 258 DDEMSRDAQDLISRILTVDPTKRI 281

>ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH]
            complement(731433..736142) [4710 bp, 1569 aa]
          Length = 1569

 Score =  122 bits (305), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 86/145 (59%), Gaps = 11/145 (7%)

Query: 528  DNEKTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKI 587
            D + +  F GTP+YL+PE +LG G +   DWW++G +L+E L G PP++   V +++K I
Sbjct: 994  DEDGSRRFFGTPDYLSPETILGTGESGASDWWSVGCILFEFLLGYPPFHASTVEDVFKNI 1053

Query: 588  LKSPLIFP---------DGMDPDAKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDLIWD 638
            L   + +P         + + P+AKDL+ +LL  +P  RLGANGA EIK H +F  + W 
Sbjct: 1054 LSGQIDWPSFPNKETELEYLSPEAKDLILKLLESNPEERLGANGAQEIKEHPYFKGINWS 1113

Query: 639  SIWNKEYLPPFRPDVQNANDTSNFD 663
             ++++E    F P V N  DT  FD
Sbjct: 1114 KVYDEEA--SFVPTVDNPEDTDYFD 1136

 Score =  116 bits (290), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 55/159 (34%), Positives = 100/159 (62%), Gaps = 1/159 (0%)

Query: 374 IDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTIL-ARV 432
           I D++++  + KG+YG V    K+ T + +A+K +RKS ++AK++V +  +ER I+  + 
Sbjct: 679 IKDYDIIKPISKGAYGSVYLAYKRITGEYFAIKVLRKSDMIAKNQVTNVKSERVIMMVQS 738

Query: 433 ECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLH 492
           E P++  L  TFQ  E L+LV+  ++GG+L   ++  G      A+ Y +E+++ +D +H
Sbjct: 739 EKPYVAKLYATFQNKENLFLVMEYLSGGDLATLIKMMGNLPDKWAKQYITEVIIGVDDMH 798

Query: 493 KMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEK 531
              +++ DLKP+N+L+DS GH+ L DFGL ++ +    K
Sbjct: 799 MSGIIHHDLKPDNLLIDSNGHVKLTDFGLSRIGLIQRHK 837

>ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023)
           [2556 bp, 851 aa]
          Length = 851

 Score =  121 bits (303), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 90/287 (31%), Positives = 139/287 (48%), Gaps = 17/287 (5%)

Query: 350 NLKQGLGTI--NLTVDFKPSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKA 407
           NLK  +G     L   F  S  + VG  ++ ++  +G+GS+GKV     K T +   LK 
Sbjct: 10  NLKATIGASYNKLYGQFTASELREVG--NYRIVKQVGEGSFGKVYLATHKLTHQKVVLKT 67

Query: 408 IRKSYIVAKSEVIHTLAERTILARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQ 467
             KS      EV +         + E PFI  L     T  ++++ L    G EL+ +L 
Sbjct: 68  GAKSDPNVVREVFYH-------RQFEYPFITKLYEVIVTETRVWMALEYCPGNELYDYLL 120

Query: 468 REGIFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMK 527
            +    +   R   ++++ A+   H +  V+RDLK ENILLD  G+  L DFG  +    
Sbjct: 121 LKQRIPLDETRRLFAQIVSAVFYAHSLQCVHRDLKLENILLDKNGYAMLTDFGFTR-ECA 179

Query: 528 DNEKTSTFCGTPEYLAPEVLLGKGYTKV-VDWWTLGVLLYEMLTGLPPY-YDENVSEMYK 585
              +  T CGT  Y+APE++  + Y    VD W+LG++LY ML G  P+  D+ V    K
Sbjct: 180 TKTQLETVCGTTVYMAPELIKREAYDGYKVDTWSLGIILYTMLHGYMPFDEDDTVRTGLK 239

Query: 586 KILKSPLIFPDGMDPDAKDLLKRLLNRDPNRRLGANGADEIKNHKFF 632
            + + P +  +   P AKDL+ RLL+++  +R   N   E+  H F 
Sbjct: 240 IMHEEPAVLDEYTSPQAKDLIVRLLDKNAAQRPNLN---EVLQHPFL 283

>YFR014C (CMK1) [1695] chr6 complement(172529..173869)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type I [1341 bp, 446 aa]
          Length = 446

 Score =  118 bits (295), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 78/246 (31%), Positives = 124/246 (50%), Gaps = 10/246 (4%)

Query: 382 VLGKGSYGKVMQVRKKDTQKIYALKA-IRKSYIVAKSEVIHTLAERTILARVECPFIVPL 440
            LG G++G V Q +  +T +  A+K  I+K+    K ++     E  IL R+  P IV  
Sbjct: 42  TLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLEALYDELDILQRLHHPNIVAF 101

Query: 441 KFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVYRD 500
           K  F++ +K Y++     GGELF  + ++G F    A     E+L A+  +H  ++V+RD
Sbjct: 102 KDWFESKDKFYIITQLAKGGELFDRILKKGKFTEEDAVRILVEILSAVKYMHSQNIVHRD 161

Query: 501 LKPENILL---DSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKVVD 557
           LKPEN+L      +  + + DFG+ K    D E      G+  Y+APEVL   G+ K  D
Sbjct: 162 LKPENLLYIDKSDESPLVVADFGIAKRLKSDEELLYKPAGSLGYVAPEVLTQDGHGKPCD 221

Query: 558 WWTLGVLLYEMLTGLPPYYDENVSEMYKKILKS--PLIFP----DGMDPDAKDLLKRLLN 611
            W++GV+ Y +L G   +  E V +   +      P+ F     D +   AK  + + LN
Sbjct: 222 IWSIGVITYTLLCGYSAFRAERVQDFLDECTTGEYPVKFHRPYWDSVSNKAKQFILKALN 281

Query: 612 RDPNRR 617
            DP++R
Sbjct: 282 LDPSKR 287

>CAGL0M02233g complement(267332..269635) highly similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, hypothetical start
          Length = 767

 Score =  120 bits (301), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 85/318 (26%), Positives = 153/318 (48%), Gaps = 42/318 (13%)

Query: 382 VLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVPLK 441
           V+G G++  V +  +++T K +A+K I K  +V   + +    E  +L ++  P IV LK
Sbjct: 193 VVGTGAFATVKKAVERNTGKTFAVKIINKRKVVGNMDGVSR--ELEVLQKLNHPRIVSLK 250

Query: 442 FTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVYRDL 501
             ++     Y+V+  I+GG+L   +   G       R  + ++L A+  +H   + +RDL
Sbjct: 251 AFYEDEANYYMVMEFISGGDLMDFVAAHGAVGEEAGREISRQILEAIQYIHSKGISHRDL 310

Query: 502 KPENILL--DSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLG---------- 549
           KP+NIL+  D    + + DFGL K+   +     TFCGT  Y+APEV+ G          
Sbjct: 311 KPDNILIEQDDPVLVKITDFGLAKV-QGNGSIMKTFCGTLAYVAPEVIGGFTGATGEEET 369

Query: 550 ----KGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDG------MD 599
                 Y+ +VD W++G L++ +LTG  P+      ++Y++I K    + +G      + 
Sbjct: 370 EEERIEYSSLVDMWSMGCLVFVILTGHLPFSGSTQEQLYEQIRKGS--YHEGPLKDFRIS 427

Query: 600 PDAKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDLIWDSIWNKEYLPPFRPDVQNANDT 659
            +A+D +  LL  D ++R+     D+  NH           W K+    F  D  + +  
Sbjct: 428 DEARDFIDGLLQVDQSKRM---TVDDALNHP----------WIKQCSSQF--DANSMSSQ 472

Query: 660 SNFDNEFTKQKPVDSVID 677
            +     ++QK ++S+ D
Sbjct: 473 VSLSQSMSQQKALESLDD 490

>CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces
           cerevisiae YDR122w KIN1 or sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2, hypothetical start
          Length = 944

 Score =  120 bits (301), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 83/270 (30%), Positives = 135/270 (50%), Gaps = 32/270 (11%)

Query: 377 FELLTVLGKGSYGKVMQVRKKDTQKIYALKAIR---KSYIVAKSEV-------------- 419
           ++ +  +G GS GKV   + K++ ++ A+K +    K+Y+    ++              
Sbjct: 67  WDFMETVGAGSMGKVKLAKNKNSNEVCAIKIVHRATKAYMHKAQQLPPPADENEAKERQK 126

Query: 420 ---------IHTLAERTILARVECPFIVPLKFTFQT-PEKLYLVLACINGGELFHHLQRE 469
                      T+ E ++   +  P +  L +  QT     Y+    I+GG+L  ++ + 
Sbjct: 127 RLNKEISRDKRTVREASLGQILFHPNVCKL-YEMQTLSNHYYMFFEFISGGQLLDYIIQH 185

Query: 470 GIFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDN 529
           G    + AR  +  +L AL  LH  ++V+RDLK ENI+L   G I L DFGL   NM D 
Sbjct: 186 GSLKENHARKVSRGILSALQYLHANNIVHRDLKIENIMLSKTGEIKLIDFGLS--NMYDP 243

Query: 530 EKT-STFCGTPEYLAPEVLLGKGY-TKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKI 587
            K+  TFCG+  + APE+L    Y    VD W+ GV+LY ++ G  P+ DEN S +++KI
Sbjct: 244 RKSLQTFCGSLYFAAPELLKAHPYLGPEVDVWSFGVVLYVLVCGKVPFDDENSSALHEKI 303

Query: 588 LKSPLIFPDGMDPDAKDLLKRLLNRDPNRR 617
            K  + +P  +  D   LL ++L  DP +R
Sbjct: 304 KKGKVTYPQFLSIDVISLLSKILVVDPQKR 333

>YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protein
           kinase involved in septin organization and cell cycle
           control [3114 bp, 1037 aa]
          Length = 1037

 Score =  120 bits (301), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 88/266 (33%), Positives = 136/266 (51%), Gaps = 15/266 (5%)

Query: 367 SYSKPVG-IDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYI------VAKSEV 419
           S +KP   I  ++L   LG GS GKV   + + T    A+K I KS             V
Sbjct: 10  SAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSV 69

Query: 420 IHTLAER--TILARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRA 477
           +    ER   I+  +  P ++ L   ++T   LYL+L     GELF+ L   G      A
Sbjct: 70  LPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREA 129

Query: 478 RFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCG 537
                ++++ +   H + +V+RDLKPEN+LLDS  +I + DFG+  L   D +   T CG
Sbjct: 130 INCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQT-DADLLETSCG 188

Query: 538 TPEYLAPEVLLGKGYTKVV-DWWTLGVLLYEMLTGLPPYYDE--NVSEMYKKILKSPLIF 594
           +P Y APE++ G  Y     D W+ GV+L+ +LTG  P+ +E  NV ++  K+ K     
Sbjct: 189 SPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEM 248

Query: 595 PDGMD--PDAKDLLKRLLNRDPNRRL 618
           P+  +   DA+DL+ ++L  DP +R+
Sbjct: 249 PNDTEISRDAQDLIGKILVVDPRQRI 274

>CAGL0K10604g complement(1029226..1030566) similar to sp|P27466
           Saccharomyces cerevisiae YFR014c CMK1
           Ca2+/calmodulin-dependent ser/thr protein kinase type I,
           hypothetical start
          Length = 446

 Score =  117 bits (293), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 77/247 (31%), Positives = 128/247 (51%), Gaps = 9/247 (3%)

Query: 383 LGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVPLKF 442
           LG GS+G V + ++  + +  A+K + K  +     +     E  I+  ++ P IV  K 
Sbjct: 71  LGAGSFGVVKRAKQLHSDEDVAVKILLKRALEKNGGLEPIYDELNIIQHLDHPNIVKFKD 130

Query: 443 TFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVYRDLK 502
            F+T  K Y+V    +GGELF  +  +G +    A     ++L A++ LH  ++++RDLK
Sbjct: 131 WFETESKFYIVTQLASGGELFDRIMHDGKYTEEDAVNIVVQILKAVEYLHSQNIIHRDLK 190

Query: 503 PENIL-LDSQ--GHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKVVDWW 559
           PEN+L LD      I L DFG+ +    D++      G+  Y+APEV    G+ K  D W
Sbjct: 191 PENLLYLDKSKDSRIVLADFGIARQLENDDDVIYRPAGSLGYVAPEVFTSDGHGKPSDIW 250

Query: 560 TLGVLLYEMLTGLPPYYDENVSEMYKKIL--KSPLIFP----DGMDPDAKDLLKRLLNRD 613
           ++GV+ Y +L G  P+  E+V     ++   ++P+ F     DG+   AK+ + R+L+ D
Sbjct: 251 SVGVITYTLLCGYSPFKAESVDGFLDEVTSDENPVKFQRPYWDGISELAKNFILRILDLD 310

Query: 614 PNRRLGA 620
           P  R  A
Sbjct: 311 PACRPSA 317

>CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces
            cerevisiae YFL033c RIM15 protein kinase involved in
            expression of meiotic genes, hypothetical start
          Length = 1682

 Score =  120 bits (301), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 94/152 (61%), Gaps = 11/152 (7%)

Query: 521  LCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENV 580
            L   N +D+++   F GTP+YLAPE + G G     DWW++G +L+EM+ G PP++ E  
Sbjct: 1089 LILFNPEDSKQDKRFFGTPDYLAPETIEGTGEDNQCDWWSVGCILFEMVFGYPPFHAETP 1148

Query: 581  SEMYKKILKSPLIFP---------DGMDPDAKDLLKRLLNRDPNRRLGANGADEIKNHKF 631
             ++++ IL+  + +P         + + P+AKDL+ + L  DP++RLG NG +EIKNH +
Sbjct: 1149 DQVFRNILEGKIDWPIFDSIEEEREYISPEAKDLIMKFLITDPHKRLGYNGTEEIKNHPY 1208

Query: 632  FNDLIWDSIWNKEYLPPFRPDVQNANDTSNFD 663
            F D+ WD ++++     + P++++  DT  FD
Sbjct: 1209 FKDVKWDHVYDE--TASYVPNIEDPEDTDYFD 1238

 Score =  114 bits (286), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 57/163 (34%), Positives = 99/163 (60%), Gaps = 3/163 (1%)

Query: 367 SYSKPV--GIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLA 424
           S  KP+   I D++++  + KG+YG V   RKK T   +A+K +RKS ++AK++V +  +
Sbjct: 770 SQMKPLTPSIKDYDIIKPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTNVKS 829

Query: 425 ERTIL-ARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASE 483
           ER I+  + + P++  L  TFQ  + L+LV+  + GG+L   L+  G       + Y SE
Sbjct: 830 ERAIMMVQSDKPYVARLYATFQNKDNLFLVMEYLPGGDLATLLKMMGCLPDEWVKQYLSE 889

Query: 484 LLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNM 526
           +++ ++ +H   +++ DLKPEN+L+D  GH+ L DFGL +  +
Sbjct: 890 IIIGVEDMHNNGIIHHDLKPENLLIDVSGHLKLTDFGLSRAGL 932

>CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase,
           hypothetical start
          Length = 1192

 Score =  119 bits (299), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 80/273 (29%), Positives = 132/273 (48%), Gaps = 30/273 (10%)

Query: 373 GIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSY------------------IV 414
            + D++ L  +G GS GKV   + + T ++ A+K + ++                   I+
Sbjct: 104 SLGDWDFLETVGAGSMGKVKLAKHRRTGEVCAIKIVNRATKAFLHKEQNSPPPVNNQEIM 163

Query: 415 AKSEVIHTLAERTILARVEC--------PFIVPLKFTFQTPEKLYLVLACINGGELFHHL 466
            + + +     R   A  E         P I  L          Y++   + GG+L  ++
Sbjct: 164 ERQKKLEKEISRDKRAIREASLGQIFYHPHICRLFEMCTMSNHFYMLFEYVAGGQLLDYI 223

Query: 467 QREGIFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNM 526
            + G      AR +A  +  AL  LH  ++V+RDLK ENI++ + G I + DFGL   N+
Sbjct: 224 IQHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMISNSGEIKIIDFGLS--NV 281

Query: 527 KDNEKT-STFCGTPEYLAPEVLLGKGYT-KVVDWWTLGVLLYEMLTGLPPYYDENVSEMY 584
            D  K   TFCG+  + APE+L    YT   VD W+ GV+LY ++ G  P+ DEN S ++
Sbjct: 282 YDTRKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSVLH 341

Query: 585 KKILKSPLIFPDGMDPDAKDLLKRLLNRDPNRR 617
           +KI +  + +P  +  +   LL ++L  DP+RR
Sbjct: 342 EKIKRGKVEYPQHLSIEVMSLLSKMLVVDPSRR 374

>Scas_201.1*
          Length = 274

 Score =  113 bits (282), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 75/230 (32%), Positives = 125/230 (54%), Gaps = 10/230 (4%)

Query: 387 SYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLA-ERTILARVECPFIVPLKFTFQ 445
           ++G V Q R+  +Q+  A+K + K+ +      +  L  E +IL R+  P IV  K  F+
Sbjct: 45  TFGVVRQARQFFSQEAVAVKILLKNALKGNDVQLQMLYDELSILQRLHHPNIVAFKDWFE 104

Query: 446 TPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVYRDLKPEN 505
           + +K Y+V     GGELF  + ++G F    A     +LL A+  +H  ++V+RDLKPEN
Sbjct: 105 SRDKFYIVTQLATGGELFDRIIKKGKFTEVDAVNIMVQLLDAVKYIHSQNIVHRDLKPEN 164

Query: 506 IL-LD--SQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLG 562
           +L LD   +  + + DFG+ K    +++      G+  Y+APEVL  +G+ K  D W+LG
Sbjct: 165 VLYLDPSDESQLVIADFGIAKELKSNDDLIFKGAGSLGYVAPEVLTKEGHGKPCDIWSLG 224

Query: 563 VLLYEMLTGLPPYYDENVSEMYKKILKS--PLIFP----DGMDPDAKDLL 606
           V+ Y +L+G  P+  E+V    ++  +S  P+ F     D +  +AKD +
Sbjct: 225 VITYTLLSGYSPFIAESVEGFLEECTRSRYPVQFHKPYWDSISDEAKDFI 274

>Scas_580.6
          Length = 1015

 Score =  119 bits (298), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 81/260 (31%), Positives = 129/260 (49%), Gaps = 10/260 (3%)

Query: 377 FELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARV-ECP 435
           F    V+G+G +G V +     T++IYA+K +  +    + EV     E   L+ + + P
Sbjct: 37  FRRTEVIGRGKFGIVYKGYHVRTKQIYAIKVL--NLDSDEDEVEDVQREVQFLSSLKQIP 94

Query: 436 FIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMD 495
            I     ++     L++++    GG L   L R G  D         ELL+AL  +HK +
Sbjct: 95  NITRYYGSYLKDTSLWIIMEYCAGGSL-RSLLRPGKIDEKYIGVIMRELLVALKYIHKDN 153

Query: 496 VVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLL-GKGYTK 554
           V++RD+K  N+L+ ++G + LCDFG+     +   +  T  GTP ++APEV++ G  Y  
Sbjct: 154 VIHRDIKAANVLITNEGSVKLCDFGVAAQLNQSTLRRQTMAGTPYWMAPEVIMEGVYYDT 213

Query: 555 VVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKS--PLIFPDGMDPDAKDLLKRLLNR 612
            VD W+LG+  YE+ TG PPY +       + I KS  P +      P  K+ +   L+ 
Sbjct: 214 KVDIWSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPRLESRSYTPLLKEFIALCLDE 273

Query: 613 DPNRRLGANGADEIKNHKFF 632
           DP  RL    A+E+   KF 
Sbjct: 274 DPKERL---SAEELSKTKFI 290

>Scas_713.7
          Length = 983

 Score =  119 bits (297), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 78/254 (30%), Positives = 132/254 (51%), Gaps = 12/254 (4%)

Query: 366 PSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAE 425
           P+ +K V    ++L  V+GKGSYG V +   K T +I A+K +         E+I  + E
Sbjct: 18  PNKNKSV---QYQLKQVIGKGSYGVVYKAVNKKTLQIVAIKEVNYD---NDDELIEIMTE 71

Query: 426 RTILARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQ--REGIFDISRARFYASE 483
             +L  +    IV      Q    LY++L   + G L + L   ++GI ++  A+ Y  +
Sbjct: 72  IDLLKNLNHVNIVKYHGFIQKSSNLYIILEFCSKGSLKNLLTGYKDGIPELD-AKVYIRQ 130

Query: 484 LLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLA 543
            L  L  LH+  V++RD+K  N+LLDS   + L DFG+   + K +    T  G+  +++
Sbjct: 131 TLNGLVYLHEQGVIHRDIKAANLLLDSNDVVKLADFGV---STKVSNTAMTLAGSLHWMS 187

Query: 544 PEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAK 603
           PE++  +G + + D W+LG  + E++TG PP+Y      +Y  I   P I P+ +  +AK
Sbjct: 188 PEIIGNRGASTLSDIWSLGATVVELVTGNPPFYKLVDVNIYYAIENDPFIPPEFLSNEAK 247

Query: 604 DLLKRLLNRDPNRR 617
           D LK+   ++  +R
Sbjct: 248 DFLKKCFQKNMYKR 261

>ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -
           SH] complement(560761..563556) [2796 bp, 931 aa]
          Length = 931

 Score =  118 bits (296), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 90/294 (30%), Positives = 147/294 (50%), Gaps = 21/294 (7%)

Query: 367 SYSKPVGIDDFELLTVLGKGSYGKVM----QVRKKDTQKIYALKAIRKSYIVAKSEV-IH 421
           S  K V    + +   LG+G +GKV     + R     +  A+K IR+  +   SE  I 
Sbjct: 35  SKKKQVTFGPYIIGPTLGEGEFGKVKLGWSKARLDGDSRNVAIKLIRRDTVPKNSEKEIK 94

Query: 422 TLAERTILARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYA 481
              E   L  +  P IV L+   Q  + + +VL   +GGE + ++Q++       A    
Sbjct: 95  IYRELNALKLLSHPNIVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRLKEPPACRLF 154

Query: 482 SELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEY 541
           ++L+  +  +H   + +RDLK EN+LLD   ++ + DFG        N+   T CG+P Y
Sbjct: 155 AQLISGVHYIHYKGLAHRDLKLENLLLDEHENLIITDFGFVN-EFHKNDLMRTSCGSPCY 213

Query: 542 LAPE-VLLGKGYT-KVVDWWTLGVLLYEMLTGLPPYYD-------ENVSEMYKKILKSPL 592
            APE V+  K Y+ +  D W+ GV+LY ML G  P+ D       E+++++Y+ I  + L
Sbjct: 214 AAPELVVSSKPYSAQKADVWSCGVILYAMLAGYLPWDDDPENPEGEDIAKLYQYITHTSL 273

Query: 593 IFPDGMDPDAKDLLKRLLNRDPNRRLGANGADE---IKNHKFFNDLIWD-SIWN 642
            FP+ + P  +DLLKR+L  +P  RL     ++   ++ H  F  L+W  S W+
Sbjct: 274 KFPEYIKPIPRDLLKRILVSNPEVRLTVADIEQHAWLQPHAQF--LMWSPSDWD 325

>YFL033C (RIM15) [1651] chr6 complement(69113..74425) Serine/threonine
            protein kinase, positive regulator of IME2 expression and
            of sporulation [5313 bp, 1770 aa]
          Length = 1770

 Score =  119 bits (297), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 58/146 (39%), Positives = 90/146 (61%), Gaps = 12/146 (8%)

Query: 528  DNEKTSTFCGTPEYLAPEVLLGKGY-TKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKK 586
            D+++   F GTP+YLAPE + GKG   K  DWW++G + +E+L G PP++ E    ++KK
Sbjct: 1140 DSKQNKKFFGTPDYLAPETIEGKGEDNKQCDWWSVGCIFFELLLGYPPFHAETPDAVFKK 1199

Query: 587  ILKSPLIFPDG---------MDPDAKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDLIW 637
            IL   + +P+          + P+AKDL+++LL  DP +RLGA G  EIK+H +F ++ W
Sbjct: 1200 ILSGVIQWPEFKNEEEEREFLTPEAKDLIEKLLVVDPAKRLGAKGIQEIKDHPYFKNVDW 1259

Query: 638  DSIWNKEYLPPFRPDVQNANDTSNFD 663
            D ++++E    F P + N  DT  FD
Sbjct: 1260 DHVYDEEA--SFVPTIDNPEDTDYFD 1283

 Score =  113 bits (283), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 98/155 (63%), Gaps = 1/155 (0%)

Query: 373 GIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTIL-AR 431
            I D+++L  + KG+YG V   RKK T   +A+K +RKS ++AK++V +  +ER I+  +
Sbjct: 790 SIKDYDILKPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTNVKSERAIMMVQ 849

Query: 432 VECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSL 491
            + P++  L  +FQ  + L+LV+  + GG+L   ++  G      A+ Y +E+++ ++ +
Sbjct: 850 SDKPYVARLFASFQNKDNLFLVMEYLPGGDLATLIKMMGYLPDQWAKQYLTEIVVGVNDM 909

Query: 492 HKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNM 526
           H+  +++ DLKPEN+L+D+ GH+ L DFGL +  +
Sbjct: 910 HQNGIIHHDLKPENLLIDNAGHVKLTDFGLSRAGL 944

>CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces
           cerevisiae YBR274w CHK1 regulats inhibitory Cdk
           phosphorylation of PDS1, start by similarity
          Length = 528

 Score =  116 bits (291), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 86/271 (31%), Positives = 141/271 (52%), Gaps = 31/271 (11%)

Query: 369 SKPVGIDDFELLTVLGKGSYGKVMQVRKK-DTQKIYALKAIR---------KSYIVAKSE 418
           S PV I D EL   +G+GS+G V   R K D+  + A+K +              V++  
Sbjct: 7   SLPV-IKDVELGGTIGEGSFGCVRSARLKFDSSVVVAVKFVHLPTCAESGLSQKDVSREV 65

Query: 419 VIHTLAER--TILARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISR 476
           V+H+   +   +L  ++C             E L+++L   +GG+LF  ++ +   D   
Sbjct: 66  VLHSKCSKHANVLRVIDCNV---------GGEYLWIMLEMADGGDLFDKIEPDVGVDPDV 116

Query: 477 ARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLC-KLNMKDN--EKTS 533
           A+FY  +L+ AL+ LH + V +RD+KPENILLD +G++ L DFGL  +   KD     ++
Sbjct: 117 AQFYFQQLIRALNYLHDVGVAHRDIKPENILLDKKGNLKLADFGLASQFRRKDGTLRVST 176

Query: 534 TFCGTPEYLAPEVLLGKG-YTKVVDWWTLGVLLYEMLTG-----LPPYYDENVSEMYKKI 587
              G+P Y+APE+L  +G Y  + D W+ GVLL+ +LTG     +P   D+N        
Sbjct: 177 DQRGSPPYMAPEILSSQGYYANITDIWSAGVLLFVLLTGEIPWSIPAKEDDNYEWFVNNE 236

Query: 588 LKSPLIFPDGMDPDAKDLLKRLLNRDPNRRL 618
            K  L   + ++    +LL+++L  DP +R+
Sbjct: 237 GKVSLGPWERVELRQMNLLRKILQPDPRKRV 267

>Kwal_33.13112
          Length = 505

 Score =  116 bits (290), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 88/323 (27%), Positives = 151/323 (46%), Gaps = 22/323 (6%)

Query: 377 FELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERT-ILARVECP 435
           +++   +GKGS+G V +   K+T ++ A+K I    +    + I  LA+    L+ +  P
Sbjct: 36  YDIKECVGKGSFGDVYRAIDKETGEMVAVKIIN---LEETQDDIDVLAQEIYFLSELRAP 92

Query: 436 FIVPLKFTFQTPEKLYLVLACINGG---ELFHHLQREGIFDISRARFYASELLLALDSLH 492
           F+     T+     +++V+    GG   +L  HL    + + ++  +   E+L  L+ LH
Sbjct: 93  FVTTYYKTYVEDVSMWIVMEFCGGGSCADLLKHLPEHRLPE-NKVAYIIREVLYGLEYLH 151

Query: 493 KMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLL-GKG 551
               ++RD+K  NILL  +G + L DFG+    M    K +TF GTP ++APE++    G
Sbjct: 152 SQRKIHRDVKAANILLTDEGEVKLGDFGVSGQIMA-TLKRNTFVGTPYWMAPEIIARDNG 210

Query: 552 YTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKI-LKSPLIFPDGMDPDAKDLLKRLL 610
           Y +  D W+LG+   E+LTG PPY   +  ++   I L+ P          A+D +   L
Sbjct: 211 YDEKADIWSLGITAMELLTGQPPYAKYDPMKVLMNIPLRKPPRLQGRFTSSARDFIALCL 270

Query: 611 NRDPNRRLGANGADEIKNHKFFNDLIWDSIWNKEYLPPFRPDVQNANDTSNFDNEFTKQK 670
            +DP  R  A+   ++ +HKF N   W        L      VQ     +N+  E     
Sbjct: 271 TKDPALRPTAS---DLLSHKFLNRPTWRGTGT---LKKEVDLVQMLKKRTNYSRE----- 319

Query: 671 PVDSVIDEYLSESVQNQFKGWSY 693
           P   V D+  +  +    + W++
Sbjct: 320 PRFQVTDKVYATGISRHLQDWNF 342

>CAGL0B03509g complement(349638..351431) similar to sp|P38623
           Saccharomyces cerevisiae YLR248w RCK2
           Ca/calmodulin-dependent or sp|P38622 Saccharomyces
           cerevisiae YGL158w RCK1, start by similarity
          Length = 597

 Score =  117 bits (292), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 71/222 (31%), Positives = 105/222 (47%), Gaps = 40/222 (18%)

Query: 434 CPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHK 493
           CP+IV      +T    YL+   ++GGE+F+ + R        +R    ++ LA+  +H 
Sbjct: 240 CPYIVGFIDFQETKHYYYLIQELLDGGEIFNEIVRLTYLSEDLSRHVIKQVALAVRHMHS 299

Query: 494 MDVVYRDLKPENILLDSQGHI----------------------------------ALCDF 519
           + +V+RD+KPEN+L  S  +I                                   L DF
Sbjct: 300 LGIVHRDIKPENLLFKSIEYIPSKKRTFRKSDDPATKADEGVFIPTIGGGGIGIVKLADF 359

Query: 520 GLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDEN 579
           GL K   + N KT   CGT  Y APEV+  + Y+  VD W +G +LY ML G PP+YDE 
Sbjct: 360 GLSKQIFQKNTKTP--CGTIGYTAPEVVKDEKYSMQVDMWGIGCVLYTMLCGFPPFYDEK 417

Query: 580 VSEMYKKILKSPLIFP----DGMDPDAKDLLKRLLNRDPNRR 617
           +  + +KI +    F     D + P AK  +K+LL  DP +R
Sbjct: 418 IDVLTEKISRGEYTFLEPWWDEISPGAKHCVKKLLEVDPRKR 459

>CAGL0C05005g complement(467626..470856) similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15, hypothetical
           start
          Length = 1076

 Score =  117 bits (294), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 76/271 (28%), Positives = 134/271 (49%), Gaps = 8/271 (2%)

Query: 377 FELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPF 436
           ++L  ++G+GSYG V +   K T +  A+K +         E++  ++E  +L  +    
Sbjct: 22  YQLRQIIGRGSYGVVYKATNKKTAQEVAIKEVNYQ---DDDELVDIMSEIDLLKNLNHIN 78

Query: 437 IVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDV 496
           IV      Q    LY++L     G L + + R        A+ Y  + L  L+ LH+  V
Sbjct: 79  IVKYHGFIQKQHNLYIILEYCAKGSLKNLISRNRPMSEHEAKPYVRQTLNGLNYLHEQGV 138

Query: 497 VYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKVV 556
           ++RD+K  NILLDS+  + L DFG   ++ K N    T  G+  ++APE++  +G + + 
Sbjct: 139 IHRDIKAANILLDSENVVKLADFG---VSTKVNNTAMTLAGSLNWMAPEIIGNRGASTLS 195

Query: 557 DWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRLLNRDPNR 616
           D W+LG  + E+LTG PP+++     +Y  I       P  +   AKD L++   ++  +
Sbjct: 196 DIWSLGATVVELLTGNPPFHNLIDMNIYYAIENDSYFPPSSLSSGAKDFLQQCFAKNMYK 255

Query: 617 RLGANGADEIKNHKFFNDLIWDSIWNKEYLP 647
           R  A     ++++   ND   DS  +K+ +P
Sbjct: 256 RPTA--VQLLQHNWLENDNSKDSTMDKQVIP 284

>YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine
           protein kinase involved in regulation of cell wall beta
           1,6-glucan levels, interacts with Cdc31p [3243 bp, 1080
           aa]
          Length = 1080

 Score =  117 bits (293), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 80/260 (30%), Positives = 129/260 (49%), Gaps = 10/260 (3%)

Query: 377 FELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARV-ECP 435
           F+   V+G+G +G V +     T ++YA+K +  +      EV     E   LA + +  
Sbjct: 23  FKRTEVIGRGKFGVVYKGYNVKTGRVYAIKVL--NLDSDSDEVEDVQREIQFLASLKQIS 80

Query: 436 FIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMD 495
            I     ++     L++++    GG L   L R G  D         ELL+AL  +HK +
Sbjct: 81  NITRYYGSYLKDTSLWIIMEHCAGGSL-RSLLRPGKIDEKYIGVIMRELLVALKCIHKDN 139

Query: 496 VVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLL-GKGYTK 554
           V++RD+K  N+L+ ++G++ LCDFG+     + + +  T  GTP ++APEV++ G  Y  
Sbjct: 140 VIHRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRRQTMAGTPYWMAPEVIMEGVYYDT 199

Query: 555 VVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKS--PLIFPDGMDPDAKDLLKRLLNR 612
            VD W+LG+  YE+ TG PPY D       + I+KS  P +         K+ +   L+ 
Sbjct: 200 KVDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPPRLEDRSYSTSLKEFIALCLDE 259

Query: 613 DPNRRLGANGADEIKNHKFF 632
           DP  RL    AD++   KF 
Sbjct: 260 DPKERL---SADDLLKSKFI 276

>KLLA0C04191g 384198..386591 weakly similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15 protein kinase of
           the MAP kinase kinase kinase family, hypothetical start
          Length = 797

 Score =  116 bits (291), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 76/245 (31%), Positives = 126/245 (51%), Gaps = 9/245 (3%)

Query: 377 FELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPF 436
           + L  V+G+G+YG V +  K+ T K  A+K I       +SE+   + E  +L  +    
Sbjct: 10  YALKQVIGRGAYGVVYRAVKRGTNKPCAIKQIE---FEDESELNEHMLEIDLLKNLRHQN 66

Query: 437 IVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDV 496
           IV  +   Q   +LY++L     G L   L+   + +      Y ++ L  L  LH+  V
Sbjct: 67  IVEYRGFIQKAHELYIILEYCARGSLRDILKHGPLLEDDTVN-YVTQTLYGLQYLHEQGV 125

Query: 497 VYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKVV 556
           ++RD+K  N+LL  +G + L DFG+   + + N    T+ G+P ++APEV+ G+G + V 
Sbjct: 126 IHRDIKAANLLLTEEGIVKLADFGV---STRINRMAMTYAGSPNWMAPEVMTGQGASTVS 182

Query: 557 DWWTLGVLLYEMLTGLPPYYD-ENVSEMYKKILKSPLIFPDGMDPDAKDLLKRLLNRDPN 615
           D W+LG  + E+LTG PP+++  N S  Y  I+    I P  +  + KD L R   ++  
Sbjct: 183 DIWSLGATVVELLTGNPPFHNLVNESACY-AIVNEEYIPPLTLSAECKDFLSRCFQKNMF 241

Query: 616 RRLGA 620
           +R  A
Sbjct: 242 KRATA 246

>Scas_640.14*
          Length = 728

 Score =  115 bits (289), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 84/279 (30%), Positives = 137/279 (49%), Gaps = 37/279 (13%)

Query: 382 VLGKGSYGKV---------MQVRKKDTQKIYALKAIRKSYIVAKSEV-IHTLAERTILAR 431
            LG+G +GKV            +  +  K  A+K IR+ +I   SE  +    E   L  
Sbjct: 43  TLGEGEFGKVKMGWSTTSSSSGKITEDSKQVAIKLIRRDFIKKGSEKEMKIFREINSLKH 102

Query: 432 VECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREG-IFDISRARFYASELLLALDS 490
           +  P IV L+   Q  + + +VL   +GGE + ++QR+  + + +  R +A +L+  +  
Sbjct: 103 LTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYVQRKRRLKEATACRLFA-QLISGVSY 161

Query: 491 LHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGK 550
           +H   +V+RDLK EN+LLD   ++ + DFG       DNE   T CG+P Y APE+++  
Sbjct: 162 MHSKGIVHRDLKLENLLLDKHENLIITDFGFVNEFYADNELMKTSCGSPCYAAPELVITT 221

Query: 551 GYTKV--VDWWTLGVLLYEMLTGLPPYYD-------ENVSEMYKKILKSPLIFPD----- 596
              K    D W+ G++LY ML G  P+ D       E++  +Y  I K+PL FP      
Sbjct: 222 EPYKARKADIWSCGIILYGMLAGYLPWDDDKQNPNGEDIVRLYHYITKTPLKFPRIHYTT 281

Query: 597 --GMDPDAKDLLKRLLNRDPNRRLGANGADEIKNHKFFN 633
             G+       L+ +L  +P RR+ +     IK H++ +
Sbjct: 282 FLGI------CLRHILVSNPVRRMSSR---HIKKHEWLS 311

>AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH]
           (1044971..1047679) [2709 bp, 902 aa]
          Length = 902

 Score =  116 bits (290), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 79/280 (28%), Positives = 143/280 (51%), Gaps = 19/280 (6%)

Query: 377 FELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPF 436
           + L  V+GKG+YG V +   + T ++ A+KAI         E +  +    +L  ++   
Sbjct: 19  YALKQVIGKGAYGVVYKAVNRATDQVIAIKAIEYENEEELHEHMLEI---DLLKNLKHEN 75

Query: 437 IVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDV 496
           IV      Q+  +LY++L     G L   +++E + + ++A+ Y  + L  L  LH   V
Sbjct: 76  IVKYHGFIQSSHELYILLEYCIRGSLRDLIKKEALSE-AKAKTYVRQTLRGLQYLHDQGV 134

Query: 497 VYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKVV 556
           ++RD+K  N+LL   G + L DFG+   + + N    T+ G+P ++APEV+LGKG + V 
Sbjct: 135 IHRDIKAANLLLTENGVVKLADFGV---STRVNNMAMTYAGSPNWMAPEVMLGKGASTVS 191

Query: 557 DWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRLLNRDPNR 616
           D W+LG  + E+LTG PP+Y+         I+      P+ +  + K  ++    ++  +
Sbjct: 192 DIWSLGATVVELLTGNPPFYNLVNEAACYAIVNDVYYPPEHLSAECKAFMELCFQKNMFK 251

Query: 617 RLGAN----------GADEIKNHKFFNDLIWDSIWNKEYL 646
           R  A+          G D+++  K  +DL+ D  W++++L
Sbjct: 252 RPQAHQLLQHGWLKEGRDKLEQFK-EDDLVEDR-WDQDFL 289

>Kwal_23.3590
          Length = 499

 Score =  114 bits (284), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 86/283 (30%), Positives = 128/283 (45%), Gaps = 33/283 (11%)

Query: 383 LGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVPLKF 442
           LG G Y  V +   KD+  + A+K     +   + +      E  IL  ++   IV L  
Sbjct: 192 LGSGHYAIVKEAIDKDSGDVVAVKIFHAQHNDDQKKTKQFREETKILMSIQHKNIVKLID 251

Query: 443 TFQTPE-----KLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVV 497
            F  P      + +LVL  ++ GELF  + R+             ++L  L  LH  +++
Sbjct: 252 RFVEPVSKAQIQTFLVLEKVSDGELFDRIVRKTRLREDETNAIFKQILNGLRYLHAKNII 311

Query: 498 YRDLKPENILLDSQGH-------------------IALCDFGLCKLNMKDNEKTSTFCGT 538
           +RD+KPENILL  +                     I + DFGL K  + + + T+T CGT
Sbjct: 312 HRDIKPENILLSIRKRRHSDEQQLGPWDDDEIDITIKIADFGLAKF-IGEMQFTNTLCGT 370

Query: 539 PEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENV-SEMYKKILKSPLIFP-- 595
           P Y+APEVL   GYT  VD W+ GVLLY  L G PP+ ++     M ++IL     F   
Sbjct: 371 PSYVAPEVLTKTGYTSRVDMWSAGVLLYVCLCGFPPFSEQLAPPSMKEQILNGKFAFYSP 430

Query: 596 --DGMDPDAKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDLI 636
             D +D     L+  LL  +P  R       +  NH +F++ I
Sbjct: 431 YWDDIDDSCLHLISNLLVVNPAYRFDVQ---KTINHPWFSNTI 470

>AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..90211)
           [1419 bp, 472 aa]
          Length = 472

 Score =  113 bits (283), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 102/333 (30%), Positives = 142/333 (42%), Gaps = 49/333 (14%)

Query: 325 DSFTLPVVLDMNSASNFRLFNHQWINLKQGLGTINLTVDFKPSYSKPVGIDDFELLTVLG 384
           DS   P   + NS     LF+ Q    K   G  N  V F          D +     LG
Sbjct: 112 DSPARPADEEKNSVFKKPLFSSQNTTRKPLRGKENRGVSF---------FDRYIPGKELG 162

Query: 385 KGSYGKVMQVRKKDTQKIYALK---------AIRKSYIVAKSEVIHTLAERTILARVECP 435
            G Y  V +   K T +  A+K         A +      +++++  L    I+  +E  
Sbjct: 163 SGHYAIVKEAINKITGQSVAVKIFHPQKNDDAKKTRQFREETKILMGLNHENIVKLLE-R 221

Query: 436 FIVPL-KFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKM 494
           F+ PL K   QT    YLVL  I  GELF  + R+        R    ++L  L  LH  
Sbjct: 222 FVEPLSKSQVQT----YLVLEKIQDGELFDKIVRKTKLHQDETRALFKQILAGLKYLHDR 277

Query: 495 DVVYRDLKPENILLDSQGH-------------------IALCDFGLCKLNMKDNEKTSTF 535
           ++++RD+KPENILL  +                     + + DFGL K    + + T+T 
Sbjct: 278 NIIHRDIKPENILLSIRRRTSPDQVQLGPWDEDELDITVKIADFGLAKFT-GEMQFTTTL 336

Query: 536 CGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENV-SEMYKKILKSPLIF 594
           CGTP Y+A EVL   GYT  VD W+ GVLLY  L G PP+ D+     M ++IL+    F
Sbjct: 337 CGTPSYVAAEVLTKTGYTSKVDLWSAGVLLYVCLCGFPPFSDQLAPPSMKEQILQGKFAF 396

Query: 595 P----DGMDPDAKDLLKRLLNRDPNRRLGANGA 623
                D +D     L+  LL  DP +R     A
Sbjct: 397 YSPYWDEIDDSVLHLISNLLVVDPAKRYSVRDA 429

>CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 893

 Score =  115 bits (289), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 80/254 (31%), Positives = 134/254 (52%), Gaps = 12/254 (4%)

Query: 367 SYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAER 426
           S S+   + ++++   +G+GS+GKV     + T++   LK   KS      EV +     
Sbjct: 32  SSSELTEVGNYKIQKQIGEGSFGKVYLATHRPTKQKVVLKTGDKSDPNVVREVFYH---- 87

Query: 427 TILARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHL-QREGIFDISRARFYASELL 485
               + + P+I  L     T  K+++ L    G EL+ HL  +  +  +  A  +A ++ 
Sbjct: 88  ---RQFDYPYITKLYEVIVTETKVWMALEYCPGKELYDHLLSKSRLPTLECAELFA-QIT 143

Query: 486 LALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPE 545
            A+   H ++ V+RDLK EN+LLD  G+  L DFG  + +M       T CGT  Y+APE
Sbjct: 144 GAVHYAHTLNCVHRDLKLENVLLDKNGNAKLTDFGFTRESMT-KAVLETVCGTTVYMAPE 202

Query: 546 VLLGKGYTKV-VDWWTLGVLLYEMLTGLPPY-YDENVSEMYKKILKSPLIFPDGMDPDAK 603
           ++  K Y    VD W+LGV+LY +L G  P+  D+++    K I  +P+I      P+A+
Sbjct: 203 MIQHKPYDGFKVDIWSLGVILYTLLCGCLPFDEDDDLLTKQKIINDTPVIDERITIPEAQ 262

Query: 604 DLLKRLLNRDPNRR 617
           +L+++LL++DP  R
Sbjct: 263 NLIEQLLSKDPTER 276

>Scas_573.10
          Length = 569

 Score =  114 bits (285), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 90/318 (28%), Positives = 138/318 (43%), Gaps = 70/318 (22%)

Query: 368 YSKPVGIDDFELLTVLGKGSYGKVMQVRKK---------DTQKIYALKAIRKSYIVAK-- 416
           + + V +  + L+  +G+G++ KV +   +         +  K  A+K I+K+ +V    
Sbjct: 110 FPEQVELQGYTLIEKVGEGAFSKVFRAVPQRNGPTSFLCENYKEVAIKIIKKTALVGDDP 169

Query: 417 SEVIH-----------TLAERTILARVE--------CPFIVPLKFTFQTPEKLYLVLACI 457
              IH           T ++  +L  V         CP IV      ++    Y+V   I
Sbjct: 170 KADIHVAESHNRKHSKTSSKEQVLKEVSLHKAVSSGCPQIVQFIDFQESKTYYYIVQELI 229

Query: 458 NGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHI--- 514
           +GGE+F  + +   F    +R    +L LA+  LH + VV+RD+KPEN+L +    I   
Sbjct: 230 HGGEIFGEIVKYTYFSEDLSRHVIKQLALAVQHLHSLGVVHRDIKPENLLFEPIEFIPSK 289

Query: 515 -------------------------------ALCDFGLCKLNMKDNEKTSTFCGTPEYLA 543
                                           L DFGL K     N KT   CGT  Y A
Sbjct: 290 EPKLRKSDDPSTKSDEGLFVPGVGGGGIGVVKLADFGLSKQIFATNTKTP--CGTVGYTA 347

Query: 544 PEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFP----DGMD 599
           PEV+  + Y+  VD W +G +LY ML G PP+YDE +  + +KI +    F     D + 
Sbjct: 348 PEVVKDEHYSMKVDMWGVGCVLYTMLCGFPPFYDEKIDVLTEKISRGEYTFLRPWWDEIS 407

Query: 600 PDAKDLLKRLLNRDPNRR 617
             AK+ + RLL  DPN+R
Sbjct: 408 AGAKNAVIRLLEVDPNKR 425

>Kwal_14.1159
          Length = 1521

 Score =  115 bits (289), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 56/145 (38%), Positives = 87/145 (60%), Gaps = 11/145 (7%)

Query: 528  DNEKTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKI 587
            ++ K   F GTP+YLAPE + G G T   DWW++G +L+E + G PP++   V E++  I
Sbjct: 951  EDSKNKKFFGTPDYLAPETIEGTGETDSSDWWSVGCMLFEFVFGYPPFHASTVEEVFSNI 1010

Query: 588  LKSPL---IFPDG------MDPDAKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDLIWD 638
            L   +    FPD       + P+A+DL+++LL  DP++RLGANGA+EI  H +F D+ W+
Sbjct: 1011 LAGNIDWPAFPDEATEREYISPEARDLIEKLLVVDPDKRLGANGAEEIFEHPYFQDVDWE 1070

Query: 639  SIWNKEYLPPFRPDVQNANDTSNFD 663
            +++       F PD+ +   T  FD
Sbjct: 1071 NLYKD--TGSFVPDIAHPESTDYFD 1093

 Score =  108 bits (270), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 56/183 (30%), Positives = 108/183 (59%), Gaps = 5/183 (2%)

Query: 346 HQWINLKQGLGTINLTVD-FKPSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYA 404
           H  +  KQ L  + L  +  KPS      I D++++  + KG+YG V   +++ T + +A
Sbjct: 648 HSAVVPKQPLSPLLLATNQAKPSTP---SIKDYDVIKPISKGAYGSVFLAKRRITGEYFA 704

Query: 405 LKAIRKSYIVAKSEVIHTLAERTIL-ARVECPFIVPLKFTFQTPEKLYLVLACINGGELF 463
           +K ++KS ++AK++V +  +ER I+  +   P++  L  TFQ    L+LV+  ++GG+L 
Sbjct: 705 IKVLKKSDMIAKNQVTNVKSERAIMMVQSNKPYVAKLYATFQNRGNLFLVMEYLSGGDLG 764

Query: 464 HHLQREGIFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCK 523
             ++  G       + Y SE++  ++ +H+  +++ DLKP+N+L+D +GH+ L DFGL +
Sbjct: 765 TLIKMMGSLPDQWVKQYISEVIYGVEDMHQSGIIHHDLKPDNLLIDQRGHLKLTDFGLSR 824

Query: 524 LNM 526
           + +
Sbjct: 825 MGL 827

>YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine protein
           kinase, related to Kin2p and S. pombe KIN1 [3195 bp,
           1064 aa]
          Length = 1064

 Score =  115 bits (287), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 77/272 (28%), Positives = 135/272 (49%), Gaps = 30/272 (11%)

Query: 374 IDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKS--YIVAKSEVI----------- 420
           + D+E +  +G GS GKV   + + T ++ A+K + ++    + K +++           
Sbjct: 117 LGDWEFVETVGAGSMGKVKLAKHRYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVLE 176

Query: 421 -------------HTLAERTILARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQ 467
                         T+ E ++   +  P I  L          Y++   ++GG+L  ++ 
Sbjct: 177 RQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYII 236

Query: 468 REGIFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMK 527
           + G     +AR +A  +  AL  LH  ++V+RDLK ENI++     I + DFGL   N+ 
Sbjct: 237 QHGSIREHQARKFARGIASALIYLHANNIVHRDLKIENIMISDSSEIKIIDFGLS--NIY 294

Query: 528 DNEKT-STFCGTPEYLAPEVLLGKGYT-KVVDWWTLGVLLYEMLTGLPPYYDENVSEMYK 585
           D+ K   TFCG+  + APE+L    YT   VD W+ GV+L+ ++ G  P+ DEN S +++
Sbjct: 295 DSRKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSVLHE 354

Query: 586 KILKSPLIFPDGMDPDAKDLLKRLLNRDPNRR 617
           KI +  + +P  +  +   LL ++L  DP RR
Sbjct: 355 KIKQGKVEYPQHLSIEVISLLSKMLVVDPKRR 386

>Kwal_0.155
          Length = 587

 Score =  114 bits (284), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 86/300 (28%), Positives = 136/300 (45%), Gaps = 58/300 (19%)

Query: 374 IDDFELLTVLGKGSYGKVMQ-VRKKDTQKIY--------ALKAIRKSYIV-----AKSEV 419
           + D++L+  +G+G++ KV + V ++ + K +        A+K I K ++      AKS+ 
Sbjct: 154 LQDYKLIAKIGEGAFSKVYRGVPQEHSSKSFLSRAFKQVAVKVISKKHLSSTHKDAKSKA 213

Query: 420 I---HTLAERTILARVECPFIVPLKFTFQTPEKLYLVLA-CINGGELFHHLQREGIFDIS 475
                 L E  I   V     V     FQ     Y ++   + GGE+F  + R   F   
Sbjct: 214 TSREQVLKEVAIHRTVSASENVVSFVDFQESHNYYFIVQELLAGGEIFGEIVRLTYFSED 273

Query: 476 RARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGH---------------------- 513
            +R    +L LA+  +H M +V+RD+KPEN+L +   +                      
Sbjct: 274 LSRHVIRQLALAVKHMHAMGIVHRDIKPENLLFEHVDYEPSPSPVLRKSDDPKAKQDEGI 333

Query: 514 ------------IALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKVVDWWTL 561
                       + L DFGL K     N KT   CGT  Y APEV+  + Y+  VD W +
Sbjct: 334 FRPGIGGGGIGTVKLADFGLSKQIYSTNTKTP--CGTVGYTAPEVVKDERYSMQVDMWGI 391

Query: 562 GVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFP----DGMDPDAKDLLKRLLNRDPNRR 617
           G +LY +L G PP+YDE +  + +KI +    F     D +   AK+ ++RLL  DP++R
Sbjct: 392 GCVLYTVLCGFPPFYDEKIDVLTEKISRGEFTFLRPWWDEISDGAKNAVRRLLEVDPSKR 451

>KLLA0E21780g complement(1936438..1939488) similar to sp|P38692
           Saccharomyces cerevisiae YHR102w NRK1 ser/thr protein
           kinase that interacts with CDC31P, start by similarity
          Length = 1016

 Score =  114 bits (286), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 76/245 (31%), Positives = 122/245 (49%), Gaps = 7/245 (2%)

Query: 377 FELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARV-ECP 435
           F+   ++G+G +G V +     TQ++YA+K +       + EV     E   L+ + + P
Sbjct: 16  FKRKEIIGRGKFGVVYKAFHVKTQQVYAIKVLNLDN--TEDEVEDIRKEIQFLSSLKQTP 73

Query: 436 FIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMD 495
            I     ++    KL++++    GG L   L R GI +         E+L+AL S+H+ +
Sbjct: 74  NITHYYGSYLIDTKLWVIMEYCAGGSL-RTLLRPGIIEEKYIGVIMREILVALISIHRDN 132

Query: 496 VVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLL-GKGYTK 554
           V++RD+K  NIL+ + G + LCDFG+     +   K  T  GTP ++APEV++ G  Y  
Sbjct: 133 VIHRDIKAANILIANNGSVKLCDFGVAAQLSQSMLKRQTMAGTPYWMAPEVIMEGVYYDT 192

Query: 555 VVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKS--PLIFPDGMDPDAKDLLKRLLNR 612
            VD W+LG+  YE+ TG PPY         + I KS  P +         K+ +   L+ 
Sbjct: 193 KVDIWSLGITAYEIATGNPPYCHMEAIRAMQMITKSKPPRLEGREYSQPLKEFIALCLDE 252

Query: 613 DPNRR 617
           DP  R
Sbjct: 253 DPKER 257

>Scas_673.20*
          Length = 758

 Score =  114 bits (284), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 82/256 (32%), Positives = 124/256 (48%), Gaps = 25/256 (9%)

Query: 377 FELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPF 436
           +  L  +G+G+ G V    +  T    A+K I    I  + ++I T  E  +L   + P 
Sbjct: 481 YRKLKRIGEGASGIVYTAYEIGTDISVAIKQIDLK-IQPRLQMIWT--EMLVLKEYQHPN 537

Query: 437 IVPLKFTFQTPEKLYLVLACINGGEL-----FHHLQREGIFDISRARFYASELLLALDSL 491
           I+    ++   + L++V+  ++GG L     F     E +  I R      E L  L+ L
Sbjct: 538 IINFINSYLLHDTLWIVMEYMDGGSLADIVSFFTPTEEQMATICR------ETLFGLNFL 591

Query: 492 HKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKG 551
           H   +V+RD+K +NILL   G I + DFG C    + N K +T  GTP ++APEV+  K 
Sbjct: 592 HSRGIVHRDIKSDNILLSMNGDIKITDFGFCGQLTESNTKRTTMVGTPYWMAPEVIASKE 651

Query: 552 YTKVVDWWTLGVLLYEMLTGLPPYYDEN-VSEMY------KKILKSPLIFPDGMDPDAKD 604
           Y   VD W+LG+++ EM+ G PPY  E  V  +Y      K ILK     P+ + P  K+
Sbjct: 652 YGPKVDVWSLGIMIIEMIEGEPPYLHETPVRALYLITTNGKPILKE----PEKVGPVLKN 707

Query: 605 LLKRLLNRDPNRRLGA 620
            +   L  DP  RL  
Sbjct: 708 FMDECLRVDPEARLST 723

>KLLA0F09020g 836287..839073 weakly similar to sp|P43565
           Saccharomyces cerevisiae YFL033c RIM15 protein kinase
           involved in expression of meiotic genes, start by
           similarity
          Length = 928

 Score =  112 bits (281), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 52/154 (33%), Positives = 99/154 (64%), Gaps = 1/154 (0%)

Query: 374 IDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTIL-ARV 432
           I D++++  + KG+YG V   +K+ T + +A+K ++KS ++AK++V +  +ER I+  + 
Sbjct: 699 IRDYDVIKPISKGAYGSVYLAKKRVTGEYFAIKVLKKSDMIAKNQVTNVKSERAIMMVQS 758

Query: 433 ECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLH 492
           + P++  L  TFQ  E L+LV+  ++GG++   ++  G      A+ Y  E++  +D +H
Sbjct: 759 DKPYVARLYATFQNKENLFLVMQYLSGGDMATLIKMMGNLPEKWAKQYICEVISGVDDMH 818

Query: 493 KMDVVYRDLKPENILLDSQGHIALCDFGLCKLNM 526
           +  +++ DLKP+N+L+DS GHI L DFGL ++ +
Sbjct: 819 QNGIIHHDLKPDNLLIDSLGHIKLTDFGLSRMGL 852

>Kwal_26.8751
          Length = 848

 Score =  112 bits (280), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 80/269 (29%), Positives = 130/269 (48%), Gaps = 19/269 (7%)

Query: 360 LTVDFKPSYSKPVG---------IDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRK 410
           L  +   SY+K  G         + ++++L ++G+GS+GKV       T +   LK   K
Sbjct: 11  LKANISASYNKLYGQFSLNELQEVGNYKILKIVGEGSFGKVYLASHCLTHQKVVLKMGSK 70

Query: 411 SYIVAKSEVIHTLAERTILARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREG 470
           +      EV +         + +   I  L     T   +++ L    G EL+ +L  + 
Sbjct: 71  NDPNVVREVFYH-------RQFDYSHITKLYEVIVTENYVWMALEYCPGKELYEYLLAKK 123

Query: 471 IFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNE 530
              +       S+++ A+   H M  V+RDLK ENILLD +GH  L DFG  +       
Sbjct: 124 HIPLEECSELFSQIVGAVYYAHSMKCVHRDLKLENILLDKKGHAKLTDFGFTR-ECATKG 182

Query: 531 KTSTFCGTPEYLAPEVLLGKGYTKV-VDWWTLGVLLYEMLTGLPPYYD-ENVSEMYKKIL 588
              T CGT  Y+APE++  K Y    +D W+LG++LY M+ G  P+ + + V   YK + 
Sbjct: 183 ILETICGTTVYMAPELIERKPYEGYKIDTWSLGIILYTMIHGTMPFDEVDEVKTKYKIVH 242

Query: 589 KSPLIFPDGMDPDAKDLLKRLLNRDPNRR 617
            +P    D +D + K+L+ +LL +DPN+R
Sbjct: 243 YNPTYDNDYIDSNGKELISQLLEKDPNQR 271

>YJL128C (PBS2) [2790] chr10 complement(178015..180021) MAP kinase
           kinase (MEK) activated by high osmolarity through the
           Sln1p-Ypd1p-Ssk1p two-component osmosensor and the Sho1p
           osmosensor [2007 bp, 668 aa]
          Length = 668

 Score =  112 bits (279), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 88/293 (30%), Positives = 139/293 (47%), Gaps = 26/293 (8%)

Query: 347 QWINLKQG----LGTINLT---VDFKPSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDT 399
           +++++K G     G ++L+   +DF    S  + +D+ E L  LG G+YG V +V  K T
Sbjct: 323 KYVDIKSGSLNFAGKLSLSSKGIDFSNGSSSRITLDELEFLDELGHGNYGNVSKVLHKPT 382

Query: 400 QKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVPLKFTFQTPEKLYLVLACING 459
             I A K +R     AK   I  L E  +L +   P+IV     F     +Y+ +  ++G
Sbjct: 383 NVIMATKEVRLELDEAKFRQI--LMELEVLHKCNSPYIVDFYGAFFIEGAVYMCMEYMDG 440

Query: 460 GEL---FHHLQREGIFDISRARFYASELLLALDSL-HKMDVVYRDLKPENILLDS-QGHI 514
           G L   +      G  D  +  F A+ ++  L  L  + ++++RD+KP NIL  + QG +
Sbjct: 441 GSLDKIYDESSEIGGIDEPQLAFIANAVIHGLKELKEQHNIIHRDVKPTNILCSANQGTV 500

Query: 515 ALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLG-----KGYTKVVDWWTLGVLLYEML 569
            LCDFG+    +    KT+  C +  Y+APE +         YT   D W+LG+ + EM 
Sbjct: 501 KLCDFGVSGNLVASLAKTNIGCQS--YMAPERIKSLNPDRATYTVQSDIWSLGLSILEMA 558

Query: 570 TGLPPY----YDENVSEMYKKILKSPLIFP-DGMDPDAKDLLKRLLNRDPNRR 617
            G  PY    YD   S++   +   P   P D    DA+D +   L + P RR
Sbjct: 559 LGRYPYPPETYDNIFSQLSAIVDGPPPRLPSDKFSSDAQDFVSLCLQKIPERR 611

>Scas_700.28
          Length = 896

 Score =  112 bits (279), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 76/248 (30%), Positives = 126/248 (50%), Gaps = 14/248 (5%)

Query: 374 IDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVE 433
           + ++++L  +G+GS+GKV   + + T     LK+  K+      EV +         + +
Sbjct: 35  VGNYKILDQIGEGSFGKVYLAQHRPTHTKVVLKSSDKNDPNIVREVFYH-------RQFD 87

Query: 434 CPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHK 493
            P+I  L     T  K+++ L    G EL+  +               ++++  +   H 
Sbjct: 88  YPYITKLYEVIITETKVWMALEYCPGKELYDRVLSMHRVPTDECVQLFAQIVGGVHYAHS 147

Query: 494 MDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTS--TFCGTPEYLAPEVLLGKG 551
           ++ V+RDLK ENILLD  G   L DFG  +  M    KT+  T CGT  Y+APE++  K 
Sbjct: 148 LNCVHRDLKLENILLDKSGDAKLTDFGFTRECM---TKTTLETICGTTVYMAPELIERKS 204

Query: 552 YTKV-VDWWTLGVLLYEMLTGLPPY-YDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRL 609
           Y    +D W+LGV+LY M+ G  P+  D+     +K + ++P +  + +  DAKDL+ RL
Sbjct: 205 YDGFKIDIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQLNENIVTADAKDLILRL 264

Query: 610 LNRDPNRR 617
           L ++PN R
Sbjct: 265 LAKNPNDR 272

>Kwal_47.17252
          Length = 872

 Score =  111 bits (278), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 93/354 (26%), Positives = 166/354 (46%), Gaps = 65/354 (18%)

Query: 369 SKPVGIDDFELLTV-LGKGSYGKVMQVR---KKDTQKIYALKAIRKSYIVAKSEVIHTLA 424
           + P+ I D  L+   +GKGS+  V + R    +D     A+KA+ +S +  K  + +   
Sbjct: 11  AAPIMISDKYLVQQEIGKGSFATVYKGRIASNRDLNDFIAIKAVSRSKLKNKKLLENLEI 70

Query: 425 ERTILARVECPFIVPLKFTFQTPEKLYLVLA-CINGGELFHHLQREGIFD---ISRARF- 479
           E  IL +++ P IV L    +T    +L++  C  G   F   +R G+ +   + R  F 
Sbjct: 71  EIAILKKIKHPHIVGLMDCERTGADFFLIMEYCALGDLTFLIKKRGGLIEKHPLVRTMFE 130

Query: 480 -------------------YASELLLALDSLHKMDVVYRDLKPENILLDS---------- 510
                              Y  +L  AL  L   ++V+RD+KP+N+LL +          
Sbjct: 131 KYPPPSESHNGLNRVVVVSYLQQLSSALMFLRSKNLVHRDIKPQNLLLSTPLVNYSDRET 190

Query: 511 ---QGHIAL--------CDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKVVDWW 559
               G + +         DFG  +  + +     T CG+P Y+APE+L  + Y    D W
Sbjct: 191 FHKMGFVGIYNLPILKIADFGFARF-LPNTSLAETLCGSPLYMAPEILDYQKYNAKADLW 249

Query: 560 TLGVLLYEMLTGLPPYYDENVSEMYKKILKSP--LIFPD--GMDPDAKDLLKRLLNRDPN 615
           ++G +LYEM  G PP+   N  E++KKI ++   + FP    +DP  ++L+  LL  DP+
Sbjct: 250 SVGTVLYEMCCGRPPFKASNHLELFKKIKRANDVISFPTHCKVDPQMRELICGLLTFDPS 309

Query: 616 RRLGANGADEIKNHKFFNDLIWD---SIWNKEYLPPFRPDVQNANDTSNFDNEF 666
           +R+G N        +FF++ + +   S + +E++P      ++  +++ F +E+
Sbjct: 310 QRMGFN--------EFFSNEVVNEDLSPYEEEHIPDLENKSKDVAESNMFISEY 355

>Kwal_56.23717
          Length = 858

 Score =  110 bits (274), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 62/185 (33%), Positives = 105/185 (56%), Gaps = 7/185 (3%)

Query: 450 LYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLD 509
            Y++   ++GG+L  ++ + G      AR +A  +  AL  LH  ++V+RDLK ENI++ 
Sbjct: 8   FYMLFEYVSGGQLLDYIIQHGSLRERSARKFARGIASALQYLHMNNIVHRDLKIENIMIS 67

Query: 510 SQGHIALCDFGLCKLNMKDNEKT-STFCGTPEYLAPEVLLGKGYT-KVVDWWTLGVLLYE 567
           + G I + DFGL   NM + +K   TFCG+  + APE+L    YT   VD W+ GV+L+ 
Sbjct: 68  TSGEIKIIDFGLS--NMYNPKKQLHTFCGSLYFAAPELLKACPYTGPEVDVWSFGVVLFV 125

Query: 568 MLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRLLNRDPNRRLGANGADEIK 627
           ++ G  P+ DEN S +++KI +  + +P  +  +   LL ++L  DP +R       ++ 
Sbjct: 126 LVCGKVPFDDENSSVLHEKIKQGKVEYPQHLSIEVISLLSKMLVVDPTKRASLK---QVV 182

Query: 628 NHKFF 632
           NH++ 
Sbjct: 183 NHQWM 187

>Kwal_55.21545
          Length = 865

 Score =  110 bits (274), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 77/248 (31%), Positives = 121/248 (48%), Gaps = 7/248 (2%)

Query: 377 FELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARV-ECP 435
           F+   V+G+G +G V +     T+++ A+K +  +   A  EV     E   L+ + + P
Sbjct: 19  FKRTEVIGRGKFGVVYKGYYTKTKQVCAIKVL--NLDSADDEVEDVQKEIQFLSSLKQVP 76

Query: 436 FIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMD 495
            I     ++    KL++++    GG L   L R G            ELL AL  +HK  
Sbjct: 77  NITHYYGSYLNDTKLWVIMEYCAGGSL-RTLLRPGKIGEQYIGVIMRELLTALMHIHKDG 135

Query: 496 VVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLL-GKGYTK 554
           V++RD+K  N+L+ + GHI LCDFG+     +   +  T  GTP ++APEV++ G  Y  
Sbjct: 136 VIHRDIKAANVLITNDGHIKLCDFGVAAQLSQTKIRRQTMAGTPYWMAPEVIMEGVYYDT 195

Query: 555 VVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKS--PLIFPDGMDPDAKDLLKRLLNR 612
            VD W+LG+  YE+ TG PPY +       + I KS  P +         K+++   L+ 
Sbjct: 196 KVDIWSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPRLEGRQHSSALKEIIALCLDE 255

Query: 613 DPNRRLGA 620
           DP  R  A
Sbjct: 256 DPKERPSA 263

>Kwal_27.9763
          Length = 868

 Score =  109 bits (272), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 70/241 (29%), Positives = 120/241 (49%), Gaps = 7/241 (2%)

Query: 377 FELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPF 436
           + L  V+GKG+YG V +   + T K  A+K I       +    H L E  +L  ++   
Sbjct: 23  YALKQVVGKGAYGIVYRAINRQTHKQVAIKVIEYD--EEEELNEHML-EIDLLKNLKHEN 79

Query: 437 IVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDV 496
           IV      Q   +L+++L   + G L   L + G  +  + + Y  + L  L  LH   V
Sbjct: 80  IVKYHGFIQKSHQLFILLEYCSQGSL-RDLIKRGPVEEQQCKTYIRQTLHGLKYLHDQGV 138

Query: 497 VYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKVV 556
           ++RD+K  N+LLD+Q  + L DFG+   + + N    T+ G+P ++APEV++G+G + V 
Sbjct: 139 IHRDIKAANLLLDAQNVVKLADFGV---STRVNNLAMTYAGSPNWMAPEVMMGQGASTVS 195

Query: 557 DWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRLLNRDPNR 616
           D W+LG  + E+LTG PP+++         I+    I P  +    +  L+    ++  +
Sbjct: 196 DIWSLGATVVEILTGNPPFHNLVNEAACYAIVHDVYIPPSTLSSSCRKFLRSCFQKNMFK 255

Query: 617 R 617
           R
Sbjct: 256 R 256

>YDR523C (SPS1) [1335] chr4 complement(1485554..1487026)
           Serine/threonine protein kinase involved in middle/late
           stage of meiosis [1473 bp, 490 aa]
          Length = 490

 Score =  107 bits (267), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 78/256 (30%), Positives = 127/256 (49%), Gaps = 22/256 (8%)

Query: 377 FELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTI-LARVECP 435
           + + + +G+G++G V +   + TQ+I A+K +   +     E I  LA+    LA ++ P
Sbjct: 18  YSIQSCIGRGNFGDVYKAVDRVTQEIVAIKVVNLEH---SDEDIELLAQEIFFLAELKSP 74

Query: 436 FIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDI--SRARFYASELLLALDSLHK 493
            I     T      +++V+    GG     L+R  +  +   +  F   E+ L L  LH+
Sbjct: 75  LITNYIATMLEDVSMWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHE 134

Query: 494 MDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGK--G 551
              ++RD+K  NILL+ +G + L DFG+   +++   K  TF GTP ++APEV+  +  G
Sbjct: 135 QRKIHRDIKAANILLNEEGMVKLGDFGVSG-HIRSTLKRDTFVGTPYWMAPEVVCCEVDG 193

Query: 552 YTKVVDWWTLGVLLYEMLTGLPPY--YD-----ENVSEMYKKILKSPLIFPDGMDPDAKD 604
           Y +  D W+LG+  YE+L GLPP   YD      N+ +     L+ P  F D     AKD
Sbjct: 194 YNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGP--FSDA----AKD 247

Query: 605 LLKRLLNRDPNRRLGA 620
            +   L + P  R  A
Sbjct: 248 FVAGCLVKTPADRPSA 263

>YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase
           kinase kinase essential for late nuclear division [2925
           bp, 974 aa]
          Length = 974

 Score =  107 bits (266), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 72/258 (27%), Positives = 122/258 (47%), Gaps = 10/258 (3%)

Query: 377 FELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPF 436
           + L  V+G+GSYG V +   K T ++ A+K +         E+   +AE ++L  +    
Sbjct: 25  YHLKQVIGRGSYGVVYKAINKHTDQVVAIKEVVYE---NDEELNDIMAEISLLKNLNHNN 81

Query: 437 IVPLKFTFQTPEKLYLVLACINGGELFHHLQREGI-FDISRARFYASELLLALDSLHKMD 495
           IV      +   +LY++L     G L   + R       + ++ Y ++ LL L  LH   
Sbjct: 82  IVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEG 141

Query: 496 VVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKV 555
           V++RD+K  NILL +   + L DFG+  +    N    T  GT  ++APE+L  +G + +
Sbjct: 142 VIHRDIKAANILLSADNTVKLADFGVSTI---VNSSALTLAGTLNWMAPEILGNRGASTL 198

Query: 556 VDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRLLNRDPN 615
            D W+LG  + EMLT  PPY++   + +Y  +       P       KD L +   ++  
Sbjct: 199 SDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSSFSEPLKDFLSKCFVKNMY 258

Query: 616 RRLGANGADEIKNHKFFN 633
           +R     AD++  H + N
Sbjct: 259 KR---PTADQLLKHVWIN 273

>Kwal_23.6325
          Length = 1542

 Score =  107 bits (267), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 79/257 (30%), Positives = 120/257 (46%), Gaps = 19/257 (7%)

Query: 383  LGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAER-TILARVECPFIVPLK 441
            +G G++G V      DT +I A+K I+     +  +V   + E  ++L  +  P +V   
Sbjct: 1255 VGGGAFGTVFSAVNLDTGEILAVKEIKIQDRKSMKQVFPAIKEEMSVLEMLNHPNVVQYY 1314

Query: 442  FTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVYRDL 501
                  +K+ L +    GG L   L+   I D    + YA ++L  L  LH+  VV+RD+
Sbjct: 1315 GVEVHRDKVNLFMEYCEGGSLAQLLEHGRIEDEMVTQIYALQMLEGLAYLHQSSVVHRDI 1374

Query: 502  KPENILLDSQGHIALCDFGLCKLNMKDNEKT------------STFCGTPEYLAPEVLLG 549
            KPENILLD  G I   DFG  +    +  K             ++  GTP Y++PE + G
Sbjct: 1375 KPENILLDFNGVIKYVDFGAARSLAANGTKAPNVGAEGKADGVNSMMGTPMYMSPESITG 1434

Query: 550  --KGYTKVVDWWTLGVLLYEMLTGLPPYY--DENVSEMYKKILKSPLIFP--DGMDPDAK 603
              KG     D W+LG ++ EM+TG  P++  D   + MY          P  + + P   
Sbjct: 1435 AKKGKFGSGDIWSLGCVILEMVTGRRPWFNLDNEWAIMYHVAAGHVPQLPTKEELSPQGI 1494

Query: 604  DLLKRLLNRDPNRRLGA 620
            D L R L +DPN+R  A
Sbjct: 1495 DFLLRCLKQDPNKRSTA 1511

>AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W
           (RCK1) - SH] complement(289989..291593) [1605 bp, 534
           aa]
          Length = 534

 Score =  105 bits (262), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 70/213 (32%), Positives = 102/213 (47%), Gaps = 41/213 (19%)

Query: 444 FQTPEKLYLVLA-CINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVYRDLK 502
           FQ  E  Y ++   + GGE+F  + R   F    +R    +L LA+  +H + +V+RD+K
Sbjct: 186 FQETESYYFIVQELLAGGEIFGEIVRLTYFSEDLSRHVIRQLALAVKHMHSLGIVHRDIK 245

Query: 503 PENILL----------------------DSQGH------------IALCDFGLCKLNMKD 528
           PEN+L                         +G             I L DFGL K     
Sbjct: 246 PENLLFSPIDFIPSKRQQLRQSDDPKTKQDEGLFRPGIGGGGIGVIKLADFGLSKQIYAT 305

Query: 529 NEKTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKIL 588
           N  T+T CGT  Y APEV+  + Y+  VD W +G +LY +L G PP+YDE +  + + I 
Sbjct: 306 N--TTTPCGTVGYTAPEVVKDERYSMKVDMWGIGCVLYTVLCGFPPFYDEKIDVLTELIS 363

Query: 589 KSPLIF--P--DGMDPDAKDLLKRLLNRDPNRR 617
           K    F  P  D + P AK+ ++RLL  DP++R
Sbjct: 364 KGQYTFLRPWWDEISPGAKNAVRRLLEVDPDKR 396

>AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C
            (SSK2) - SH] (1120017..1124468) [4452 bp, 1483 aa]
          Length = 1483

 Score =  105 bits (262), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 79/256 (30%), Positives = 122/256 (47%), Gaps = 16/256 (6%)

Query: 381  TVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLA-ERTILARVECPFIVP 439
            + +G GS+G V      DT  I A+K I+ +      +V  ++  E T+L  +  P +V 
Sbjct: 1195 SFIGGGSFGSVYSAVNLDTGDILAVKEIKFNDRKTIKQVFPSIRDEMTVLEMLNHPNVVQ 1254

Query: 440  LKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVYR 499
                    +++ + +    GG L   L    I D    + Y+ ++L  L  LH+  V +R
Sbjct: 1255 YYGVEVHRDRVNIFMEYCEGGSLASLLAHGRIEDEMVTQVYSLQMLEGLAYLHESGVDHR 1314

Query: 500  DLKPENILLDSQGHIALCDFGLC---------KLNMKDNEKTSTFCGTPEYLAPEVLLGK 550
            D+KPENILLD  G I   DFG           KLN++ + +     GTP Y++PE + G 
Sbjct: 1315 DIKPENILLDFNGIIKYVDFGAAKVLASNGSKKLNLEQHMEGEKMIGTPMYMSPEAISGT 1374

Query: 551  GYTKVV--DWWTLGVLLYEMLTGLPPY--YDENVSEMYKKILKSPLIFP--DGMDPDAKD 604
            GY K    D W+LG ++ EM+TG  P+   D   + +Y+       +FP  + M      
Sbjct: 1375 GYGKFGSDDIWSLGCVILEMVTGRRPWANLDNQWAIIYQVAAGQIPMFPSKNEMSQAGIK 1434

Query: 605  LLKRLLNRDPNRRLGA 620
             L R L +DPN+R  A
Sbjct: 1435 FLSRCLIQDPNQRSTA 1450

>KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces
            cerevisiae YNR031c SSK2 MAP kinase kinase kinase of the
            high osmolarity signal transduction pathway, start by
            similarity
          Length = 1551

 Score =  105 bits (262), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 79/259 (30%), Positives = 118/259 (45%), Gaps = 19/259 (7%)

Query: 381  TVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERT-ILARVECPFIVP 439
            + +G GS+G V      DT  I A+K I+     +  ++  +L E   ++  +  P IV 
Sbjct: 1263 SFIGSGSFGTVYSAVNLDTGDILAVKEIKIQDAKSMKQIFPSLKEEMRVMEILNHPNIVQ 1322

Query: 440  LKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVYR 499
                    +K+ + +    G  L   L+   I D    + Y  +LL  L  LH+  VV+R
Sbjct: 1323 YYGVEVHRDKVNIFMEFCEGSSLASLLEHGRIEDEMVTQVYTLQLLEGLACLHQSGVVHR 1382

Query: 500  DLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTF------------CGTPEYLAPEVL 547
            D+KPENILLD  G I   DFG  KL  K+  K  +              GTP Y+APE +
Sbjct: 1383 DIKPENILLDRNGVIKYVDFGAAKLIAKNGSKRISLDANNKSTGGKDMIGTPMYMAPETV 1442

Query: 548  LGKGYTKVV--DWWTLGVLLYEMLTGLPPY--YDENVSEMYKKILKSPLIFP--DGMDPD 601
             G+G+ K    D W+LG ++ EM+TG  P+   D   + MY         FP    +   
Sbjct: 1443 TGQGHGKFGSDDIWSLGCVVLEMVTGRRPWANLDNEWAIMYHVAAGHLPQFPTKSEISSA 1502

Query: 602  AKDLLKRLLNRDPNRRLGA 620
             +  + R L +D N+R  A
Sbjct: 1503 GRKFISRCLIQDANKRATA 1521

>Scas_685.24
          Length = 515

 Score =  103 bits (256), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 71/270 (26%), Positives = 134/270 (49%), Gaps = 15/270 (5%)

Query: 358 INLTVDFKPSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKS 417
           +++  ++ P  SK     ++ +   +G+G++G V +   + T K+ A+K +    +   +
Sbjct: 6   LSIRREYTPRISKA---HNYIVKECVGRGNFGDVYRAIDRTTNKVVAIKVVD---LENTN 59

Query: 418 EVIHTLAERTI-LARVECPFIVPLKFTFQTPEKLYLVLACINGG---ELFHHLQREGIFD 473
           E +  LA+    LA ++ P+I+    T      +++V+    GG   +L  +    G+ +
Sbjct: 60  ERLEVLAQEIFFLAELKSPYIINYITTLLEDASMWIVMEYCGGGSCSDLLKYYFNNGLPE 119

Query: 474 ISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTS 533
             +  +   E+L  L  LH+   ++RD+K  NILL  +GH+ L DFG+    +K   +  
Sbjct: 120 -KKVAYITREILKGLQYLHEQKKIHRDIKAANILLTEEGHVKLGDFGVSG-QLKSTLRRG 177

Query: 534 TFCGTPEYLAPEVLLG--KGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSP 591
           T  GTP ++APEV     +GY + +D W+LG+ ++E+L G+PP    +   +   + +  
Sbjct: 178 TIVGTPYWMAPEVASQNIEGYDEKIDIWSLGITVFELLKGVPPLVKLDPIRVLANLSRKS 237

Query: 592 LIFPDGMDPD-AKDLLKRLLNRDPNRRLGA 620
                G   D AK  +   L ++PN R  A
Sbjct: 238 APRLQGAYSDAAKSFVALCLIKNPNERPAA 267

>CAGL0L05632g 610481..612514 similar to sp|P08018 Saccharomyces
           cerevisiae YJL128c PBS2, hypothetical start
          Length = 677

 Score =  103 bits (258), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 80/293 (27%), Positives = 142/293 (48%), Gaps = 26/293 (8%)

Query: 347 QWINLKQG----LGTINLT---VDFKPSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDT 399
           +++++K G     G ++L+   +DF    S  + +D+ + +  LG G+YG V +V  K  
Sbjct: 332 RYVDIKSGSLNFAGKLSLSSRGIDFSNGSSSRITLDELQFIEELGHGNYGTVSKVLHKPN 391

Query: 400 QKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVPLKFTFQTPEKLYLVLACING 459
             + A+K +R    + +S+    L E  +L +   PFIV     F     +Y+ +  ++G
Sbjct: 392 NVLMAMKEVR--LELDESKFRQILMELEVLHKCNSPFIVDFYGAFFIEGAVYMCMEYMDG 449

Query: 460 GEL---FHHLQREGIFDISRARFYASELLLALDSLHKM-DVVYRDLKPENILLDS-QGHI 514
           G L   +      G  D  +  F  + ++  L  L ++ +V++RD+KP NIL  + QG +
Sbjct: 450 GSLDKIYDENPEMGGIDEPQLAFITNAVIQGLRELKEVHNVIHRDVKPTNILCSAKQGTV 509

Query: 515 ALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLG----KG-YTKVVDWWTLGVLLYEML 569
            LCDFG+    +    KT+  C +  Y+APE +      +G YT   D W+LG+ + EM 
Sbjct: 510 KLCDFGVSGNLVASLAKTNIGCQS--YMAPERIKSLNPDRGTYTVQSDIWSLGLSILEMA 567

Query: 570 TGLPPYYDENVSEMYKKILK-----SPLIFPDGMDPDAKDLLKRLLNRDPNRR 617
            G  PY  E    ++ ++        P +  D    +A+D +   L + P+RR
Sbjct: 568 LGRYPYPPETFDNIFSQLSAIVDGPPPKLPADKFSDEAQDFVSLCLQKIPDRR 620

>Scas_675.2
          Length = 527

 Score =  103 bits (256), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 79/260 (30%), Positives = 133/260 (51%), Gaps = 19/260 (7%)

Query: 374 IDDFELLTVLGKGSYGKVMQVR-KKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARV 432
           I D  L   +G+GS+G VM      D   I A+K +       K+ +      R +L   
Sbjct: 12  IKDVVLGDTIGQGSFGCVMNAHLAVDPSVIIAVKYVHIP-TCKKNGLTEKDISREVLLHS 70

Query: 433 EC---PFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALD 489
            C   P ++ L       + +++++   +GG+LF  ++ +   D   A+FY  +L+ A+ 
Sbjct: 71  RCSKNPNVLRLIDCNIAKDYMWMIMEMADGGDLFDKIEPDVGVDSEVAQFYFQQLVRAIS 130

Query: 490 SLHK-MDVVYRDLKPENILLDSQGHIALCDFGL-CKLNMKDN--EKTSTFCGTPEYLAPE 545
            LH+   V +RD+KPENILLD  G++ L DFGL  +   KD     ++   G+P Y+APE
Sbjct: 131 YLHEECGVAHRDIKPENILLDKNGNLKLADFGLSSQYRRKDGTLRISTDQRGSPPYMAPE 190

Query: 546 VLLGKG-YTKVVDWWTLGVLLYEMLTGLPPYYDENVSEM-YKKILKSPLIFPDGMDPDAK 603
           +L  +G Y    D W++G+LL+ +LTG  P+    + E+ +   L++       + P AK
Sbjct: 191 ILHSRGYYAHSTDIWSIGILLFVLLTGETPWELPVIEELNFASFLQNNGNL--NLGPWAK 248

Query: 604 ------DLLKRLLNRDPNRR 617
                 +LL+++L  DP +R
Sbjct: 249 IEFFHLNLLRKILQPDPKKR 268

>KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 483

 Score =  102 bits (254), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 76/268 (28%), Positives = 127/268 (47%), Gaps = 27/268 (10%)

Query: 372 VGIDDFELLTVLGKGSYGKVMQV------RKKDTQKI-----YALKAIRKSYIVAKSEVI 420
           + +  F+LL  +GKG++G V         ++    KI      A+K I   +  +   + 
Sbjct: 2   LSLQQFQLLECVGKGNFGDVYLAHYLGSNQEPTDPKIPKNVPLAIKCINLEH--SNEPID 59

Query: 421 HTLAERTILARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFY 480
             L E   L+ + CP+I     TF     LY+V+   + G L + L+           F 
Sbjct: 60  LLLKEIYFLSTLHCPYITHYYGTFTGDCNLYIVMEYCSNGSLLNLLRYYSRLTEQTTCFI 119

Query: 481 ASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLC---KLN--MKDNEKTSTF 535
             ++  AL+ LH+  +++RDLK  NILL+  G + L D G+    K N      +  +TF
Sbjct: 120 ILQVCHALEYLHEKRLIHRDLKAANILLNDDGEVRLADLGVTGQLKFNSTRHGGKNLNTF 179

Query: 536 CGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFP 595
            GTP ++APE++  + Y    D W+LG+   E+L G PP    ++  M K +++ P +  
Sbjct: 180 VGTPFWMAPEIIKNQSYDGKCDIWSLGITTLELLNGKPPM--SHLDSM-KALMRIPKLNA 236

Query: 596 DG------MDPDAKDLLKRLLNRDPNRR 617
           D       + P  KD ++  L +DPN+R
Sbjct: 237 DSILRNMDISPLGKDFIRSCLQQDPNQR 264

>Scas_618.15
          Length = 620

 Score =  102 bits (255), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 81/321 (25%), Positives = 134/321 (41%), Gaps = 67/321 (20%)

Query: 359 NLTVDFKPSYSKPVGIDDFELLTVLGKGSYGKVMQVRK----------KDTQKIYALKAI 408
           N T+ +K  + +   +  ++LL  +GKG++  V +             K+     A+K I
Sbjct: 140 NSTITYK--FKEQAELKGYKLLNKIGKGAFAVVYRAIPDPQNGKSSYFKEVCNEVAIKII 197

Query: 409 RK--------------SYIVAKSEVIHTLAERTILARVECPFIVPLKFTFQTPEKLYLVL 454
           +K              S++ ++ +V+       + A  EC  +V      +T    Y+V 
Sbjct: 198 KKVDLSEDLKDHERDTSHVSSREQVLKEACLHKV-ASSECSEVVGFIDFVETKSYYYIVQ 256

Query: 455 ACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHI 514
             ++GGE++  + R   F     R    +L  A+  LH M +++RD+KPEN+L +   HI
Sbjct: 257 EYLHGGEIYDQIVRLTYFSEDLTRHVIRQLAHAVKHLHSMGIIHRDIKPENLLFEPIQHI 316

Query: 515 ----------------------------------ALCDFGLCKLNMKDNEKTSTFCGTPE 540
                                              L DFGL K      E T+T CGT  
Sbjct: 317 PSTHVKLRKTDNPFTKVDEGMFRPAIGGGGIGAVKLTDFGLSK--QLSTETTNTPCGTIS 374

Query: 541 YLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFP----D 596
           Y APE++    Y   +D W +G +LY +L G PP+Y +    + +KI      F     D
Sbjct: 375 YAAPELIRNHQYDNKIDLWGIGCVLYTLLCGFPPFYADQHKSVTRKIRHGEYHFLSPWWD 434

Query: 597 GMDPDAKDLLKRLLNRDPNRR 617
            +   AK+ +K LL  D ++R
Sbjct: 435 EISSGAKNCVKHLLEVDVSKR 455

>Kwal_14.2497
          Length = 418

 Score =  100 bits (250), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 106/188 (56%), Gaps = 12/188 (6%)

Query: 458 NGGELFHHLQREGIFDISRARFYASELLLALDSLH-KMDVVYRDLKPENILLDSQGHIAL 516
           +GG+LF  ++ +   D   ARFY  +L+ A+D LH +  V +RD+KPEN+LLD +G++ L
Sbjct: 5   SGGDLFDKIEPDVGVDSEVARFYFKQLINAIDHLHNRCGVAHRDIKPENLLLDERGNLKL 64

Query: 517 CDFGLC-KLNMKDNEK--TSTFCGTPEYLAPEVLLGKG-YTKVVDWWTLGVLLYEMLTGL 572
            DFGL  +   KD  K   S   G+  Y+APE++  K  Y    D W+ GVL++ +LTG 
Sbjct: 65  ADFGLASQFKRKDGSKRIMSDTRGSLPYMAPEIVYSKSYYADSTDIWSCGVLVFVLLTGE 124

Query: 573 PPYYDENVSEMYKKILKSPLIFPDG----MDPDAKDLLKRLLNRDPNRRLGANGADEIKN 628
            P+   +    +   L++      G    +D    +LL+++L+ DP RR     A+++K+
Sbjct: 125 TPWDSPSDDSRFDDFLENSGGIASGSWAKIDISQLNLLRKMLHPDPARRA---TAEQLKS 181

Query: 629 HKFFNDLI 636
           H +++  I
Sbjct: 182 HNWYSSPI 189

>Scas_582.1
          Length = 638

 Score =  102 bits (254), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 84/294 (28%), Positives = 139/294 (47%), Gaps = 26/294 (8%)

Query: 347 QWINLKQG----LGTINLT---VDFKPSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDT 399
           +++++K G     G ++L+   +DF    S  + + + E +  LG G+YG V +V  K T
Sbjct: 293 KYVDIKSGSLNFAGKLSLSSKGIDFSNGSSSRITLAELEFIEELGHGNYGNVSKVLHKPT 352

Query: 400 QKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVPLKFTFQTPEKLYLVLACING 459
             I A+K ++     AK   I  L E  +L + + P+IV     F     +Y+ +  ++G
Sbjct: 353 NVIMAMKEVKLELDEAKFRQI--LMELEVLHKCKSPYIVDFYGAFFIEGAVYMCMEYMDG 410

Query: 460 GEL---FHHLQREGIFDISRARFYASELLLALDSLHKM-DVVYRDLKPENILLDS-QGHI 514
           G L   +      G  D  +    A+ ++  L  L  +  +++RD+KP NIL  + QG I
Sbjct: 411 GSLDKIYDQDPEIGGIDEPQLAVIATAVIRGLKVLKDVHHIIHRDVKPTNILCSAKQGTI 470

Query: 515 ALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLG-----KGYTKVVDWWTLGVLLYEML 569
            LCDFG+    +    KT+  C +  Y+APE +         YT   D W+LG+ + EM 
Sbjct: 471 KLCDFGVSGNLVASMAKTNIGCQS--YMAPERIKSLNPDIATYTVQSDIWSLGLSILEMA 528

Query: 570 TGLPPY----YDENVSEMYKKILKSPLIFPDG-MDPDAKDLLKRLLNRDPNRRL 618
            G  PY    +D   S++   +   P   P G    +A+D +   L + P RRL
Sbjct: 529 LGRYPYPPETFDNIFSQLSAIVDGPPPKLPAGKFSKEAQDFVSLCLQKVPERRL 582

>Kwal_47.17263
          Length = 1127

 Score =  103 bits (256), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 88/340 (25%), Positives = 152/340 (44%), Gaps = 65/340 (19%)

Query: 357 TINLTVDFKPSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAI-------- 408
           T  +++++ P   + V ++ +E++  LG+G +GKV   R   T+++ A+K +        
Sbjct: 86  TTKISLEYDPISKRKV-LNTYEIIGELGQGQHGKVKLARDLVTKQLVAIKIVDRNGGKSN 144

Query: 409 RKSYIVAKSEVIHTLAERTILARVECPFIVPLKFTF--QTPEKLYLVLACINGGEL---- 462
           R S+    +       E  I+ +     +V L       T  K+YLVL   + GE+    
Sbjct: 145 RFSFKKNTNGSDKIKREIAIMKKCHHEHVVKLVEVLDDSTSRKIYLVLEYCSKGEVKWCP 204

Query: 463 FHHLQREG----IFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCD 518
              L+ E     +    RAR     ++L L+ LH   +++RD+KP N+L+   G + + D
Sbjct: 205 GDQLETEARGPPLLTFQRAREIFRGVVLGLEYLHYQGIIHRDIKPANLLISESGTVKISD 264

Query: 519 FGLCKLNMK--------DNEKTSTFCGTPEYLAPEVLLGKGYTKV--------------- 555
           FG+     K        D  + +   GTP + APE+ LG   ++                
Sbjct: 265 FGVSFAASKSGAGYGSLDELELAKTAGTPAFFAPEICLGHEASERFAPDRPSSDHGSIIS 324

Query: 556 --VDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIF-------PDGMDP------ 600
             +D W +GV L+ +L G+ P++ E   E++ KI+   L+         +G+        
Sbjct: 325 YNIDIWAIGVTLHCLLFGMLPFFSEFELELFDKIINQELVLKTYEEMASNGISKISNQEE 384

Query: 601 --DAKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDLIWD 638
              AKDLL RLL ++P +R+      EIK H F   + WD
Sbjct: 385 YEAAKDLLGRLLTKNPFKRIKIA---EIKKHPF---VCWD 418

>CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces
           cerevisiae YLR248w RCK2 Ca/calmodulin-dependent or
           sp|P38622 Saccharomyces cerevisiae YGL158w RCK1,
           hypothetical start
          Length = 514

 Score =  100 bits (249), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 80/307 (26%), Positives = 136/307 (44%), Gaps = 64/307 (20%)

Query: 374 IDDFELLTVLGKGSYGKVMQVRKKDTQ----KIYALKAIRKS----YIVAKSEVIHTLAE 425
           ++++ +++ +G+G++ +V +           K  A+K + K     + + K+  + TL E
Sbjct: 64  LNNYRIISKIGEGAFSRVFKAVPLHNNLALPKFVAIKVVPKEDFHDHNLKKTSKLQTLNE 123

Query: 426 RTI---LARVECPFIVPLKFTFQTPEKLY-LVLACINGGELFHHLQREGIFDISRARFYA 481
             I   L +   P +V L   FQ  +K Y  +   I GGE+F+ + +   F     R   
Sbjct: 124 LNIHLKLTKANVPNVVKL-LEFQVSKKYYYFIQEYIEGGEIFNQIVKYTYFSEDLTRHVI 182

Query: 482 SELLLALDSLHKMDVVYRDLKPENILLD-------------------------------- 509
            ++  A+  LH+ ++++RD+KPEN++ +                                
Sbjct: 183 RQVATAVKGLHENNIIHRDIKPENLIFEPIIKEQTIHRYQKLRKSDDPKTKLDEGKFIPG 242

Query: 510 ----SQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVL---------LGKGYTKVV 556
                 G + L DFGL +L         T CGT  YLAPEVL             Y+  V
Sbjct: 243 IGGGGIGKVRLVDFGLSRLMDPAESGARTPCGTFGYLAPEVLNQYKVDPRTSNTSYSYKV 302

Query: 557 DWWTLGVLLYEMLTGLPPYYDENVSE--MYKKILKSPLIFP----DGMDPDAKDLLKRLL 610
           D W +G +LY ML G PP+Y++  S+  +  KI +    F     D +  +A+DL++ LL
Sbjct: 303 DIWAIGCILYTMLCGFPPFYEDEFSKESLGDKISRGNYKFLAPWWDEISIEAQDLIRNLL 362

Query: 611 NRDPNRR 617
             DP +R
Sbjct: 363 QVDPAKR 369

>YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine
           protein kinase involved in induction of autophagy after
           nutrient limitation [2694 bp, 897 aa]
          Length = 897

 Score =  101 bits (252), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 78/287 (27%), Positives = 135/287 (47%), Gaps = 51/287 (17%)

Query: 383 LGKGSYGKVMQVR-KKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVPLK 441
           +GKGS+  V +     D  +  A+K + ++ +  K  + +   E  IL +++ P IV L 
Sbjct: 30  IGKGSFATVYRGHLTSDKSQHVAIKEVSRAKLKNKKLLENLEIEIAILKKIKHPHIVGLI 89

Query: 442 FTFQTPEKLYLVLACINGGELFHHLQREG-----------IFD-----------ISRARF 479
              +T    YL++     G+L   L+R             +F+           + RA  
Sbjct: 90  DCERTSTDFYLIMEYCALGDLTFLLKRRKELMENHPLLRTVFEKYPPPSENHNGLHRAFV 149

Query: 480 --YASELLLALDSLHKMDVVYRDLKPENILL--------DSQGH-------------IAL 516
             Y  +L  AL  L   ++V+RD+KP+N+LL        DS+               + +
Sbjct: 150 LSYLQQLASALKFLRSKNLVHRDIKPQNLLLSTPLIGYHDSKSFHELGFVGIYNLPILKI 209

Query: 517 CDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYY 576
            DFG  +  + +     T CG+P Y+APE+L  + Y    D W++G +++EM  G PP+ 
Sbjct: 210 ADFGFARF-LPNTSLAETLCGSPLYMAPEILNYQKYNAKADLWSVGTVVFEMCCGTPPFR 268

Query: 577 DENVSEMYKKILKSP--LIFPD--GMDPDAKDLLKRLLNRDPNRRLG 619
             N  E++KKI ++   + FP    ++P+ K+L+  LL  DP +R+G
Sbjct: 269 ASNHLELFKKIKRANDVITFPSYCNIEPELKELICSLLTFDPAQRIG 315

>KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces
           cerevisiae YLR248w RCK2 Ca/calmodulin-dependent ser/thr
           protein kinase, start by similarity
          Length = 546

 Score =  100 bits (249), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 65/213 (30%), Positives = 102/213 (47%), Gaps = 41/213 (19%)

Query: 444 FQTPEKLYLVLA-CINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVYRDLK 502
           FQ  EK Y ++   + GGE+F  + +   F    +R    +L  A+  +H++ +V+RD+K
Sbjct: 211 FQESEKYYYIIQELLAGGEIFGEIVKYTYFSEDLSRHVIRQLANAVKYMHQLGIVHRDIK 270

Query: 503 PENILLD----------------------------------SQGHIALCDFGLCKLNMKD 528
           PEN+L +                                    G + L DFGL K   + 
Sbjct: 271 PENLLFEPIDFIPNPKPKLRSSDDPSTKLDEGVFRPGIGGGGIGVVKLADFGLSKQIYQT 330

Query: 529 NEKTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKIL 588
           N KT   CGT  Y APEV+  + Y+  VD W +G +LY +L G PP++DE +  + +KI 
Sbjct: 331 NTKTP--CGTVGYTAPEVVKDERYSMQVDMWGVGCVLYTVLCGFPPFFDEKIDVLTEKIS 388

Query: 589 KSPLIF--P--DGMDPDAKDLLKRLLNRDPNRR 617
           +    F  P  D +   AK+ +++LL  DP +R
Sbjct: 389 RGEYTFLRPWWDQISDGAKNCVRKLLEVDPAKR 421

>CAGL0K02673g complement(240509..243256) similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20
           Serine/threonine-protein kinase, hypothetical start
          Length = 915

 Score =  101 bits (252), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 106/204 (51%), Gaps = 14/204 (6%)

Query: 380 LTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVP 439
           L  +G+G+ G V      +++   A+K +       K E+I  L E  ++   +   IV 
Sbjct: 623 LIKIGQGASGGVYIAHDTESEDSVAIKQMNLEK-QPKKELI--LNEILVMRESKHSNIVN 679

Query: 440 LKFTFQTPEKLYLVLACINGGELF----HHLQREG-IFDISRARFYASELLLALDSLHKM 494
              ++     L++V+  + GG L     H L  EG I  + R      E L  L  LH  
Sbjct: 680 FIDSYLAKGDLWIVMEYMEGGSLTDVVTHCLLSEGQIGAVCR------ETLKGLQFLHSK 733

Query: 495 DVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTK 554
            V++RD+K +NILL  +G+I L DFG C    ++N K +T  GTP ++APEV+  K Y  
Sbjct: 734 GVLHRDIKSDNILLSLKGNIKLTDFGFCAQINENNLKRTTMVGTPYWMAPEVVSRKEYGP 793

Query: 555 VVDWWTLGVLLYEMLTGLPPYYDE 578
            VD W+LG+++ EM+ G PPY +E
Sbjct: 794 KVDIWSLGIMIIEMIEGEPPYLNE 817

>Scas_713.21
          Length = 641

 Score =  100 bits (249), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 93/291 (31%), Positives = 142/291 (48%), Gaps = 41/291 (14%)

Query: 375 DDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTI-----L 429
           ++  ++ +LGKG   KV +V+ + T K YALK I    +    E + T  ER I     L
Sbjct: 319 EELSIVELLGKGGSSKVYKVQDR-TGKYYALKQI---LLEELDENLKTDLEREIELLKRL 374

Query: 430 ARVECPFIVPLKFTFQTPEKLYLVLACINGGELFH--HLQREGIFDISRARFYASELLLA 487
           AR E   +V L   ++  +++  VL      +L H  H +    FDI+  R  + E++  
Sbjct: 375 AREE--RVVKL-IEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIEC 431

Query: 488 LDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKT---STFCGTPEYLAP 544
           + ++H  D+V+ DLKP N +   +G + L DFG+    + DN      +T  GTP Y+AP
Sbjct: 432 IKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIAN-KIADNTLNVYRNTQMGTPNYMAP 489

Query: 545 EVLLGKGYT-----------KVVDWWTLGVLLYEMLTGLPPY-----YDENVSEMYKKI- 587
           E L+ + Y+           K  D W+ G +LY+M  G PPY     +D  ++ M   I 
Sbjct: 490 ETLISQNYSNNNNNLLWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQ 549

Query: 588 LKSPLIFPDGMD-PDA-KDLLKRLLNRDPNRRLGANGADEIKNHKFFNDLI 636
           +  P   P G   P +   L+K  LNRDP  R      DEI++  FFN +I
Sbjct: 550 IDYPNESPCGKKVPQSLVALIKTCLNRDPQLRA---TTDEIQHCSFFNPMI 597

>YHL007C (STE20) [2279] chr8 complement(95113..97932)
           Serine/threonine protein kinase of the pheromone
           response pathway, also participates in the filamentous
           growth and STE vegetative growth pathways [2820 bp, 939
           aa]
          Length = 939

 Score = 99.8 bits (247), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 104/204 (50%), Gaps = 14/204 (6%)

Query: 380 LTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVP 439
           L  +G+G+ G V    +  T    A+K +       K  +I+   E  ++   + P IV 
Sbjct: 623 LVKIGQGASGGVYTAYEIGTNVSVAIKQMNLEKQPKKELIIN---EILVMKGSKHPNIVN 679

Query: 440 LKFTFQTPEKLYLVLACINGGELF----HHLQREG-IFDISRARFYASELLLALDSLHKM 494
              ++     L++++  + GG L     H +  EG I  + R      E L  L+ LH  
Sbjct: 680 FIDSYVLKGDLWVIMEYMEGGSLTDVVTHCILTEGQIGAVCR------ETLSGLEFLHSK 733

Query: 495 DVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTK 554
            V++RD+K +NILL  +G I L DFG C    + N K +T  GTP ++APEV+  K Y  
Sbjct: 734 GVLHRDIKSDNILLSMEGDIKLTDFGFCAQINELNLKRTTMVGTPYWMAPEVVSRKEYGP 793

Query: 555 VVDWWTLGVLLYEMLTGLPPYYDE 578
            VD W+LG+++ EM+ G PPY +E
Sbjct: 794 KVDIWSLGIMIIEMIEGEPPYLNE 817

>Kwal_33.14167
          Length = 838

 Score = 99.8 bits (247), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 85/301 (28%), Positives = 135/301 (44%), Gaps = 42/301 (13%)

Query: 376 DFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTL-AERTILARVEC 434
           ++E L +LG+G   KV +V+  +  K+YALK  R S+       I     E  +L ++E 
Sbjct: 514 EYEKLELLGRGGTSKVYKVKNANNNKVYALK--RVSFDEFDDSSIDGFKGEIELLKKLET 571

Query: 435 -PFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGI-FDISRARFYASELLLALDSLH 492
            P +V L         LY+V+ C +         R G+  D+   R++A E+L  +  +H
Sbjct: 572 QPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVH 631

Query: 493 KMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKD--NEKTSTFCGTPEYLAPEVLLGK 550
              +V+ DLKP N +   +G + + DFG+     +   N    T  GTP Y+APE L+  
Sbjct: 632 DAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAM 690

Query: 551 GYT-------------KVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKS--PLIFP 595
            YT             K  D W+ G ++Y+M+ G PPY           I+     +++P
Sbjct: 691 NYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYP 750

Query: 596 ------DGMDPDAKDLLKRLLNRDPNRRLGANGADEIKN----------HKFFNDLIWDS 639
                 D +   A D +K  L R+PN+R      +E+ N          H F  DLI +S
Sbjct: 751 EKTSNGDTVPKTAIDTMKACLERNPNKRW---TVEEVANGSFVKPVSVTHFFIRDLIENS 807

Query: 640 I 640
           +
Sbjct: 808 V 808

>KLLA0E15378g 1362851..1365025 some similarities with sp|P08018
           Saccharomyces cerevisiae YJL128c PBS2 tyrosine protein
           kinase of the MAP kinase kinase family, hypothetical
           start
          Length = 724

 Score = 99.4 bits (246), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 90/294 (30%), Positives = 144/294 (48%), Gaps = 29/294 (9%)

Query: 347 QWINLKQG----LGTINLT---VDFKPSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDT 399
           +++N+K G     G ++L+   VDF    S  + +D+ E L  LG G+YG V +V  K T
Sbjct: 381 KYVNIKSGSLNFAGKLSLSSKGVDFSNGSSFRIKLDELEFLEELGHGNYGNVSKVLHKPT 440

Query: 400 QKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVPLKFTFQTPEKLYLVLACING 459
             I A+K +R    + +S+    L E  +L   + P+IV     F     +Y+ +  ++G
Sbjct: 441 HIIMAMKEVR--LELDESKFRQILMELEVLHNCQSPYIVDFYGAFFIEGAVYMCMEYMDG 498

Query: 460 GEL---FHHLQREGIFDISRARFYAS--ELLLALDSLHKMDVVYRDLKPENILLD-SQGH 513
           G L   +   Q  GI +   AR  +S  + L  L  +H  ++++RD+KP NIL   SQG 
Sbjct: 499 GSLDKTYDDEQIGGIDEPQLARITSSVIQGLKELKDVH--NIIHRDVKPTNILCSASQGT 556

Query: 514 IALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLG-----KGYTKVVDWWTLGVLLYEM 568
           I LCDFG+    +    KT+  C +  Y+APE +         Y+   D W+LG+ + EM
Sbjct: 557 IKLCDFGVSGNLVASLAKTNIGCQS--YMAPERIKSLNPDKSTYSVQSDIWSLGLSILEM 614

Query: 569 LTGLPPY----YDENVSEMYKKILKSPLIFPDG-MDPDAKDLLKRLLNRDPNRR 617
             G  PY    +D   S++   +   P   P+G    DA++ +   L + P RR
Sbjct: 615 ALGAYPYPPETFDNIFSQLSAIVDGPPPKLPEGKFSADAQNFVSMCLQKIPERR 668

>Scas_619.5*
          Length = 510

 Score = 98.2 bits (243), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 85/282 (30%), Positives = 138/282 (48%), Gaps = 52/282 (18%)

Query: 382 VLGKGSYGKVMQVRKKD--------TQKIYALKAIR-KSYIVAKSEVIHTLAERTILARV 432
           ++G G++G V+   KK         ++  +A+K I+ + Y V K        E  IL ++
Sbjct: 173 IIGNGTFGNVLVAFKKSEIVASDVYSRPNFAVKVIKLRKYKVDK--------EAKILLKL 224

Query: 433 ECPFIVPLKFTFQ--TPEKLYLVLACINGGELFHHLQR-EGIFDISRAR--FYASELLLA 487
               I+ + +TF       LY+    I GG+LF +L + E +  IS         ++L A
Sbjct: 225 NHANIIKIHYTFNDLMNNNLYIFQDLIPGGDLFSYLAKGECLTAISETETLIIVYQILKA 284

Query: 488 LDSLHKMDVVYRDLKPENILLDSQ---GHIALCDFGLCK-LNMKDNEKTSTFCGTPEYLA 543
           L  +H   +V+RDLK +NILL S      I L DFG+ K L++K N + +T  GTPEY A
Sbjct: 285 LHYIHGRGIVHRDLKLDNILLCSPEPCTRIVLADFGIAKDLSLK-NTRMNTIVGTPEYCA 343

Query: 544 PEVLLG--------------------KGYTKVVDWWTLGVLLYEMLTGLPPYY-DENVSE 582
           PEV                        GY    D W+LGV+ + MLTG+ P+Y D + + 
Sbjct: 344 PEVGFKATRSIIDQSCSRANTIDQSMNGYDSKCDIWSLGVITHIMLTGISPFYGDGSENS 403

Query: 583 MYKKILKSPLIFP----DGMDPDAKDLLKRLLNRDPNRRLGA 620
           + + + +  L F     + ++ +AK  +++LL  D ++RL +
Sbjct: 404 IIQNVKRGKLDFSMKPWNNVNHNAKQFVEKLLEIDADKRLDS 445

>Scas_707.36
          Length = 915

 Score = 99.4 bits (246), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 85/333 (25%), Positives = 152/333 (45%), Gaps = 61/333 (18%)

Query: 360 LTVDFKPSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAI----RKSYIVA 415
           +++ + P  SK   ++ +E++  LG G +GKV   +     ++ A+K +    +K+Y   
Sbjct: 77  ISLSYDP-VSKTQILNHYEIVKELGNGQHGKVKLAKDIRANQLVAIKMVNRYEKKTYFAG 135

Query: 416 --KSEVIHTLAERTILARVECPFIVPLKFTFQ--TPEKLYLVLACINGGELF------HH 465
             +++      E  I+ +     +V L       +  K+YLVL     G +         
Sbjct: 136 PKRNDPNKIKKEIAIMKKCNNKHVVKLIEILDDLSSRKIYLVLEYCEKGPILWCPRDQLE 195

Query: 466 LQREGIFDIS--RARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLC- 522
           +   G   +S  RAR    +++L L+ LH   +++RD+KP N+L+D  G + + DFG+  
Sbjct: 196 IDSRGPPQLSFQRAREIFRDVILGLEYLHSQGIIHRDIKPANLLMDKNGVVKISDFGVSL 255

Query: 523 ----KLNMKDNE-KTSTFCGTPEYLAPEVLLGKGYTKV-----------------VDWWT 560
                ++  D+E + +   GTP + APE+ LG    +                  +D W 
Sbjct: 256 AANGNIDTNDDELELTKTVGTPVFYAPEICLGAAAMERFNLDKDELFNGSCISFKIDIWA 315

Query: 561 LGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFP------DGMDPD---------AKDL 605
           LG+ LY +L G+ P+  E   ++++KI+   L FP      D    +         AKDL
Sbjct: 316 LGITLYCLLFGMLPFVSEFELKLFEKIVNEKLRFPTFETLQDNHISEISHIREFVHAKDL 375

Query: 606 LKRLLNRDPNRRLGANGADEIKNHKFFNDLIWD 638
           L +LL ++P +R+      +IK H F   + WD
Sbjct: 376 LNKLLEKNPAKRI---SIPDIKVHPF---VCWD 402

>CAGL0L06006g complement(670707..673535) similar to sp|P53104
           Saccharomyces cerevisiae YGL180w APG1 essential for
           autophagocytosis, hypothetical start
          Length = 942

 Score = 99.4 bits (246), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 84/304 (27%), Positives = 145/304 (47%), Gaps = 59/304 (19%)

Query: 383 LGKGSYGKVMQVR-KKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVPLK 441
           +GKGS+  V +     D +   A+KA+ +S +  K  + +   E  IL +++ P IV L 
Sbjct: 17  IGKGSFATVYRGHVTTDPKSHIAVKAVARSKLKNKKLLENLEIEIAILKKIKHPHIVGLI 76

Query: 442 FTFQTPEKLYLVLACINGGELFHHLQR-----------EGIFD-----------ISRARF 479
              +T    YLV+     G+L   +++           + +F+           ++RA  
Sbjct: 77  DCERTTTDFYLVMDYCALGDLTFLIKKRKELENNHPLLQTVFNKYPPPSKEHNGLNRAFV 136

Query: 480 --YASELLLALDSLHKMDVVYRDLKPENILL--------DSQ-----GHIAL-------- 516
             Y  +L  AL  L   ++V+RD+KP+N+LL        DS+     G++ +        
Sbjct: 137 VCYLQQLASALKFLRSKNLVHRDIKPQNLLLATPLTNYRDSKTFHELGYVGIYNLPILKI 196

Query: 517 CDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYY 576
            DFG  +  +       T CG+P Y+APE+L  + Y    D W++G +L+EM  G+PP+ 
Sbjct: 197 ADFGFARF-LPSTSLAETLCGSPLYMAPEILNYQKYNAKADLWSVGTVLFEMCCGVPPFT 255

Query: 577 DENVSEMYKKILKS--PLIFPD--GMDPDAKDLLKRLLNRDPNRRLGANGADEIKNHKFF 632
             N  E++KKI ++   + FP+   ++   K+L+  LL  DP +R+G          +FF
Sbjct: 256 ASNHLELFKKIKRAHDEINFPEVCEVEDGLKELICSLLTFDPAKRIGF--------EEFF 307

Query: 633 NDLI 636
           N+ I
Sbjct: 308 NNKI 311

>ABR014W [605] [Homologous to ScYHL007C (STE20) - SH]
           complement(417710..420625) [2916 bp, 971 aa]
          Length = 971

 Score = 99.4 bits (246), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 103/207 (49%), Gaps = 14/207 (6%)

Query: 377 FELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPF 436
           +  L  +G+G+ G V    +  T    A+K +       K  +I+   E  ++       
Sbjct: 683 YRNLVKIGQGASGGVYTAYEIGTNASVAIKQMNLEKQPKKELIIN---EILVMKGSRHNN 739

Query: 437 IVPLKFTFQTPEKLYLVLACINGGELF----HHLQREG-IFDISRARFYASELLLALDSL 491
           IV    ++     L++++  + GG L     H +  EG I  +SR      E L  L  L
Sbjct: 740 IVNFIDSYLLKGDLWVIMEYMEGGSLTDVVTHCILTEGQIAAVSR------ETLRGLHFL 793

Query: 492 HKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKG 551
           H   V++RD+K +NILL   G+I L DFG C    + N K +T  GTP ++APEV+  K 
Sbjct: 794 HSKGVIHRDIKSDNILLSMDGNIKLTDFGFCAQINETNLKRTTMVGTPYWMAPEVVSRKE 853

Query: 552 YTKVVDWWTLGVLLYEMLTGLPPYYDE 578
           Y   VD W+LG+++ EM+ G PPY +E
Sbjct: 854 YGPKVDIWSLGIMIIEMIEGEPPYLNE 880

>Kwal_26.7861
          Length = 955

 Score = 99.0 bits (245), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 104/207 (50%), Gaps = 14/207 (6%)

Query: 377 FELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPF 436
           ++ L  +G+G+ G V    +  T    A+K +       K  +I+   E  ++   +   
Sbjct: 667 YKNLIKIGQGASGGVYTAYEVGTNASVAIKQMNLEKQPKKELIIN---EILVMKASKHAN 723

Query: 437 IVPLKFTFQTPEKLYLVLACINGGELF----HHLQREG-IFDISRARFYASELLLALDSL 491
           IV    ++     L++V+  + GG L     H +  EG I  +SR      E L  L  L
Sbjct: 724 IVNFIDSYLLRGDLWVVMEYMEGGSLTDVVTHCILTEGQIGAVSR------ETLKGLQFL 777

Query: 492 HKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKG 551
           H   V++RD+K +N+LL   G I L DFG C    + N K +T  GTP ++APEV+  K 
Sbjct: 778 HSKGVIHRDIKSDNVLLSMSGEIKLTDFGFCAQINEINLKRTTMVGTPYWMAPEVVSRKE 837

Query: 552 YTKVVDWWTLGVLLYEMLTGLPPYYDE 578
           Y   VD W+LG+++ EM+ G PPY +E
Sbjct: 838 YGPKVDIWSLGIMIIEMIEGEPPYLNE 864

>KLLA0F01276g complement(120001..121560) similar to sp|P38147
           Saccharomyces cerevisiae YBR274w CHK1 regulats
           inhibitory Cdk phosphorylation of PDS1, start by
           similarity
          Length = 519

 Score = 97.4 bits (241), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 79/282 (28%), Positives = 136/282 (48%), Gaps = 34/282 (12%)

Query: 374 IDDFELLTVLGKGSYGKVMQVR-KKDTQKIYALKAIR----KSYIVAKSEVIHTLAERT- 427
           ID  +L   +GKGS+  V +   + D   + A+K I     +   +++ +V+  +   + 
Sbjct: 12  IDGLQLGRTIGKGSFAFVKRASLEVDPSTVIAVKFIHLPSCEKQGMSQEDVLREVKLHSR 71

Query: 428 ------ILARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYA 481
                 +L  ++C    P          L++ +    GG+LF  ++ +   D   A+FY 
Sbjct: 72  CSNFVNVLKVIDCNLSDPF---------LWIAMELAEGGDLFDKIEPDIGVDSEVAQFYY 122

Query: 482 SELLLALDSLH-KMDVVYRDLKPENILLDSQGHIALCDFGLCKL-NMKDNEK--TSTFCG 537
            +L+ A+  LH    V +RD+KPENILLD  G++ L DFGL  L   KD  K  +    G
Sbjct: 123 KQLIKAISYLHDTCGVAHRDIKPENILLDKDGNLKLADFGLASLFKRKDGSKRISRDQRG 182

Query: 538 TPEYLAPEVLLGKG-YTKVVDWWTLGVLLYEMLTGLPPY-YDENVSEMYKKILKSPLIFP 595
           +  Y+APE++   G Y  + D W++GVLL+ +LTG  P+       E ++  +K      
Sbjct: 183 SLPYMAPEIIYCDGYYADMTDIWSIGVLLFVLLTGETPWELPHEDDETFRNFIKGEGKLD 242

Query: 596 DG----MDPDAKDLLKRLLNRDPNRRLGANGADEIKNHKFFN 633
            G    +D    +LL+++L  DP +R      D ++ H ++ 
Sbjct: 243 QGSWLKIDFVELNLLRKILQPDPEKRA---SLDTLRKHTWYQ 281

>Kwal_33.14081
          Length = 580

 Score = 97.8 bits (242), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 84/292 (28%), Positives = 141/292 (48%), Gaps = 25/292 (8%)

Query: 347 QWINLKQG----LGTINLT---VDFKPSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDT 399
           +++++K G     G ++L+   VDF    S  + +D+ E L  LG G+YG V +V  K T
Sbjct: 237 KYVDIKSGSLNFAGKLSLSSQGVDFSNGSSFRITLDELEFLEELGHGNYGNVSKVLHKPT 296

Query: 400 QKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVPLKFTFQTPEKLYLVLACING 459
             I A+K +R    + +S+    L E  +L + + P+IV     F     +Y+ +  ++G
Sbjct: 297 NVIMAMKEVR--LELDESKFTQILMELEVLHKCQSPYIVDFYGAFFIEGAVYMCMEYMDG 354

Query: 460 GELFHHLQRE--GIFDISRARFYASELLLALDSLHKM-DVVYRDLKPENILLD-SQGHIA 515
           G L      +  G  D     + A+ ++  L  L  + ++++RD+KP N+L   +QG + 
Sbjct: 355 GSLDKSYDSDVLGGIDEPELAYIANAIIQGLKELKDVHNIIHRDVKPTNVLCSAAQGTVK 414

Query: 516 LCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLG-----KGYTKVVDWWTLGVLLYEMLT 570
           LCDFG+    +    KT+  C +  Y+APE +         YT   D W+LG+ + EM  
Sbjct: 415 LCDFGVSGNLVASLAKTNIGCQS--YMAPERIKSFNPDKATYTVQSDIWSLGLSILEMAI 472

Query: 571 GLPPY----YDENVSEMYKKILKSPLIFPDG-MDPDAKDLLKRLLNRDPNRR 617
           G  PY    +D   S++   +   P   P G   P A+D +   L + P RR
Sbjct: 473 GTYPYPVETFDNIFSQLSAIVDSPPPQLPKGRFSPMAQDFVNMCLQKIPERR 524

>KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20 ser/thr protein
           kinase of the pheromone pathway, hypothetical start
          Length = 989

 Score = 98.2 bits (243), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 69/213 (32%), Positives = 106/213 (49%), Gaps = 26/213 (12%)

Query: 377 FELLTVLGKGSYGKVMQVRKKDTQKIYALKAI------RKSYIVAKSEVIHTLAERTILA 430
           ++ L  +G+G+ G V    +  T    A+K +      +K  IV +  V+       I+ 
Sbjct: 698 YKNLIKIGQGASGGVYTAYELGTNASVAIKQMNLEKQPKKELIVNEILVMKGSKHNNIVN 757

Query: 431 RVECPFIVPLKFTFQTPEKLYLVLACINGGELF----HHLQREG-IFDISRARFYASELL 485
            ++        + F+    L++V+  + GG L     H +  EG I  +SR      E L
Sbjct: 758 FIDS-------YLFRG--DLWVVMEYMEGGSLTDVVTHCILTEGQIGAVSR------ETL 802

Query: 486 LALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPE 545
             L  LH   V++RD+K +NILL   G I L DFG C    + N K +T  GTP ++APE
Sbjct: 803 KGLQFLHSKGVIHRDIKSDNILLSMNGDIKLTDFGFCAQINEVNLKRTTMVGTPYWMAPE 862

Query: 546 VLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDE 578
           V+  K Y   VD W+LG+++ EM+ G PPY +E
Sbjct: 863 VVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNE 895

>CAGL0J04290g complement(400939..402012) similar to sp|P16892
           Saccharomyces cerevisiae YBL016w FUS3 or sp|P14681
           Saccharomyces cerevisiae YGR040w KSS1, start by
           similarity
          Length = 357

 Score = 95.1 bits (235), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 81/297 (27%), Positives = 133/297 (44%), Gaps = 54/297 (18%)

Query: 376 DFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECP 435
           DF+L ++LG+G+YG V     K T +I A+K I           + TL E  IL R +  
Sbjct: 12  DFQLKSLLGEGAYGVVCSAVHKPTGEIVAIKKIVP--FDKPLFALRTLREIKILRRFQHE 69

Query: 436 FIVPLKFTFQTPE------KLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALD 489
            I+ + F  Q PE      ++Y++   +      H +           +++  + L A+ 
Sbjct: 70  NIISI-FDIQKPESFEKFNEVYIIQELMQTD--LHRVIATQTLTDDHIQYFIYQTLRAIK 126

Query: 490 SLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKL--------NMKDNEKTSTFCGTPEY 541
           +LH  +V++RDLKP NIL++S   + +CDFGL ++        N  D    + +  T  Y
Sbjct: 127 TLHGSNVIHRDLKPSNILINSNCDLKVCDFGLARIIDSGENGDNEVDKIGMTEYVATRWY 186

Query: 542 LAPEVLLGKG-YTKVVDWWTLGVLLYEM---------------------LTGLPPYYDEN 579
            APEV+L    Y++ +D W+ G +L E+                     L G P   D++
Sbjct: 187 RAPEVMLTNAKYSRAMDIWSCGCILGELFLKRPLFPGKDYRHQLLLIFGLIGTPDSSDKS 246

Query: 580 VS--------EMYKKILKSPLIFP-----DGMDPDAKDLLKRLLNRDPNRRLGANGA 623
           +         +    + K P + P      G++P   DLL R+L  DP  R+ A+ A
Sbjct: 247 MECIESRRARQYIASLQKYPPVRPLQKAFPGVNPVGVDLLSRMLVFDPRERISADDA 303

>Scas_668.22
          Length = 893

 Score = 97.8 bits (242), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 102/204 (50%), Gaps = 14/204 (6%)

Query: 380 LTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVP 439
           L  +G+G+ G V    +  + +  A+K +       K  +I+   E  ++     P IV 
Sbjct: 614 LVKIGQGASGGVYIANEIGSNESVAIKQMNLEKQPKKELIIN---EILVMKGSRHPNIVN 670

Query: 440 LKFTFQTPEKLYLVLACINGGELF----HHLQREG-IFDISRARFYASELLLALDSLHKM 494
              ++     L++++  + GG L     H +  EG I  + R      E L  L  LH  
Sbjct: 671 FIDSYLLDGDLWVIMEYMEGGSLTDVVTHCILTEGQIGAVCR------ETLSGLQFLHSK 724

Query: 495 DVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTK 554
            V++RD+K +NILL   G I L DFG C    + N K +T  GTP ++APEV+  K Y  
Sbjct: 725 GVLHRDIKSDNILLSISGDIKLTDFGFCAQINEINLKRTTMVGTPYWMAPEVVSRKEYGP 784

Query: 555 VVDWWTLGVLLYEMLTGLPPYYDE 578
            VD W+LG+++ EM+ G PPY +E
Sbjct: 785 KVDIWSLGIMIIEMIEGEPPYLNE 808

>KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces
           cerevisiae YGL180w APG1 essential for autophagocytosis,
           start by similarity
          Length = 831

 Score = 97.4 bits (241), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 89/363 (24%), Positives = 165/363 (45%), Gaps = 70/363 (19%)

Query: 375 DDFELLTVLGKGSYGKVMQ-VRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVE 433
           +++ +   +GKGS+  V + +  +D + I A+KA+ +S +  K  + +   E  IL +++
Sbjct: 19  ENYSVEKEIGKGSFAVVYKGLSLRDGRNI-AIKAVSRSKLKNKKLLENLEVEIAILKKIK 77

Query: 434 CPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQR-----------EGIFD--------- 473
            P IV L    +T    YL++     G+L   +++           + +F+         
Sbjct: 78  HPHIVGLIDCERTSSDFYLIMEYCALGDLTFFIKKRKNLVLKHPLIKTVFEHYPPPSTEH 137

Query: 474 --ISRARF--YASELLLALDSLHKMDVVYRDLKPENILLDSQ-------------GHIAL 516
             ++R     Y  +L  AL  L   ++V+RD+KP+N+LL +              G + +
Sbjct: 138 NGLNRVLVVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLCTPLLDYNDPKTFHELGFVGI 197

Query: 517 --------CDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEM 568
                    DFG  +  + +     T CG+P Y+APE+L  + Y    D W++G +LYEM
Sbjct: 198 YNLPILKIADFGFARF-LPNTSLAETLCGSPLYMAPEILNYQKYNAKADLWSVGTVLYEM 256

Query: 569 LTGLPPYYDENVSEMYKKILKS--PLIFPDG--MDPDAKDLLKRLLNRDPNRRLGANGAD 624
             G PP+   N  E+++KI K+   +  P    ++P   +L++ LL  DP+ R+G     
Sbjct: 257 CCGRPPFKASNHLELFQKIKKANDEITVPSNCYIEPKLFNLIRGLLTFDPDSRMGFTD-- 314

Query: 625 EIKNHKFFNDLIWDSIWNKEYLPPFRPDVQNANDTSNFDNEFTKQKPVDSVIDEYLSESV 684
                 FFN+ +      + Y   + PD+++ +      N F         + EYL + +
Sbjct: 315 ------FFNNEVVTEDLTR-YEQSYEPDLESKSKDVAESNMF---------VSEYLVKPL 358

Query: 685 QNQ 687
           + Q
Sbjct: 359 KQQ 361

>ACL054W [995] [Homologous to ScYGL180W (APG1) - SH]
           complement(269703..272621) [2919 bp, 972 aa]
          Length = 972

 Score = 97.4 bits (241), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 82/305 (26%), Positives = 139/305 (45%), Gaps = 53/305 (17%)

Query: 367 SYSKPVGI--DDFELLTVLGKGSYGKVMQVRKKDTQK-IYALKAIRKSYIVAKSEVIHTL 423
           S  +PV I  + + +   +G+GS+  V +    D+     A+KA+ +S +  K  + +  
Sbjct: 6   SGGRPVAIVAERYVVEKEIGRGSFAVVYKGHLADSSAGNVAIKAVSRSKLRNKKLLENLE 65

Query: 424 AERTILARVECPFIVPLKFTFQTPEKLYLVLA-CINGGELFHHLQREGIFD---ISRARF 479
            E  IL +++ P IV L    +T    YL++  C  G   F   +R  + D   + R  F
Sbjct: 66  IEIAILKKIKHPHIVGLLECERTGTDFYLMMEYCALGDLTFFIKKRRSLMDKHPLVRTLF 125

Query: 480 --------------------YASELLLALDSLHKMDVVYRDLKPENILLD---------- 509
                               Y  +L  AL  L   ++V+RD+KP+N+LL           
Sbjct: 126 EKYPPPSEHHNGLNRVLVVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLSTPLVDYNDPA 185

Query: 510 ---SQGHIAL--------CDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKVVDW 558
              ++G + +         DFG  +  + +     T CG+P Y+APE+L  + Y    D 
Sbjct: 186 EFHARGFVGIYNLPILKIADFGFARF-LPNTSLAETLCGSPLYMAPEILNYQKYNAKADL 244

Query: 559 WTLGVLLYEMLTGLPPYYDENVSEMYKKILKSP--LIFPD--GMDPDAKDLLKRLLNRDP 614
           W++G +LYEM  G PP+   N  E+++KI K+   + FP    ++    DL+  LL  +P
Sbjct: 245 WSVGTVLYEMCCGKPPFKASNHLELFQKIKKANDVIQFPKHAALESAMVDLICGLLTFEP 304

Query: 615 NRRLG 619
            +R+G
Sbjct: 305 AKRMG 309

>AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH]
           (291129..292676) [1548 bp, 515 aa]
          Length = 515

 Score = 96.3 bits (238), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 78/276 (28%), Positives = 134/276 (48%), Gaps = 22/276 (7%)

Query: 374 IDDFELLTVLGKGSYGKVMQVR-KKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARV 432
           I + EL   +G+G++  V     + D Q I A+K +      A+      L  R ++ + 
Sbjct: 12  IKELELGETIGQGTFAFVKTASLRADPQTIVAVKFVHVERCKARGMTDEDLT-REVVLQT 70

Query: 433 ECP---FIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALD 489
            C     +V +     + E L++ +   +GG+LF  ++ +   D   ARFY  +L+ AL 
Sbjct: 71  RCAGHRHVVRVLDCNVSREYLWIAMELADGGDLFDKIEPDVGVDSEVARFYYQQLVRALT 130

Query: 490 SLHK-MDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEK---TSTFCGTPEYLAPE 545
            LH+   V +RD+KPEN+LLD  G++ + DFGL     + +          GT  YLAPE
Sbjct: 131 HLHEACGVAHRDIKPENMLLDRAGNLKVADFGLATRFRRRDGTRRLARDRRGTLPYLAPE 190

Query: 546 VLLGKGY-TKVVDWWTLGVLLYEMLTGLPPYYDENVSE-MYKKILKSPLIFPDGMDPDAK 603
           V+  + Y     D W+ GVL++ +LTG  P+ + +V + M++  +       DG  P  K
Sbjct: 191 VVGERAYHADTADIWSAGVLVFVLLTGETPWSEPSVDDGMFRAFVADGGNLSDG--PWGK 248

Query: 604 ------DLLKRLLNRDPNRRLGANGADEIKNHKFFN 633
                 +LL+++L + P  R       +++ H +F 
Sbjct: 249 IGLVELNLLRKMLQQRPAARATLA---QLRQHPWFK 281

>CAGL0K02167g complement(191468..194956) similar to sp|P38990
           Saccharomyces cerevisiae YER129w
           Serine/threonine-protein kinase, start by similarity
          Length = 1162

 Score = 97.4 bits (241), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 92/347 (26%), Positives = 154/347 (44%), Gaps = 74/347 (21%)

Query: 357 TINLTVDFKPSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAI-------R 409
           T  +++ + P   + V ++ +E++  LG G +GKV   R   T+++ A+K +       R
Sbjct: 122 TNRISLTYDPVSKRKV-LNTYEIIKELGHGQHGKVKLGRDLVTKRLVAIKIVDRHEKKER 180

Query: 410 KSYIV---AKSEVIHTLAERTILARVECPFIVPLKFTFQ--TPEKLYLVLACINGGELF- 463
           K +      K+E      E  I+ +     +V L          K+YLVL   + GE+  
Sbjct: 181 KFFSFKKPGKTENDKIKREIAIMKKCHHKHVVKLIEVLDDLKSRKIYLVLEYCSRGEVKW 240

Query: 464 ---HHLQREG------IFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHI 514
                L+ E        F  +R       ++L L+ LH   +++RD+KP N+LL   G +
Sbjct: 241 CPPDCLETEAKGPSPLSFQFTREILRG--VVLGLEYLHYQGIIHRDIKPANLLLSETGIV 298

Query: 515 ALCDFGL----CKLNMKDNEKT------STFCGTPEYLAPEVLLGK-GYTKV-------- 555
            + DFG+       N+  +++T      +   GTP + APE+ LG+  + K         
Sbjct: 299 KISDFGVSLAASSSNVDGSDETIDELELAKTAGTPAFFAPEICLGEDAFEKYQLDREELF 358

Query: 556 --------VDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMD-------- 599
                   +D W LGV LY ++ G+ P+      E+++KI+  P+ FP   D        
Sbjct: 359 KGSCISFKIDIWALGVTLYCLVFGMLPFVSSFELELFEKIVNDPVKFPKYSDMLKNNQVL 418

Query: 600 --------PDAKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDLIWD 638
                     AKDLL RLL ++P +R+     +EIK H F   + WD
Sbjct: 419 QMTEEAEYEAAKDLLTRLLEKNPIKRI---NIEEIKRHPF---VCWD 459

>KLLA0F23507g complement(2198603..2200066) similar to sp|P24719
           Saccharomyces cerevisiae YOR351c MEK1 ser/thr protein
           kinase, start by similarity
          Length = 487

 Score = 95.1 bits (235), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 77/263 (29%), Positives = 123/263 (46%), Gaps = 34/263 (12%)

Query: 382 VLGKGSYGKVMQVRKKD--TQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVP 439
           ++G G++G V+   K D   ++  A K +  +  V  +     + E TIL ++  P I+ 
Sbjct: 144 IVGSGTFGHVLVAEKVDHNMKRQVAKKTVSYAVKVINTAKTRMVKEATILEKLNHPNIIR 203

Query: 440 L-KFTFQTPEKLYLVLACINGGELFHHLQR-EGIFDISRAR--FYASELLLALDSLHKMD 495
           + +        +Y+    I+GG+LF +L + + +  IS         ++LLAL  LH   
Sbjct: 204 IHQSCVDALGNVYIFQDLISGGDLFSYLAKGDCLVPISETESLIIIYQILLALKFLHSNG 263

Query: 496 VVYRDLKPENILLDS---QGHIALCDFGLCK-LNMKDNEKTSTFCGTPEYLAPEVLL--- 548
           +V+RDLK +NILL +      + L DFG+ K L+    E+  T  GTPEY APEV     
Sbjct: 264 IVHRDLKLDNILLHTPEPCTKVVLADFGIAKELSQNTKERMHTVVGTPEYCAPEVGFKAD 323

Query: 549 ----------------GKGYTKVVDWWTLGVLLYEMLTGLPPYY-DENVSEMYKKILKSP 591
                             GY    D W+LGV+ + MLTG+ P+Y D + + + K +    
Sbjct: 324 RNIYRSFSRTATLDPDNNGYDSKCDIWSLGVITHIMLTGISPFYGDGSEASIIKNVRTGK 383

Query: 592 LIFPD----GMDPDAKDLLKRLL 610
           L F       +   AK  +K+ L
Sbjct: 384 LNFTARQWIAITDSAKSFVKKCL 406

>AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W
           (SKM1) - SH] complement(246871..249252) [2382 bp, 793
           aa]
          Length = 793

 Score = 96.3 bits (238), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 66/231 (28%), Positives = 107/231 (46%), Gaps = 26/231 (11%)

Query: 356 GTINLTVDFK-PSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIV 414
           G++ L    K P Y +  G+   EL   +G     K M + K+           RK  IV
Sbjct: 510 GSVYLAQRLKIPPYDENSGVSQHELNDNIGDKVAIKQMILSKQP----------RKELIV 559

Query: 415 AKSEVIHTLAERTILARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDI 474
            +  V+     + I+  +E           +T + L++V+  + GG L   ++     D 
Sbjct: 560 NEILVMKDSQHKNIVNFLEA--------YLKTEDDLWVVMEYMEGGSLTDVIENSIGSDA 611

Query: 475 SRA-------RFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMK 527
           S +        +   E    L  LH   +++RD+K +N+LLD+ G + + DFG C     
Sbjct: 612 SESPMTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTHGRVKITDFGFCAKLTD 671

Query: 528 DNEKTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDE 578
              K +T  GTP ++APEV+  + Y + VD W+LG++  EML G PPY +E
Sbjct: 672 KRSKRATMVGTPYWMAPEVVKQREYDEKVDVWSLGIMTIEMLEGEPPYLNE 722

>Kwal_26.8703
          Length = 444

 Score = 94.7 bits (234), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 61/206 (29%), Positives = 103/206 (50%), Gaps = 9/206 (4%)

Query: 382 VLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVPL- 440
           VLG+G+ G V + + K    ++ALK I  +    +++    L E          +IV   
Sbjct: 162 VLGEGAGGSVTKCKLKGGSMVFALKTITTANSDPETQK-QVLRELQFNRSCSSEYIVRYY 220

Query: 441 -KFTFQTPEKLYLVLACINGGEL----FHHLQREGIFDISRARFYASELLLALDSLHKMD 495
             F  ++   +Y+ +  + G  L     H L+R G          A  +L  L  L +  
Sbjct: 221 GMFAEESTSSIYIAMEYMGGKSLDAIYKHLLERGGRIGEKVLGKIAESVLKGLSYLQERK 280

Query: 496 VVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKV 555
           +++RD+KP+NILL+  G + LCDFG+  + +  N   +TF GT  Y+APE + G+ Y+  
Sbjct: 281 IIHRDIKPQNILLNEAGQVKLCDFGVSGVAV--NSLATTFTGTSFYMAPERIQGQPYSVT 338

Query: 556 VDWWTLGVLLYEMLTGLPPYYDENVS 581
            D W+LG+ L E+  G  P+  +N++
Sbjct: 339 SDVWSLGLTLLEVAQGQFPFGSDNMA 364

>ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH]
           (1386601..1388079) [1479 bp, 492 aa]
          Length = 492

 Score = 94.7 bits (234), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 81/282 (28%), Positives = 130/282 (46%), Gaps = 46/282 (16%)

Query: 382 VLGKGSYGKVMQVRKKDTQKI-----YALKAIR---------KSYIVAKSEV--IHTLAE 425
           V+G G++G+V+   +K          YA+K IR          S +V  + V  I T  E
Sbjct: 148 VVGSGTFGQVLVAERKSAHSKHRPLNYAVKVIRMKREALAKEASILVRLNHVSGIETTGE 207

Query: 426 RTILARVECPFIVPLKFTF-QTPEKLYLVLACINGGELFHHLQREGIF---DISRARFYA 481
             +L R + P ++ +  TF    + +Y+    + GG+LF +L ++        + A    
Sbjct: 208 EHVLTRGQ-PNVIKVHDTFVDENDNIYIFEDLVAGGDLFSYLAKKDCLAPISETEALVIV 266

Query: 482 SELLLALDSLHKMDVVYRDLKPENILL---DSQGHIALCDFGLCKLNMKDNEKTSTFCGT 538
            ++L AL  LH   +V+RDLK +NILL   +    I L DFG+ K       +  T  GT
Sbjct: 267 YQILQALKFLHSKGIVHRDLKLDNILLCTPEPCSRIVLADFGIAKDLPSTRVRMHTIVGT 326

Query: 539 PEYLAPEV-----------------LLGKGYTKVVDWWTLGVLLYEMLTGLPPYY-DENV 580
           PEY APEV                 +  +GY    D W+LGV+ + MLTG+ P+Y D   
Sbjct: 327 PEYCAPEVGFRVDRNSYRNFSRTASMEQQGYDFKCDLWSLGVMTHIMLTGISPFYGDGTE 386

Query: 581 SEMYKKILKSPLIFPD----GMDPDAKDLLKRLLNRDPNRRL 618
           + + + +    L F      G+   AK  +++LL  +  +R+
Sbjct: 387 ASIIRNVKIGKLNFGTKQWVGVSDTAKSFVRQLLEVNAEKRM 428

>YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine protein
           kinase required for cell cycle arrest and for cell
           fusion during mating, member of the MAP kinase family of
           protein kinases [1062 bp, 353 aa]
          Length = 353

 Score = 92.8 bits (229), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 81/299 (27%), Positives = 138/299 (46%), Gaps = 54/299 (18%)

Query: 376 DFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECP 435
           DF+L ++LG+G+YG V     K T +I A+K I           + TL E  IL   +  
Sbjct: 12  DFQLKSLLGEGAYGVVCSATHKPTGEIVAIKKIEP--FDKPLFALRTLREIKILKHFKHE 69

Query: 436 FIVPLKFTFQTPE------KLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALD 489
            I+ + F  Q P+      ++Y++   +      H +    +      +++  + L A+ 
Sbjct: 70  NIITI-FNIQRPDSFENFNEVYIIQELMQTD--LHRVISTQMLSDDHIQYFIYQTLRAVK 126

Query: 490 SLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKL---NMKDN-EKTSTFCGTPEYL--- 542
            LH  +V++RDLKP N+L++S   + +CDFGL ++   +  DN E T    G  EY+   
Sbjct: 127 VLHGSNVIHRDLKPSNLLINSNCDLKVCDFGLARIIDESAADNSEPTGQQSGMTEYVATR 186

Query: 543 ---APEVLLGKG-YTKVVDWWTLGVLLYEMLTGLP--------------------PYYDE 578
              APEV+L    Y++ +D W+ G +L E+    P                    P+ D 
Sbjct: 187 WYRAPEVMLTSAKYSRAMDVWSCGCILAELFLRRPIFPGRDYRHQLLLIFGIIGTPHSDN 246

Query: 579 NV----SEMYKKILKSPLIFPDG--------MDPDAKDLLKRLLNRDPNRRLGANGADE 625
           ++    S   ++ +KS  ++P          ++P   DLL+R+L  DP +R+ A  A E
Sbjct: 247 DLRCIESPRAREYIKSLPMYPAAPLEKMFPRVNPKGIDLLQRMLVFDPAKRITAKEALE 305

>Scas_720.94
          Length = 1683

 Score = 96.3 bits (238), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 80/275 (29%), Positives = 123/275 (44%), Gaps = 41/275 (14%)

Query: 383  LGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTL-----AERTILARVECPFI 437
            +G G++G V      D  +I A+K I+    +  S+ +  +      E T+L  +  P I
Sbjct: 1367 IGGGTFGTVYSAVNLDNGEILAVKEIK----IQDSKTMKKIFPLVKEEMTVLEMLNHPNI 1422

Query: 438  VPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVV 497
            V         +K+ + +    GG +   L+   I D    + Y  ELL  L  LH+  VV
Sbjct: 1423 VQYYGVEVHRDKVNIFMEYCEGGSMASLLEHGRIEDEMVTQVYTLELLEGLAYLHQAGVV 1482

Query: 498  YRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTST----------------------- 534
            +RD+KPENILLD  G I   DFG  +   K+  K +                        
Sbjct: 1483 HRDIKPENILLDFNGIIKYVDFGAARKIAKNGTKVTNINSKSKDDDEPDEKDTEGGANSV 1542

Query: 535  --FCGTPEYLAPEVLLG-KGYTKVV--DWWTLGVLLYEMLTGLPPY--YDENVSEMYKKI 587
                GTP Y+APE + G K  TK    D W+ G ++ EM+TG  P+   D   + +Y   
Sbjct: 1543 HDMLGTPMYMAPESITGYKNKTKFGSDDIWSFGCVVLEMITGRRPWANLDNEWAIIYHVA 1602

Query: 588  L-KSP-LIFPDGMDPDAKDLLKRLLNRDPNRRLGA 620
              ++P L +P+ + P  +  L+R L +DP +R  A
Sbjct: 1603 AGQTPQLPYPNEVSPAGRRFLQRCLVQDPIKRATA 1637

>KLLA0D07304g 623352..624749 some similarities with sp|P32491
           Saccharomyces cerevisiae YPL140c MKK2 protein kinase of
           the map kinase kinase (MEK) family, hypothetical start
          Length = 465

 Score = 93.6 bits (231), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 62/207 (29%), Positives = 99/207 (47%), Gaps = 10/207 (4%)

Query: 375 DDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVEC 434
           +  + L +LG+G+ G V + + ++  KI+ALK I  + I           E       + 
Sbjct: 177 EQIDTLGILGEGTGGSVTKCKLRNGSKIFALKTI--ATIENDGSEKQIFRELQFNKSCKS 234

Query: 435 PFIVPLKFTFQTPEK--LYLVLACINGGEL----FHHLQREGIFDISRARFYASELLLAL 488
            FIV     F   E   +++ +  + G  L     H L + G          A  +L  L
Sbjct: 235 DFIVRYYGMFACEETSTIFIAMEYMGGRSLDSVYKHLLSKGGRIGEKVLGKIAESVLRGL 294

Query: 489 DSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLL 548
             LH+  +++RD+KP+NIL +  G I LCDFG+    +  N   +TF GT  Y+APE + 
Sbjct: 295 FYLHERKIIHRDIKPQNILFNEIGQIKLCDFGVSGEAV--NSLATTFTGTSYYMAPERIQ 352

Query: 549 GKGYTKVVDWWTLGVLLYEMLTGLPPY 575
           G+ Y+   D W+LG+ L E+  G  P+
Sbjct: 353 GQPYSVTSDVWSLGLTLLEVAQGHSPF 379

>CAGL0M03729g complement(420316..422901) similar to sp|P48562
           Saccharomyces cerevisiae YNL298w CLA4, start by
           similarity
          Length = 861

 Score = 95.1 bits (235), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 59/204 (28%), Positives = 97/204 (47%), Gaps = 13/204 (6%)

Query: 440 LKFTFQTPEKLYLVLACINGGELFHHLQREGI-------FDISRARFYASELLLALDSLH 492
           L+   +T + L++V+  + GG L   ++               +  +   E    L  LH
Sbjct: 645 LEAYLKTEDDLWVVMEYMEGGSLTDIIENSPTNGSAYSPLSEPQIAYIVRETCKGLKFLH 704

Query: 493 KMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGY 552
             ++++RD+K +N+LLD++  + + DFG C        K +T  GTP ++APEV+  K Y
Sbjct: 705 DKNIIHRDIKSDNVLLDTKARVKITDFGFCAKLTDQRSKRATMVGTPYWMAPEVVKQKEY 764

Query: 553 TKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKS---PLIFPDGMDPDAKDLLKRL 609
              VD W+LG++  EML G PPY +E+  +    I  +    L  P  +  + K  L   
Sbjct: 765 DAKVDVWSLGIMAIEMLEGEPPYLNEDPLKALYLIATNGTPKLKHPQSLSLEIKRFLSVC 824

Query: 610 LNRDPNRRLGANGADEIKNHKFFN 633
           L  D   R      +E+ +H FFN
Sbjct: 825 LCVDVKYRA---STEELLHHSFFN 845

>CAGL0M10153g complement(1010688..1013291) some similarities with
           sp|Q03497 Saccharomyces cerevisiae YHL007c ser/thr
           protein kinase of the pheromone pathway, hypothetical
           start
          Length = 867

 Score = 94.7 bits (234), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 75/276 (27%), Positives = 130/276 (47%), Gaps = 33/276 (11%)

Query: 375 DDFELLTVLGKGSYGKV-MQVRKKDTQKIYALKAI------RKSYIVAKSEVIHTLAERT 427
           D FE    +G+G+ G V +   + D  +  A+K +      +K  IV +  V+ +   + 
Sbjct: 564 DKFETYLKIGQGASGGVYLSHSRSDKSQCVAIKQMNLEKQPKKELIVNEIMVMSSSKHQN 623

Query: 428 ILARVECPFIVPLKFTFQTPEKLYLVLACINGGEL-----FHHLQREGIFDISRARFYAS 482
           I+  ++         ++ +   L++V+  + GG L     +  L    I  + R      
Sbjct: 624 IVNYID---------SYLSGLDLWVVMEYMEGGCLTDVVTYCVLTEGQIGAVCR------ 668

Query: 483 ELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYL 542
           E+L  L+ LH   V++RD+K +N+LL   G I L DFG C        K +T  GTP ++
Sbjct: 669 EVLQGLEFLHSKGVLHRDIKSDNVLLSMNGDIKLTDFGFCAQVNDTVIKRTTMVGTPYWM 728

Query: 543 APEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKIL---KSPLIFPDGMD 599
           APE++  K Y   VD W+LG+++ EM+ G PPY +E        I    +  +  PD + 
Sbjct: 729 APEIVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGRPEVQEPDRLS 788

Query: 600 PDAKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDL 635
            D K+ + + L    + R  ++   E+  HKF  ++
Sbjct: 789 KDFKEFIDKCLAVTVSERAESS---ELLQHKFITEV 821

>CAGL0H07535g 736241..737137 highly similar to sp|P00546
           Saccharomyces cerevisiae YBR160w CDC28, start by
           similarity
          Length = 298

 Score = 90.5 bits (223), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 83/297 (27%), Positives = 141/297 (47%), Gaps = 44/297 (14%)

Query: 376 DFELLTVLGKGSYG---KVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTI--LA 430
           +++ L  +G+G+YG   K + +R    Q++ ALK IR   + ++ E + + A R I  L 
Sbjct: 7   NYKRLEKVGEGTYGVVYKALDLRPGKGQRVVALKKIR---LESEDEGVPSTAIREISLLK 63

Query: 431 RVECPFIVPL-KFTFQTPEKLYLVLACINGG--ELFHHLQREGIFDISRARFYASELLLA 487
            ++   IV L         KLYLVL  ++         + ++    ++  + +  +L   
Sbjct: 64  ELKDDNIVRLYDIVHSDAHKLYLVLEFLDLDLKRYMESIPKDQPLGVNIIKKFMVQLCKG 123

Query: 488 LDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVL 547
           +   H   +++RDLKP+N+L+D +G++ L DFGL +         +    T  Y APEVL
Sbjct: 124 IAYCHAHRILHRDLKPQNLLIDKEGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAPEVL 183

Query: 548 L-GKGYTKVVDWWTLGVLLYEMLTGLPPYY-DENVSEMYK--KILKSP--LIFPD----- 596
           L GK Y+  VD W++G +  EM    P +  D  + +++K  +IL +P   ++PD     
Sbjct: 184 LGGKQYSTGVDTWSIGCIFAEMCNRKPIFSGDSEIDQIFKIFRILGTPSEAVWPDIVYLP 243

Query: 597 -------------------GMDPDAKDLLKRLLNRDPNRRLGANGADEIKNHKFFND 634
                               +DP   DLL +LL  DP  R+ A  A    NH +F++
Sbjct: 244 DFKPSFPQWRRKDLAEVVPSLDPHGIDLLDKLLAYDPINRISARRA---ANHPYFHE 297

>Kwal_56.23841
          Length = 432

 Score = 92.8 bits (229), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 74/282 (26%), Positives = 130/282 (46%), Gaps = 49/282 (17%)

Query: 380 LTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERT-----ILARVEC 434
           L  +G G++G V       T +  A+K I K +  A       LA+RT     +L  +  
Sbjct: 26  LNPVGMGAFGLVCSANDTYTNQSVAIKKIMKPFSTA------VLAKRTYRELKLLKHLRH 79

Query: 435 PFIVPLKFTFQTP-EKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHK 493
             ++ L+  F +P E +Y V   + G +L H L +    +    +++  ++L  L  +H 
Sbjct: 80  ENLICLEDIFLSPLEDIYFVTE-LQGTDL-HRLLQTRPLEKQFVQYFLYQILRGLKYVHS 137

Query: 494 MDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLG-KGY 552
             V++RDLKP NIL++    + +CDFGL ++    + + + +  T  Y APE++L  + Y
Sbjct: 138 AGVIHRDLKPSNILINENCDLKICDFGLARIQ---DPQMTGYVSTRYYRAPEIMLTWQKY 194

Query: 553 TKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKIL------------------------ 588
              VD W+ G +  EM+ G P +  ++    +  I                         
Sbjct: 195 NVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPEDVINTICSVNTLKFVT 254

Query: 589 ----KSPLIFPD---GMDPDAKDLLKRLLNRDPNRRLGANGA 623
               + P+ F +    ++PDA DLL+++L  DPN+R+ A  A
Sbjct: 255 SLPHRDPVPFSERFKNVEPDAVDLLEKMLVFDPNKRITAADA 296

>ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C
           (MKK2) - SH] complement(557738..559312) [1575 bp, 524
           aa]
          Length = 524

 Score = 93.2 bits (230), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 63/208 (30%), Positives = 103/208 (49%), Gaps = 11/208 (5%)

Query: 375 DDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVEC 434
           D  E L VLG+G+ G V + + +   KI+ALK I  +    +        E       + 
Sbjct: 234 DQIEELGVLGEGAGGSVTKCKLRHGSKIFALKTI-TTLTTDQESQKQIFRELQFNKSCKS 292

Query: 435 PFIVPL--KFTFQTPEKLYLVLACINGGEL---FHHLQREG--IFDISRARFYASELLLA 487
            +IV     FT +    +Y+ +  + G  L   + HL + G  + +    +  A  +L  
Sbjct: 293 DYIVRYYGMFTDEEHSSIYIAMEYMGGRSLDAIYKHLLKHGGRVGEKVLGKI-AESVLRG 351

Query: 488 LDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVL 547
           L  LH+  +++RD+KP+NILL+  G + LCDFG+    +  N   +TF GT  Y+APE +
Sbjct: 352 LSYLHQRKIIHRDIKPQNILLNEAGQVKLCDFGVSGEAV--NSLATTFTGTSYYMAPERI 409

Query: 548 LGKGYTKVVDWWTLGVLLYEMLTGLPPY 575
            G+ Y+   D W+LG+ L E+     P+
Sbjct: 410 QGQPYSVTSDVWSLGLTLLEVAQAHFPF 437

>Scas_707.34
          Length = 905

 Score = 94.4 bits (233), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 89/328 (27%), Positives = 144/328 (43%), Gaps = 70/328 (21%)

Query: 372 VGIDDFELLTVLGKGSYGKVMQVR------------KKDTQKI-----YALKAIRKSYIV 414
           VG D + +   +GKGS+  V +                D+  I     +A+K + +S + 
Sbjct: 33  VGSDRYIVDKEIGKGSFATVHRAHLITPTSPHLHQSVVDSSSINNPTCFAIKIVPRSKLK 92

Query: 415 AKSEVIHTLAERTILARVECPFIVPLKFTFQTPEKLYLVLACINGGELF----------- 463
            K  + +   E  IL ++  P IV L    +T +  YL++   + G+L            
Sbjct: 93  NKKLLENLEIEIAILKKISHPHIVKLIDFERTSKDFYLIMEYCSLGDLTFLIKKRQQLIK 152

Query: 464 HHLQREGIFD-----------ISRARF--YASELLLALDSLHKMDVVYRDLKPENILLDS 510
           +H   E IF            + +A    Y  +L  AL  L   ++V+RD+KP+N+LL +
Sbjct: 153 NHPLLEKIFKKYPPPNEKYNGLHKAFILNYLQQLSSALKFLRSKNLVHRDIKPQNLLLSA 212

Query: 511 Q-------------GHIAL--------CDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLG 549
                         G + +         DFG  +  + +     T CG+P Y+APE+L  
Sbjct: 213 PLINYNDPKSFHDLGFVGIYNLPILKIADFGFARF-LPNTSMAETLCGSPLYMAPEILNY 271

Query: 550 KGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSP--LIFPD--GMDPDAKDL 605
           + Y    D W++G +LYEM  G PP+   N  E+YKKI K+   + FP    +D + K L
Sbjct: 272 QKYNAKADLWSVGTVLYEMCYGNPPFKASNHLELYKKIKKANDLIYFPTYIEIDNNLKSL 331

Query: 606 LKRLLNRDPNRRLGANGADEIKNHKFFN 633
           + +LL  DP  R+     DE  N++  N
Sbjct: 332 ISKLLTFDPQERI---EFDEFFNNELVN 356

>YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase
            kinase kinase (MAPKKK) with strong similarity to Ssk2p,
            participates in the high-osmolarity signal transduction
            pathway [3996 bp, 1331 aa]
          Length = 1331

 Score = 94.0 bits (232), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 78/264 (29%), Positives = 113/264 (42%), Gaps = 24/264 (9%)

Query: 381  TVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAER-TILARVECPFIVP 439
            + +G G++G+V      +  +I A+K I+        ++   + E  T+L  +  P IV 
Sbjct: 1038 SFIGGGTFGQVYSAINLENGEILAVKEIKIHDTTTMKKIFPLIKEEMTVLEMLNHPNIVQ 1097

Query: 440  LKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVYR 499
                    +K+ + +    GG L   L    I D    + Y  ELL  L  LH+  VV+R
Sbjct: 1098 YYGVEVHRDKVNIFMEYCEGGSLASLLDHGRIEDEMVTQVYTFELLEGLAYLHQSGVVHR 1157

Query: 500  DLKPENILLDSQGHIALCDFGLCKLNMKDNEKT----------------STFCGTPEYLA 543
            D+KPENILLD  G I   DFG  +  +    +T                +   GTP Y+A
Sbjct: 1158 DIKPENILLDFNGIIKYVDFGTARTVVGSRTRTVRNAAVQDFGVETKSLNEMMGTPMYMA 1217

Query: 544  PEVLLG---KGYTKVVDWWTLGVLLYEMLTGLPPY--YDENVSEMYKKILKSPLIFP--D 596
            PE + G   KG     D W LG ++ EM TG  P+   D   + MY          P  D
Sbjct: 1218 PETISGSAVKGKLGADDVWALGCVVLEMATGRRPWSNLDNEWAIMYHVAAGRIPQLPNRD 1277

Query: 597  GMDPDAKDLLKRLLNRDPNRRLGA 620
             M    +  L+R L +DP  R  A
Sbjct: 1278 EMTAAGRAFLERCLVQDPTMRATA 1301

>CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 521

 Score = 92.8 bits (229), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 103/204 (50%), Gaps = 11/204 (5%)

Query: 377 FELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTI-LARVECP 435
           F +   +G+G++G V + +     ++ A+K +    +    E +  LA+    LA ++ P
Sbjct: 5   FVIENCIGRGNFGDVYKAKDTWLNEVVAVKVVN---LENSEEEVELLAQEIFFLAELKSP 61

Query: 436 FIVPLKFTFQTPEKLYLVLACINGG---ELFHHLQREGIFDISRARFYASELLLALDSLH 492
           ++     T      +++ +    GG   +L  +    G+ +  + RF   E+L  L  LH
Sbjct: 62  YVTNYIATVVEDVSMWIAMEYCGGGSVGDLLKYHYTSGLPE-HKTRFITREILKGLSYLH 120

Query: 493 KMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLL--GK 550
               ++RD+K  NILL  +G + L DFG+    +  + +  TF GTP ++APE++    +
Sbjct: 121 SQRKIHRDIKAANILLTDEGKVKLSDFGVSG-KLLSSFRRDTFVGTPYWMAPEIVAHDSE 179

Query: 551 GYTKVVDWWTLGVLLYEMLTGLPP 574
           GY +  D W+LG+ + EML G PP
Sbjct: 180 GYDERADIWSLGITVIEMLRGSPP 203

>Scas_711.25
          Length = 1515

 Score = 94.0 bits (232), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 79/267 (29%), Positives = 129/267 (48%), Gaps = 24/267 (8%)

Query: 382  VLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVPLK 441
            ++GKGS+G V       T ++ A+K +      ++ E I +  E     R E   +  L 
Sbjct: 1219 MIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQDEAIISTVE---ALRSEVSTLKDLD 1275

Query: 442  -------FTFQTPEKLY-LVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHK 493
                     F+  + +Y L L  + GG +   ++  G FD    R   +++L  L  LH 
Sbjct: 1276 HLNIVQYLGFENKDNIYSLFLEYVAGGSVGSLIRMYGRFDEPLIRHLNTQVLRGLAYLHS 1335

Query: 494  MDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTS--TFCGTPEYLAPEVLLGK- 550
              +++RD+K +N+LLD  G   + DFG+ + + KD    S  T  GT  ++APE++  K 
Sbjct: 1336 RGILHRDMKADNLLLDQDGVCKISDFGISRKS-KDIYSNSDMTMRGTVFWMAPEMVDTKQ 1394

Query: 551  GYTKVVDWWTLGVLLYEMLTGLPPYYD-ENVSEMYK--KILKSPLIFPDGM---DPDAKD 604
            GY+  VD W+LG ++ EM  G  P+ + E V+ M+K  K   +P I PD +     + +D
Sbjct: 1395 GYSAKVDIWSLGCIVLEMFAGKRPWSNYEVVAAMFKIGKSKSAPPIPPDTLPLISQNGRD 1454

Query: 605  LLKRLLNRDPNRRLGANGADEIKNHKF 631
             L      DP+ R     AD + +H F
Sbjct: 1455 FLDACFEIDPDNRP---TADNLLSHPF 1478

>YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase,
           required for metaphase DNA-damage checkpoint [1584 bp,
           527 aa]
          Length = 527

 Score = 92.4 bits (228), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 78/271 (28%), Positives = 133/271 (49%), Gaps = 38/271 (14%)

Query: 374 IDDFELLTVLGKGSYGKVMQVR-KKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARV 432
           I D  L   +G+G++  V     + D   I A+K I       K  +      + ++ + 
Sbjct: 12  IKDVVLGDTVGQGAFACVKNAHLQMDPSIILAVKFIHVP-TCKKMGLSDKDITKEVVLQS 70

Query: 433 EC---PFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALD 489
           +C   P ++ L     + E ++++L   +GG+LF  ++ +   D   A+FY  +L+ A++
Sbjct: 71  KCSKHPNVLRLIDCNVSKEYMWIILEMADGGDLFDKIEPDVGVDSDVAQFYFQQLVSAIN 130

Query: 490 SLH-KMDVVYRDLKPENILLDSQGHIALCDFGLC-KLNMKDNEKTSTF--CGTPEYLAPE 545
            LH +  V +RD+KPENILLD  G++ L DFGL  +   KD     +    G+P Y+APE
Sbjct: 131 YLHVECGVAHRDIKPENILLDKNGNLKLADFGLASQFRRKDGTLRVSMDQRGSPPYMAPE 190

Query: 546 VLLGKG--YTKVVDWWTLGVLLYEMLTGLPP------------YYDENVSEM----YKKI 587
           VL  +   Y    D W++G+LL+ +LTG  P            ++ EN   +    + KI
Sbjct: 191 VLYSEEGYYADRTDIWSIGILLFVLLTGQTPWELPSLENEDFVFFIENDGNLNWGPWSKI 250

Query: 588 LKSPLIFPDGMDPDAKDLLKRLLNRDPNRRL 618
             + L           +LL+++L  DPN+R+
Sbjct: 251 EFTHL-----------NLLRKILQPDPNKRV 270

>YGL179C (TOS3) [1812] chr7 complement(163413..165095)
           Serine/threonine protein kinase with similarity to Elm1p
           and Kin82p [1683 bp, 560 aa]
          Length = 560

 Score = 92.8 bits (229), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 73/250 (29%), Positives = 118/250 (47%), Gaps = 28/250 (11%)

Query: 374 IDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAI-----RKSY-IVAKSEVIHTLAERT 427
           +++FE+L  LG G YGKV   R   T  + A+K +     R  Y +  K E      E  
Sbjct: 47  LNNFEILATLGNGQYGKVKLARDLGTGALVAIKILNRFEKRSGYSLQLKVENPRVNQEIE 106

Query: 428 ILARVECPFIVPLKFTFQTPE--KLYLVLACINGG------ELFHHLQREG--IFDISRA 477
           ++ R     +V L      PE  K+YLVL   + G      E    ++  G  I    ++
Sbjct: 107 VMKRCHHENVVELYEILNDPESTKVYLVLEYCSRGPVKWCPENKMEIKAVGPSILTFQQS 166

Query: 478 RFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLC------KLNMKDNEK 531
           R    +++  L+ LH   + +RD+KP N+L+ S G + + DFG+         N++ + +
Sbjct: 167 RKVVLDVVSGLEYLHSQGITHRDIKPSNLLISSNGTVKISDFGVAMSTATGSTNIQSSHE 226

Query: 532 T---STFCGTPEYLAPEVL-LGKGY--TKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYK 585
               S   GTP + APE+    K Y  +  +D W+LGV +Y +L G  P+   +  E++ 
Sbjct: 227 QLLKSRALGTPAFFAPELCSTEKEYSCSSAIDIWSLGVTIYCLLFGKLPFNANSGLELFD 286

Query: 586 KILKSPLIFP 595
            I+  PL FP
Sbjct: 287 SIINKPLEFP 296

>Kwal_26.7355
          Length = 1446

 Score = 93.6 bits (231), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 80/267 (29%), Positives = 130/267 (48%), Gaps = 24/267 (8%)

Query: 382  VLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVPLK 441
            ++GKGS+G V       T ++ A+K +      ++ E   ++ E     R E   +  L 
Sbjct: 1151 MIGKGSFGSVFLGLNVTTGEMIAVKQVEVPRYGSQDETTLSVLE---ALRSEVATLKDLD 1207

Query: 442  FT-------FQTPEKLY-LVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHK 493
             T       F+    +Y L L  + GG +   ++  G FD +  RF A ++L  L  LH 
Sbjct: 1208 HTNIVQYLGFENKNYVYSLFLEYVAGGSVGSLIRLYGKFDENLIRFLAVQVLRGLSYLHS 1267

Query: 494  MDVVYRDLKPENILLDSQGHIALCDFGLCKL--NMKDNEKTSTFCGTPEYLAPEVLLGK- 550
              +++RD+K +N+LLD  G   + DFG+ K   N+  N    T  GT  ++APE++  K 
Sbjct: 1268 KKILHRDMKADNLLLDVDGICKISDFGISKKSNNIYSNSDM-TMRGTVFWMAPEMVDTKQ 1326

Query: 551  GYTKVVDWWTLGVLLYEMLTGLPPYYD-ENVSEMYK--KILKSPLIFPDG---MDPDAKD 604
            GY+  VD W+LG ++ EM  G  P+ + E V+ M+K  K   +P I  D    +  + K+
Sbjct: 1327 GYSAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKFKSAPPIPEDTQKIISAEGKE 1386

Query: 605  LLKRLLNRDPNRRLGANGADEIKNHKF 631
             L      +P +R     ADE+ +H F
Sbjct: 1387 FLDACFEINPEKRP---TADELLSHPF 1410

>CAGL0M11748g 1167306..1168649 highly similar to sp|P32485
           Saccharomyces cerevisiae YLR113w HOG1, start by
           similarity
          Length = 447

 Score = 91.7 bits (226), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 78/282 (27%), Positives = 130/282 (46%), Gaps = 49/282 (17%)

Query: 380 LTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERT-----ILARVEC 434
           L  +G G++G V       T +  A+K I K +  A       LA+RT     +L  +  
Sbjct: 26  LNPVGMGAFGLVCSATDTLTNQQVAIKKIMKPFATA------VLAKRTYRELKLLKHLRH 79

Query: 435 PFIVPLKFTFQTP-EKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHK 493
             ++ L+  F +P E +Y V   + G +L H L +    +    +++  ++L  L  +H 
Sbjct: 80  ENLICLQDIFLSPLEDIYFVTE-LQGTDL-HRLLQTRPLEKQFVQYFHYQILRGLKYVHS 137

Query: 494 MDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLG-KGY 552
             VV+RDLKP NIL++    + +CDFGL ++    + + + +  T  Y APE++L  + Y
Sbjct: 138 AGVVHRDLKPSNILINENCDLKICDFGLARIQ---DPQMTGYVSTRYYRAPEIMLTWQKY 194

Query: 553 TKVVDWWTLGVLLYEMLTGLPPY-----------------------YDENVSEMYKKILK 589
              VD W+ G +  EM+ G P +                        D   SE   K + 
Sbjct: 195 DVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPSDVIDTICSENTLKFVT 254

Query: 590 S-----PLIFPD---GMDPDAKDLLKRLLNRDPNRRLGANGA 623
           S     P+ F +    ++PDA DLL+++L  DP +R+ A  A
Sbjct: 255 SLPHRDPIPFSERFKTVEPDAVDLLEKMLVFDPKKRITAADA 296

>KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces
           cerevisiae YNL298w CLA4 ser/thr protein kinase, start by
           similarity
          Length = 879

 Score = 92.8 bits (229), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 98/204 (48%), Gaps = 13/204 (6%)

Query: 440 LKFTFQTPEKLYLVLACINGGELFHHLQR-------EGIFDISRARFYASELLLALDSLH 492
           L+   +T + L++V+  + GG L   ++        +      +  +   E    L  LH
Sbjct: 663 LEAYLKTEDDLWVVMEYMEGGSLTDIIENSPTGSSGQSPLTEPQIAYIVRETCQGLKFLH 722

Query: 493 KMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGY 552
              +++RD+K +N+LLD++G + + DFG C        K +T  GTP ++APEV+  + Y
Sbjct: 723 DKHIIHRDIKSDNVLLDTRGRVKITDFGFCAKLTDKRSKRATMVGTPYWMAPEVVKQREY 782

Query: 553 TKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKS---PLIFPDGMDPDAKDLLKRL 609
            + VD W+LG++  EML   PPY +E   +    I  +    L  P+ +  + K  L   
Sbjct: 783 DEKVDVWSLGIMTIEMLESEPPYLNEEPLKALYLIATNGTPKLKHPEYLSLEIKRFLSVC 842

Query: 610 LNRDPNRRLGANGADEIKNHKFFN 633
           L  D   R      +E+ +H FFN
Sbjct: 843 LCVDVKYRA---STEELLHHSFFN 863

>AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH]
           (807470..808831) [1362 bp, 453 aa]
          Length = 453

 Score = 90.9 bits (224), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 78/282 (27%), Positives = 130/282 (46%), Gaps = 49/282 (17%)

Query: 380 LTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERT-----ILARVEC 434
           L  +G G++G V       TQ+  A+K I K +  A       LA+RT     +L  +  
Sbjct: 32  LNPVGMGAFGLVCSAVDTYTQQPVAIKKIMKPFSTA------VLAKRTYRELKLLKHLRH 85

Query: 435 PFIVPLKFTFQTP-EKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHK 493
             ++ L+  F +P E +Y V   + G +L H L +    +    +++  ++L  L  +H 
Sbjct: 86  ENLICLEDIFLSPLEDIYFVTE-LQGTDL-HRLLQTRPLEKQFLQYFLYQILRGLKYVHS 143

Query: 494 MDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLG-KGY 552
             V++RDLKP NIL++    + +CDFGL ++    + + + +  T  Y APE++L  + Y
Sbjct: 144 AGVIHRDLKPSNILINENCDLKICDFGLARIQ---DPQMTGYVSTRYYRAPEIMLTWQKY 200

Query: 553 TKVVDWWTLGVLLYEMLTGLPPY-----------------------YDENVSEMYKKILK 589
              VD W+ G +  EM+ G P +                        D   SE   K + 
Sbjct: 201 NVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVIDTICSENTLKFVT 260

Query: 590 S-----PLIFPD---GMDPDAKDLLKRLLNRDPNRRLGANGA 623
           S     P+ F +    + PDA DLL+++L  DP +R+ A  A
Sbjct: 261 SLPHRDPVPFTERFKNLKPDAVDLLEKMLVFDPKKRITAGDA 302

>Kwal_23.5290
          Length = 819

 Score = 92.0 bits (227), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 78/147 (53%), Gaps = 7/147 (4%)

Query: 440 LKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRA-------RFYASELLLALDSLH 492
           L+   +T + L++V+  + GG L   ++       S +        +   E    L  LH
Sbjct: 603 LEAYLKTEDDLWVVMEYMEGGSLTDLIENSPANGSSHSPLTEPQIAYIVRETCQGLKFLH 662

Query: 493 KMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGY 552
              +++RD+K +N+LLD++  + + DFG C        K +T  GTP ++APEV+  + Y
Sbjct: 663 DKHIIHRDIKSDNVLLDNRARVKITDFGFCAKLTDKRSKRATMVGTPYWMAPEVVKQREY 722

Query: 553 TKVVDWWTLGVLLYEMLTGLPPYYDEN 579
            + VD W+LG++  EML G PPY +E+
Sbjct: 723 DEKVDVWSLGIMTIEMLEGEPPYLNED 749

>AFL217C [2978] [Homologous to ScYJL128C (PBS2) - SH] (30765..32840)
           [2076 bp, 691 aa]
          Length = 691

 Score = 92.0 bits (227), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 87/308 (28%), Positives = 147/308 (47%), Gaps = 31/308 (10%)

Query: 336 NSASN-----FRLFNHQWINLKQG----LGTINLT---VDFKPSYSKPVGIDDFELLTVL 383
           NS +N     F +F+ +++++K G     G ++L+   VDF    S  + +D+ E L  L
Sbjct: 325 NSGTNSNGGLFAVFS-KYVDIKSGSLNFAGKLSLSSQGVDFSNGSSFRITLDELEFLEEL 383

Query: 384 GKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVPLKFT 443
           G G+YG V +V  K T  + A+K +R    + +S+    L E  +L + + P+IV     
Sbjct: 384 GHGNYGTVSKVLHKPTNIMMAMKEVR--LELDESKFRQILMELEVLHKCQSPYIVDFYGA 441

Query: 444 FQTPEKLYLVLACINGGELFHHLQREGIFDISRARFY--ASELLLALDSLHKM-DVVYRD 500
           F     +Y+ +  ++GG L        I  I   +       ++  L  L  + ++++RD
Sbjct: 442 FFIEGAVYMCMEFMDGGSLDKSYDPHEIGGIEEPQLALITESVIRGLKELKDVHNIIHRD 501

Query: 501 LKPENILLDS-QGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLG-----KGYTK 554
           +KP NIL  + QG + LCDFG+    +    +T+  C +  Y+APE +         Y+ 
Sbjct: 502 VKPTNILCSATQGTVKLCDFGVSGNLVASLARTNIGCQS--YMAPERIKSLNPDKATYSV 559

Query: 555 VVDWWTLGVLLYEMLTGLPPY----YDENVSEMYKKILKSPLIFP-DGMDPDAKDLLKRL 609
             D W+LG+ + EM  G  PY    YD   S++   +   P   P D    DA+D ++  
Sbjct: 560 QSDIWSLGLSIVEMALGAYPYPPETYDNIFSQLSAIVDGPPPRLPKDTFSSDAQDFVRLC 619

Query: 610 LNRDPNRR 617
           L + P RR
Sbjct: 620 LQKIPERR 627

>Kwal_55.20326
          Length = 750

 Score = 92.0 bits (227), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 70/244 (28%), Positives = 115/244 (47%), Gaps = 11/244 (4%)

Query: 381 TVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVPL 440
           T +  G      +V+K+  Q      A++ S  V +  V     E  +L  ++   IV  
Sbjct: 494 TAVAAGVVSVPDEVKKQYNQNANG-SAVKNSSQVHRKMVDALQHEMGLLKELQHENIVTY 552

Query: 441 KFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVYRD 500
             + Q    L + L  + GG +   L   G F+    R +  ++L+ L  LH+ D+++RD
Sbjct: 553 YGSSQEGGNLNIFLEYVPGGSVSSMLNSYGPFEEPLIRNFTRQILIGLSYLHRKDIIHRD 612

Query: 501 LKPENILLDSQGHIALCDFGLCK----LNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKVV 556
           +K  NIL+D +G + + DFG+ K    LN + N++ S   G+  ++APEV+     TK  
Sbjct: 613 IKGANILIDIKGCVKITDFGISKKLSPLNQQQNKRAS-LQGSVYWMAPEVVKQVVTTKKA 671

Query: 557 DWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDG---MDPDAKDLLKRLLNRD 613
           D W++G ++ EM TG  P+ D   S+M          FPD       +AKD L +    D
Sbjct: 672 DIWSVGCVIIEMFTGKHPFPD--FSQMQAIFKIGTNTFPDSPSWSSNEAKDFLLKTFELD 729

Query: 614 PNRR 617
             +R
Sbjct: 730 YRKR 733

>ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH]
           (146098..147402) [1305 bp, 434 aa]
          Length = 434

 Score = 90.1 bits (222), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 88/325 (27%), Positives = 142/325 (43%), Gaps = 57/325 (17%)

Query: 361 TVDFKPSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVI 420
           T+  K ++S P     +E+L +LGKGSYG V+              AI+K   + + EV+
Sbjct: 60  TIYTKANFSIP---GHYEVLQMLGKGSYGTVVSAIDNLNANYPIRIAIKKITNIFQREVL 116

Query: 421 HTLAERTIL------ARVECPFIVPLKFTFQTP-EKLYLVLACINGGELFHHLQREGIFD 473
              A R +              ++ L+   + P + LY     I+  +L   +     F 
Sbjct: 117 LKRAIRELKFMHYFKGHKNIVSLINLEIVNEKPYDGLYCYQELIDY-DLARVIHSNVQFS 175

Query: 474 ISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCK------LNMK 527
               + +  ++L  +  +H  DV++RDLKP NIL    G + +CDFGL +       N K
Sbjct: 176 EFHIKHFTYQILCGVKYIHSADVIHRDLKPGNILCSISGQLKICDFGLARGISPLFTNTK 235

Query: 528 DNEKTSTFCGTPEYLAPEVLLG-KGYTKVVDWWTLGVLLYEMLTGLPPYYDEN----VSE 582
            +   + +  T  Y APE++L  K Y K +D W +G +L E     P +  ++    +SE
Sbjct: 236 TSNHITNYVATRWYRAPELILSHKRYNKSIDMWAIGCILAEFYGRKPIFMGQDSMHQISE 295

Query: 583 MYKKILKSPL------------------------------IFPDGMDPDAKDLLKRLLNR 612
           +  K+L +P                               I+P    PDA DL++RLL+ 
Sbjct: 296 IV-KVLGTPSRDTIIKYGSSRAYDIFCPPKPQYAKIPWAEIYPFA-GPDALDLIERLLDW 353

Query: 613 DPNRRLGANGA---DEIKNHKFFND 634
           DP+RRL    A   D +K+ +  ND
Sbjct: 354 DPDRRLTVEEAIEHDFVKSVRDVND 378

>CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces
           cerevisiae YOR231w MKK1 ser/thr protein kinase or
           sp|P32491 Saccharomyces cerevisiae YPL140c MKK2, start
           by similarity
          Length = 467

 Score = 90.5 bits (223), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 62/209 (29%), Positives = 102/209 (48%), Gaps = 11/209 (5%)

Query: 374 IDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEV-IHTLAERTILARV 432
           + + E   VLG+G+ G V + + +  +K++ALK I  + +    E     L E       
Sbjct: 177 LAEIETQGVLGEGAGGSVAKCKLRTGKKVFALKTI--NILNGDPEFQKQLLRELQFNKSF 234

Query: 433 ECPFIVPL--KFTFQTPEKLYLVLACINGGEL----FHHLQREGIFDISRARFYASELLL 486
           +  +IV     FT +    +Y+ +  + G  L       L R G          +  +L 
Sbjct: 235 KSEYIVRYFGMFTDEQNSSIYIAMEYMGGKSLEAIYKELLSRGGRISEKVLGKISEAVLR 294

Query: 487 ALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEV 546
            L  LH+  V++RD+KP+NILL+  G + LCDFG+    +  N   +TF GT  Y+APE 
Sbjct: 295 GLSYLHEKKVIHRDIKPQNILLNEDGQVKLCDFGVSGEAV--NSLATTFTGTSYYMAPER 352

Query: 547 LLGKGYTKVVDWWTLGVLLYEMLTGLPPY 575
           + G+ Y+   D W+LG+ + E+  G  P+
Sbjct: 353 IQGQPYSVTCDVWSLGLTILEVAQGHFPF 381

>Kwal_27.9773
          Length = 406

 Score = 89.7 bits (221), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 77/289 (26%), Positives = 138/289 (47%), Gaps = 45/289 (15%)

Query: 375 DDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVEC 434
           +++++L  +G+GS+G V +V    T ++   K I+  ++ +K E    ++E  IL++++ 
Sbjct: 17  NEYQVLEEIGRGSFGSVRKVVHVPTNRVLVRKEIKYGHMNSK-ERQQLISECAILSQLKH 75

Query: 435 PFIVPLKFTFQTPEKLYLVLA-CING--GELFHHLQREGIFDISRARFYAS-ELLLALDS 490
             IV         + LY  +  C NG   ++  H ++E  +   R  +    ++L+AL  
Sbjct: 76  ENIVEFYEWDSDVDVLYFYMEYCSNGDLSQMISHFKKERKYIPERLVWSVMVQVLVALYR 135

Query: 491 LH-------------KMD--------VVYRDLKPENILLD----------------SQGH 513
            H             +M         V++RDLKP NI L                 S+  
Sbjct: 136 CHYGSDLAPLETIYDRMKPPVKGSNVVIHRDLKPGNIFLSTERVPDARVALQAFDYSKIS 195

Query: 514 IALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLP 573
           + L DFGL K      E  +T+ GTP Y++PEVL+ + Y+ + D W+LG ++YEM T  P
Sbjct: 196 VKLGDFGLAKSLGASVEFATTYVGTPYYMSPEVLMDQPYSPLSDIWSLGCVIYEMCTLRP 255

Query: 574 PYYDENVSEMYKKILKSPL-IFPDGMDPDAKDLLKRLLNRDPNRRLGAN 621
           P+  +  +E+ ++I  +     PD    + + L++  +  DPN R  A+
Sbjct: 256 PFQAKTYTELQRRIKTAKFDRIPDYYSDELQMLIESCI--DPNLRTRAS 302

>Kwal_23.4276
          Length = 521

 Score = 90.5 bits (223), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 78/259 (30%), Positives = 113/259 (43%), Gaps = 57/259 (22%)

Query: 383 LGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPF------ 436
           LG G +  V +     T+  YA+K I K  +  K  +I    E  +L  V C        
Sbjct: 32  LGDGCFSVVKECMNILTRDRYAMKLISKKTVQGKLWLIQ--RELKLLKEVSCKIRELEQS 89

Query: 437 -------------IVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISR-ARFYAS 482
                        ++ L   F+TP+ + LV    + G+L+  +   G  DIS+  + Y +
Sbjct: 90  QVNCKDTFEGHHHVLQLFDYFETPKNIVLVTQLCSHGDLYEKIIEAGSLDISKQVKSYTA 149

Query: 483 ELLLALDSLHKMDVVYRDLKPENILL-----------------DSQGH-IALCDFGLC-K 523
            LL ALD LH+  VV+RD+K EN+L                  D   H + L DFGL  +
Sbjct: 150 CLLSALDFLHENKVVHRDVKAENVLFRCRVSELSEFSRRGSHYDHTSHDLILADFGLATR 209

Query: 524 LNMKDNEKTSTFCGTPEYLAPEVLLGKG--------------YTKVVDWWTLGVLLYEML 569
            + KD+E+     GT  Y+APEV+   G              Y   +D W LGVL Y M+
Sbjct: 210 CDSKDDERRECV-GTISYIAPEVVRCSGIARLAPSQAKLIKPYGASIDIWALGVLAYFMM 268

Query: 570 TGLPPYYDENVSEMYKKIL 588
           TG  P +D +  E  KK +
Sbjct: 269 TGYMP-FDCDTDEETKKCI 286

>CAGL0D02244g complement(229504..230967) similar to sp|P24719
           Saccharomyces cerevisiae YOR351c MEK1 ser/thr protein
           kinase, hypothetical start
          Length = 487

 Score = 90.1 bits (222), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 79/277 (28%), Positives = 131/277 (47%), Gaps = 47/277 (16%)

Query: 382 VLGKGSYGKVM-----------QVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILA 430
           V+G G++G V+           +  +K T K YA+K       + K ++     E  IL 
Sbjct: 158 VVGNGTFGYVLIAYMGIGAHSGKSSQKITPKCYAVK-------IVKMKLSKLDKEAKILM 210

Query: 431 RVECPFIVPL-KFTFQTPEKLYLVLACINGGELFHHLQR-EGIFDISR--ARFYASELLL 486
           ++  P I+ + K        LY+    I GG+LF +L + + +  IS+  A  +  ++L 
Sbjct: 211 QLNHPNIIKVFKTHTDKSNNLYIFQELIPGGDLFSYLAKGDCLMPISQTEALVFVYQILH 270

Query: 487 ALDSLHKMDVVYRDLKPENILLDSQ---GHIALCDFGLCKLNMKDNEKTSTFCGTPEYLA 543
           AL  LH   +V+RDLK +NILL +      I L DFG+ +       +  T  GTPEY A
Sbjct: 271 ALKYLHTKGIVHRDLKLDNILLCTPEPFTKIVLADFGIARTVTTMKSRMFTVVGTPEYCA 330

Query: 544 PEV-----------------LLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKK 586
           PEV                 L  +GY    D W+LGV+ + MLTG+ P+Y +   +   +
Sbjct: 331 PEVGFKANRKAYHSFFRAATLEQQGYDSKCDLWSLGVITHIMLTGISPFYGDGTEQSIVE 390

Query: 587 ILKSPLIFPD-----GMDPDAKDLLKRLLNRDPNRRL 618
             K+ ++  +      +D  A++ + +LL  + ++RL
Sbjct: 391 NAKAGILNFNVSQWSTIDIMAQNFVSKLLEVNVDKRL 427

>CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces
           cerevisiae YDL159w STE7 ser/thr/tyr protein kinase of
           MAP kinase kinase family, hypothetical start
          Length = 451

 Score = 90.1 bits (222), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 77/267 (28%), Positives = 123/267 (46%), Gaps = 50/267 (18%)

Query: 374 IDDFELLTVLGKGSYGKVMQVRKKDTQKIYALK--------AIRKSYIVAKSEVIHTLAE 425
           + D   L  LG G+ G VM+V    + ++ A K        AI K  I  +  ++ ++AE
Sbjct: 101 LRDLVQLGKLGSGNSGTVMKVLHVPSSRVIAKKTIVIEQNNAIVKQQIYRELTIMRSVAE 160

Query: 426 RTILARVECPFIVPLKFTFQTPEKLYLVLACINGGEL------FHHLQREGIFDISRA-- 477
              +        +    +      + +++  +N G L      +  LQR GI   +R+  
Sbjct: 161 HRNIVEFYGAHNLS-SDSINGSNDVVILMEYMNCGSLDTITRTYKSLQRRGILAANRSYP 219

Query: 478 -----------RFYASELLLALDSLHK-MDVVYRDLKPENILLDSQGHIALCDFGLC-KL 524
                         A  +L  L  L++   +++RD+KP N+L++S+G I LCDFG+  KL
Sbjct: 220 VQEWFSKPVIISRIAYSVLNGLSYLYENYKIIHRDIKPSNVLINSKGRIKLCDFGVSRKL 279

Query: 525 NMKDNEKTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMY 584
           N   N    TF GT  Y++PE + G  YT   D W+LG++L E+LTG  P    N +   
Sbjct: 280 N---NSIADTFVGTSTYMSPERIQGNKYTTKGDVWSLGLMLIELLTGEFPLGGHNDT--- 333

Query: 585 KKILKSPLIFPDGMDPDAKDLLKRLLN 611
                     PDG+     DLL+R++N
Sbjct: 334 ----------PDGI----LDLLQRIVN 346

>KLLA0F20053g 1867209..1868543 highly similar to sp|P32485
           Saccharomyces cerevisiae YLR113w HOG1 ser/thr protein
           kinase of MAP kinase (MAPK) family, start by similarity
          Length = 444

 Score = 89.7 bits (221), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 76/280 (27%), Positives = 129/280 (46%), Gaps = 45/280 (16%)

Query: 380 LTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSY---IVAKSEVIHTLAERTILARVECPF 436
           L  +G G++G V       T +  A+K I K +   ++AK     T  E  +L  +    
Sbjct: 25  LNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPFSTSVLAK----RTYRELKLLKHLRHEN 80

Query: 437 IVPLKFTFQTP-EKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMD 495
           ++ L+  F +P E +Y V   + G +L H L +    +    +++  ++L  L  +H   
Sbjct: 81  LICLEDIFLSPLEDIYFVTE-LQGTDL-HRLLQTRPLEKQFVQYFLYQILRGLKYVHSAG 138

Query: 496 VVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLG-KGYTK 554
           V++RDLKP NIL++    + +CDFGL ++    + + + +  T  Y APE++L  + Y  
Sbjct: 139 VIHRDLKPSNILINENCDLKICDFGLARIQ---DPQMTGYVSTRYYRAPEIMLTWQKYNV 195

Query: 555 VVDWWTLGVLLYEMLTGLPPY-----------------------YDENVSEMYKKILKS- 590
            VD W+ G +  EM+ G P +                        D   SE   K + S 
Sbjct: 196 EVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVIDTICSENTLKFVTSL 255

Query: 591 ----PLIFP---DGMDPDAKDLLKRLLNRDPNRRLGANGA 623
               P+ F      ++PDA DLL+++L  DP +R+ A  A
Sbjct: 256 PHRDPVPFSSRFQNLEPDAIDLLEKMLVFDPKKRITAADA 295

>Kwal_26.7154
          Length = 1213

 Score = 91.3 bits (225), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 76/269 (28%), Positives = 131/269 (48%), Gaps = 21/269 (7%)

Query: 376  DFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEV----IHTL-AERTILA 430
            DFE+L  +G+G+YGKV     K  + I  +K I K  I+  + V    + T+ +E  I+A
Sbjct: 952  DFEVLQKMGEGAYGKVDLCMHKKDRYIVVIKLIFKERILVDTWVRDRKLGTIPSEIQIMA 1011

Query: 431  RVECP--FIVPLKFTFQTPEKLYLVLACINGG----ELFHHLQREGIFDISRARFYASEL 484
             +       + +   F   +  Y +   ++G     +LF  ++ +       A     ++
Sbjct: 1012 TLNAKPHENILMLLDFFEDDDYYYIETAVHGTSGSIDLFDLIEMKTDMTEHEAMLIFKQI 1071

Query: 485  LLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAP 544
               + +LH   +V+RD+K EN+++D  G + + DFG        +     F GT +Y AP
Sbjct: 1072 ASGIKNLHDNGIVHRDIKDENVIVDCNGFVKIVDFGSAA--YVKSGPFDVFVGTIDYAAP 1129

Query: 545  EVLLGKGYT-KVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAK 603
            EVL G+ Y  K  D W +GVLLY ++    P+Y  N+ E+    L+  +   + +  D  
Sbjct: 1130 EVLGGEPYEGKPQDIWAIGVLLYTIIYKENPFY--NIDEILDADLR--VNSSERISDDCI 1185

Query: 604  DLLKRLLNRDPNRRLGANGADEIKNHKFF 632
             L++++LNR  ++R      DEI NHK+ 
Sbjct: 1186 ALIRKILNRSVSKR---PSIDEICNHKWL 1211

>Scas_602.11
          Length = 1186

 Score = 91.3 bits (225), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 90/402 (22%), Positives = 163/402 (40%), Gaps = 106/402 (26%)

Query: 336 NSASNFRLFNHQWINLKQGLG--------TINLTVDFKPSYSKPVGIDDFELLTVLGKGS 387
           N  + F  FN+++  L + LG        T  +++ + P   + V ++ +E++  LG G 
Sbjct: 124 NRTAPFNTFNNKFATLDEKLGRTSTKVKETNRISLTYDPISKRKV-LNTYEIIKELGHGQ 182

Query: 388 YGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVI-----------HTLAERTILARVECPF 436
           +GKV   +   T ++ A+K + +   +  +                  E  I+ ++    
Sbjct: 183 HGKVKLAKDLLTSQLVAIKIVDRHEKLRLTNFFKFNKRKQQNDDRIKREIAIMKKLHHKH 242

Query: 437 IVPLKFTFQ--TPEKLYLVLACINGGELF----HHLQREG----IFDISRARFYASELLL 486
           +V L          K+YLVL     GE+       L+ E     +     AR     ++L
Sbjct: 243 VVKLIEVLDDLKSRKIYLVLEYCAQGEIKWCPKDCLETEAKGPPLLSFQSAREIIRGVIL 302

Query: 487 ALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLC------------------------ 522
            L+ LH   +++RD+KP N+L+D +G + + DFG+                         
Sbjct: 303 GLEYLHYQGIIHRDIKPANLLVDEEGTVKISDFGVSLASRSSGNSTANSSSVLGGTPRNL 362

Query: 523 ------KLNMKDNEKTSTF--------CGTPEYLAPEVLLGK-GYTK------------- 554
                  +N  +N    +          GTP + APE+ LG+  + K             
Sbjct: 363 SRSSTESMNTTNNNDDESIDEVELAKTAGTPAFFAPEICLGEEAFDKFSLRKNEMFKGSC 422

Query: 555 ---VVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMD------------ 599
              ++D W LG+  Y +L G+ P+  +   E+++KI+  PL FP   +            
Sbjct: 423 ISFMIDIWALGITFYCLLFGMLPFISDFELELFEKIVGEPLTFPSYEELQANRVSNVCSI 482

Query: 600 ---PDAKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDLIWD 638
                AK++L+RLL ++P++R       E+K H F   + WD
Sbjct: 483 EEYEAAKNVLQRLLEKNPSKRC---SILELKYHPF---ICWD 518

>Kwal_33.13222
          Length = 148

 Score = 83.2 bits (204), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 40/112 (35%), Positives = 67/112 (59%), Gaps = 1/112 (0%)

Query: 444 FQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVYRDLKP 503
           ++T   LY+VL  +  GELF+ L   G    + A  +  ++++ +   H + +V+RDLKP
Sbjct: 16  WETNSNLYMVLEYVEKGELFNLLVERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKP 75

Query: 504 ENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKV 555
           EN+LLD + +I + DFG+  L  KD +   T CG+P Y APE++ G   +++
Sbjct: 76  ENLLLDHKFNIKIADFGMAALESKD-KLLETSCGSPHYAAPEIVSGTALSRL 126

>CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces
            cerevisiae YAL017w FUN31 or sp|Q08217 Saccharomyces
            cerevisiae YOL045w, start by similarity
          Length = 1206

 Score = 90.5 bits (223), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 79/256 (30%), Positives = 127/256 (49%), Gaps = 22/256 (8%)

Query: 376  DFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEV----IHTL-AERTILA 430
            DF +L  +G+G+YGKV     K+ + I  +K I K  I+  + V    + T+ +E  ILA
Sbjct: 945  DFVVLQKMGEGAYGKVNLCIHKEKKYIVVIKMIFKERILVDTWVRDRKLGTIPSEIQILA 1004

Query: 431  RV-ECPF--IVPLKFTFQTPEKLYLVL---ACINGGELFHHLQREGIFDISRARFYASEL 484
             + + P   I+ L   F+  +  YL           +LF  ++ +       A+    ++
Sbjct: 1005 TINKRPHENILGLLDFFEDDDYYYLETPPHGQTGSVDLFDIIEFKSNMTEFEAKLIFKQI 1064

Query: 485  LLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAP 544
            +  +  LH   +V+RD+K EN+++DS+G + L DFG        +     F GT +Y AP
Sbjct: 1065 VSGIKHLHDQGIVHRDIKDENVIVDSKGFVKLIDFGSAA--YVKSGPFDVFVGTIDYAAP 1122

Query: 545  EVLLGKGYT-KVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMD--PD 601
            EVL G  Y  K  D W +G+LLY ++    P+Y  N+ E    IL+  L F D  D   +
Sbjct: 1123 EVLGGNPYEGKSQDIWAIGILLYTLIYKENPFY--NIDE----ILEGELRFNDSADVSQE 1176

Query: 602  AKDLLKRLLNRDPNRR 617
             K L+ ++LNR   +R
Sbjct: 1177 CKALITKILNRCVRKR 1192

>AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH]
           (1043479..1044750) [1272 bp, 423 aa]
          Length = 423

 Score = 88.6 bits (218), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 88/318 (27%), Positives = 142/318 (44%), Gaps = 67/318 (21%)

Query: 365 KPSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLA 424
           K  +S+P   ++F++L  +G+GS+G V +V    T K+   K I+  ++ +K E    +A
Sbjct: 18  KLGHSQP---NEFKVLEEIGRGSFGSVRKVLHVPTSKLMVRKEIKYGHMNSK-ERQQLIA 73

Query: 425 ERTILARVECPFIVPL------------KFTFQTPEKLYLVLACINGGELFHHLQR-EGI 471
           E TILA +    IV                 +   E LYL +   + G+L   ++  +G+
Sbjct: 74  ECTILAGLRHENIVEFYNWDHASSRTGNSVDYGNGEVLYLYMEYCSCGDLSQMIKHYKGM 133

Query: 472 ------FDISRARFYASELLLALDSLH------KMDVVY--------------------R 499
                  DI R    A +LLLAL   H      ++D +Y                    R
Sbjct: 134 RKYVPERDIWRI---AVQLLLALYKCHTSCDLPQLDTIYDKISKSAIESEAGKVTSVIHR 190

Query: 500 DLKPENILLDSQG------------HIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVL 547
           DLKP NI L   G             + L DFGL K      E  +T+ GTP Y++PEVL
Sbjct: 191 DLKPGNIFLTGDGVGGRGSVDYSKVEVKLGDFGLAKSLQSAIEFATTYVGTPYYMSPEVL 250

Query: 548 LGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLI-FPDGMDPDAKDLL 606
           + + Y+ + D W+LG ++YE+     P+   N  E+ + I ++ +   PD    + + L+
Sbjct: 251 MDQPYSPLSDIWSLGCVIYELCALRVPFPARNFMELQRMIQRADVQPLPDYYSKELQQLV 310

Query: 607 KRLLNRDPNRRLGANGAD 624
              +N  PN +L  +  D
Sbjct: 311 ISCIN--PNEKLRPSAFD 326

>Kwal_27.12559
          Length = 414

 Score = 88.2 bits (217), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 99/368 (26%), Positives = 157/368 (42%), Gaps = 70/368 (19%)

Query: 361 TVDFKPSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVI 420
           T+  K ++S P    ++E++ VLGKGSYG V+    K         AI+K   +   E++
Sbjct: 53  TIYQKANFSTP---GNYEIIQVLGKGSYGVVVSAIDKGEDGKPRRLAIKKVTNIFNREIL 109

Query: 421 HTLAERTIL------ARVECPFIVPLKFTFQTP-EKLYLVLACING--GELFHHLQREGI 471
              A R +              +V L+   + P + LY     ++     + H   +   
Sbjct: 110 LKRAIRELKFLNFFKGHKNIVSLVDLEIVSEKPYDGLYCYQELVDYDLARVIHSTVQFSE 169

Query: 472 FDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCK------LN 525
           F I   + +  ++L  L  +H  DV++RDLKP NIL    G++ +CDFGL +        
Sbjct: 170 FHI---KHFLYQILCGLKYIHSADVIHRDLKPGNILCSIGGNLKICDFGLARGIAPQYFE 226

Query: 526 MKDNE-KTSTFCGTPEYLAPEVLLG-KGYTKVVDWWTLGVLLYEMLTGLPPYYDEN---- 579
            K +E   +++  T  Y APE++L  + YTK +D W +G +L E     P +   +    
Sbjct: 227 QKSDEIHITSYVATRWYRAPELILSHRRYTKAIDIWAVGCILAEFYGRKPIFMGHDSLHQ 286

Query: 580 VSEMYKKILKSPL-----------------------------IFPDGMDPDAKDLLKRLL 610
           VSE+  K+L SP                              ++P     DA+ LL  LL
Sbjct: 287 VSEIL-KVLGSPCRETVAKYCSARSWEIFSGRSEVKKMPWSSVYPKSCS-DAQALLDMLL 344

Query: 611 NRDPNRRLGANGADEIKNHKFFNDLIWDSIWNKEYLPPFRPDVQNANDTSNFDNEFTKQK 670
             DP++R G   A     H FF D+      +  Y  P  P      D S ++N+FT  K
Sbjct: 345 TWDPDKRPGVEVA---LCHPFFEDV------SNPYDEPSCP--YGPFDFS-YENKFTSMK 392

Query: 671 PVDSVIDE 678
            +   I+E
Sbjct: 393 MLRETINE 400

>Scas_688.14
          Length = 479

 Score = 88.6 bits (218), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 78/319 (24%), Positives = 143/319 (44%), Gaps = 72/319 (22%)

Query: 377 FELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVI-HTLAERTILAR---- 431
           F+L+  +G G+YG V   R  +  +   +   + + + +KS +   +L E  +L      
Sbjct: 23  FQLIKEIGHGAYGIVCSARFAEAVEDTTVAIKKVTNVFSKSLLCKRSLRELKLLRHFRGH 82

Query: 432 --VECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRA---------RFY 480
             + C + + + F    P+  +      NG  L+  L    +  I ++         + +
Sbjct: 83  KNITCLYDMDIVFY---PDGTF------NGLYLYEELMECDMHQIIKSSQPLTDAHYQSF 133

Query: 481 ASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLN----MKDNEKTSTFC 536
             ++L  L  +H  DV++RDLKP N+L+++   + +CDFGL +      +++N+  + + 
Sbjct: 134 IYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVENNQFLTEYV 193

Query: 537 GTPEYLAPEVLLG-KGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKIL------- 588
            T  Y APE++L  +GYTK +D W+ G +L E L G P +  ++  +   +IL       
Sbjct: 194 ATRWYRAPEIMLSYQGYTKAIDIWSTGCILAEFLGGKPIFKGKDYVDQLTRILQVLGTPP 253

Query: 589 -----------------------KSPLI--FPDGMDPDAKDLLKRLLNRDPNRRLGANGA 623
                                  K P +  +PD  +P A DLL+++L  DP +R+     
Sbjct: 254 DETLRRIGSKNVQDYIHQLGYIPKVPFVNLYPDA-NPQALDLLEKMLAFDPQKRI---TT 309

Query: 624 DEIKNHKFFNDLIWDSIWN 642
           DE   H +       SIW+
Sbjct: 310 DEALEHPYL------SIWH 322

>CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomyces
           cerevisiae YHR030c SLT2, hypothetical start
          Length = 488

 Score = 88.6 bits (218), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 77/302 (25%), Positives = 136/302 (45%), Gaps = 63/302 (20%)

Query: 377 FELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVI-HTLAERTILAR---- 431
           FEL+  +G G+YG V   R  +  +   +   + + I +K+ +   +L E  +L      
Sbjct: 21  FELIKEIGHGAYGIVCSARFTEASEETTVAIKKVTNIFSKTLLCKRSLRELKLLRHFRGH 80

Query: 432 --VECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRA---------RFY 480
             + C + + + F    P+        ING  L+  L    +  I ++         + +
Sbjct: 81  KNITCLYDMDIVFY---PD------GSINGLYLYEELMECDMHQIIKSGQALTDAHYQSF 131

Query: 481 ASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTF----C 536
             ++L  L  +H  DV++RDLKP N+L+++   + +CDFGL +   ++ E+ + F     
Sbjct: 132 TYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPEENNQFLTEYV 191

Query: 537 GTPEYLAPEVLLG-KGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKIL------- 588
            T  Y APE++L  +GYTK +D W+ G +L E L G P +  ++  +   +IL       
Sbjct: 192 ATRWYRAPEIMLSYQGYTKAIDIWSTGCILAEFLGGKPLFKGKDYVDQLNRILQVLGTPP 251

Query: 589 -----------------------KSPL--IFPDGMDPDAKDLLKRLLNRDPNRRLGANGA 623
                                  K P   +FP+  + DA DLL+ +L  DP +R+  + A
Sbjct: 252 DETLRRVGSKNVQDYIHQLGYIQKIPFSELFPNA-NEDALDLLEGMLAFDPQKRITVDKA 310

Query: 624 DE 625
            E
Sbjct: 311 LE 312

>Scas_598.6
          Length = 790

 Score = 89.4 bits (220), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 76/147 (51%), Gaps = 7/147 (4%)

Query: 440 LKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRA-------RFYASELLLALDSLH 492
           L+   +T + L++V+  + GG L   ++       S +        +   E    L  LH
Sbjct: 574 LEAYLKTEDDLWVVMEFMEGGSLTDIIENSPATGSSSSPLTEPQIAYIVRETCQGLKFLH 633

Query: 493 KMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGY 552
              +++RD+K +N+LLD+   + + DFG C        K +T  GTP ++APEV+  + Y
Sbjct: 634 DKHIIHRDIKSDNVLLDNNARVKITDFGFCAKLTDQRSKRATMVGTPYWMAPEVVKQREY 693

Query: 553 TKVVDWWTLGVLLYEMLTGLPPYYDEN 579
            + VD W+LG++  EML   PPY +E+
Sbjct: 694 DEKVDVWSLGIMTIEMLESEPPYLNED 720

>Scas_643.20
          Length = 1082

 Score = 89.4 bits (220), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 77/251 (30%), Positives = 123/251 (49%), Gaps = 22/251 (8%)

Query: 376  DFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEV----IHTL-AERTILA 430
            DF +L  LG+G+YGKV     K+ + I  +K I K  I+  + V    + T+ +E  I+A
Sbjct: 821  DFTVLQQLGEGAYGKVKLCIHKEKRTIVVIKMIFKERILVDTWVRDRKLGTIPSEIQIMA 880

Query: 431  RV-ECPF--IVPLKFTFQTPEKLYLVLAC---INGGELFHHLQREGIFDISRARFYASEL 484
             + + P   IV L   F+  E  Y+           +LF  ++ +        +    ++
Sbjct: 881  TLNKKPHKNIVALLDFFEDEEYYYMETPAHGETGSIDLFDLIELKKNMTEYEEKLIFKQV 940

Query: 485  LLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAP 544
            +  L  LH   +V+RD+K EN+++DS+GH+ L D+G        +     F GT +Y AP
Sbjct: 941  VSGLKHLHDQGIVHRDIKDENVIVDSKGHVKLIDYGSAAYT--KSGPFDVFVGTIDYAAP 998

Query: 545  EVLLGKGYT-KVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAK 603
            EVL G  Y  K  D W +G+LLY ++    P+Y  N+ E    I+   L F D  +    
Sbjct: 999  EVLGGSVYDGKPQDIWAIGILLYTIIFKENPFY--NIDE----IMDGELRFNDAGNTSEA 1052

Query: 604  --DLLKRLLNR 612
               L+K++LNR
Sbjct: 1053 CIKLIKKILNR 1063

>Scas_710.28
          Length = 352

 Score = 86.7 bits (213), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 71/248 (28%), Positives = 120/248 (48%), Gaps = 28/248 (11%)

Query: 376 DFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECP 435
           DF+L ++LG+G+YG V     K T +I A+K I           + TL E  IL   +  
Sbjct: 12  DFQLKSLLGEGAYGVVCSAVHKPTGEIVAIKKIEP--FDKPLFALRTLREIKILKHFQHE 69

Query: 436 FIVPLKFTFQTPE------KLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALD 489
            I+ + F  Q PE      ++Y++   +   +L   +  + + D    +++  + L A+ 
Sbjct: 70  NIISI-FDIQRPESFENFNEVYIIQELMQT-DLHRVISTQNLTD-DHIQYFIYQTLRAVK 126

Query: 490 SLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKL----------NMKDNEKTSTFCGTP 539
            LH  +V++RDLKP N+L++S   + +CDFGL ++          N +     + +  T 
Sbjct: 127 VLHGSNVIHRDLKPSNLLINSNCDLKICDFGLARIIEEDTGDDEPNAQLQNGMTEYVATR 186

Query: 540 EYLAPEVLLGKG-YTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGM 598
            Y APEV+L    Y+K +D W+ G +L E+    P +  ++    Y+  L   LIF    
Sbjct: 187 WYRAPEVMLTAARYSKAMDIWSCGCILAELFMKRPIFPGKD----YRHQLM--LIFGLIG 240

Query: 599 DPDAKDLL 606
            P  +DLL
Sbjct: 241 TPSGRDLL 248

>KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_1
           Kluyveromyces lactis MAP kinase, start by similarity
          Length = 495

 Score = 87.8 bits (216), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 84/352 (23%), Positives = 153/352 (43%), Gaps = 68/352 (19%)

Query: 377 FELLTVLGKGSYGKVMQVRKKDT--QKIYALKAIRKSY---IVAKSEVIHTLAERTILAR 431
           F+L+  +G GSYG V   R  +   +   A+K +   +   ++ K  +      R     
Sbjct: 25  FQLIKEIGHGSYGIVCSARFTEAADETTVAIKKVTNVFSKTLLCKRSLRELKLLRHFRGH 84

Query: 432 VECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRA---------RFYAS 482
                +  +   FQ P+ ++      NG  L+  L    +  I ++         + +  
Sbjct: 85  KNITCLYDMDIVFQ-PDGMF------NGLYLYEELMECDMHQIVKSGQPLTDAHYQSFIY 137

Query: 483 ELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLN----MKDNEKTSTFCGT 538
           ++L  L  +H  DV++RDLKP N+L+++   + +CDFGL +      +++N+  + +  T
Sbjct: 138 QILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVENNQFLTEYVAT 197

Query: 539 PEYLAPEVLLG-KGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKIL--------- 588
             Y APE++L  +GYTK +D W+ G +L E+L G P +  ++  +   +IL         
Sbjct: 198 RWYRAPEIMLSYQGYTKAIDVWSCGCILAELLGGKPIFKGKDYVDQLNRILQVLGTPPEE 257

Query: 589 ---------------------KSPL--IFPDGMDPDAKDLLKRLLNRDPNRRLGANGADE 625
                                K P   ++P+  +PDA +LL+ +L+ DP  R+     D+
Sbjct: 258 TLKRIGSKNVQDYIHQLGYIPKIPFSTLYPNA-NPDALNLLEGMLSFDPQLRI---TVDD 313

Query: 626 IKNHKFFNDLIWDSIWNKEYLPPFRPDVQNANDTSNFDNEFTKQKPVDSVID 677
              H +       SIW+     P   +  + +  S  + E  KQ  +D V D
Sbjct: 314 ALQHPYL------SIWHDPADEPICTEKFDFSFESVNEIEQLKQMVIDEVTD 359

>Scas_713.38
          Length = 432

 Score = 87.0 bits (214), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 73/282 (25%), Positives = 129/282 (45%), Gaps = 49/282 (17%)

Query: 380 LTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERT-----ILARVEC 434
           L  +G G++G V       T +  A+K I K +  A       LA+RT     +L  +  
Sbjct: 26  LNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPFSTA------VLAKRTYRELKLLKHLRH 79

Query: 435 PFIVPLKFTFQTP-EKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHK 493
             ++ L+  F +P E +Y V   + G +L H L +    +    +++  ++L  L  +H 
Sbjct: 80  ENLICLQDIFLSPLEDIYFVTE-LQGTDL-HRLLQTRPLEKQFVQYFLYQILRGLKYVHS 137

Query: 494 MDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLG-KGY 552
           + V++RDLKP NIL++    + +CDFGL ++    + + + +  T  Y APE++L  + Y
Sbjct: 138 VGVIHRDLKPSNILINENCDLKICDFGLARIQ---DPQMTGYVSTRYYRAPEIMLTWQKY 194

Query: 553 TKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKIL------------------------ 588
              VD W+ G +  EM+ G P +  ++    +  I                         
Sbjct: 195 DVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPEDVINTICSENTLKFVT 254

Query: 589 ----KSPLIFPD---GMDPDAKDLLKRLLNRDPNRRLGANGA 623
               + P+ F +    ++PDA DLL ++L  DP +R+ A  A
Sbjct: 255 SLPHRDPIPFSERFKTVEPDAVDLLGKMLVFDPKKRVTAAEA 296

>CAGL0K01617g complement(142479..144803) similar to sp|P54199
           Saccharomyces cerevisiae YDL028c Serine/threonine
           protein kinase, start by similarity
          Length = 774

 Score = 88.6 bits (218), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 76/291 (26%), Positives = 130/291 (44%), Gaps = 44/291 (15%)

Query: 366 PSYSKPVGID--DFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTL 423
           PS    V ++  ++E + +LG+G    V +VR     ++YALK +       +S V    
Sbjct: 434 PSRKNVVSVNGTEYERVELLGRGGSSNVYKVRGL-KNRVYALKKVSFDEF-DESSVEGFK 491

Query: 424 AERTILARVECPFIVPLKFTFQTPEK-LYLVLAC--INGGELFHHLQREGIFDISRARFY 480
            E ++L +++    V   + F+     LYL++ C   +  ++ H    +  FD+   R++
Sbjct: 492 GEISLLKQLQNQNRVVQLYDFEMGSGVLYLLMECGDYDLSQVLHQRANQP-FDMEFIRYH 550

Query: 481 ASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKL--NMKDNEKTSTFCGT 538
           A E++  +  +H   +V+ DLKP N +   +G + + DFG+     +   N       GT
Sbjct: 551 AREMVTCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDMQIGT 609

Query: 539 PEYLAPEVLLGKGYT-----------------KVVDWWTLGVLLYEMLTGLPPY------ 575
           P Y+APE L+   YT                 K  D W+ G ++Y+M+ G PPY      
Sbjct: 610 PNYMAPEALVANNYTADNDGKYDQKTNKWKIGKPADIWSCGCIIYQMIYGKPPYAKYQGQ 669

Query: 576 ------YDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRLLNRDPNRRLGA 620
                  D NV   YK++L    + P      A +L++  L R+P  R  A
Sbjct: 670 ERLLSIMDPNVKIEYKEVLPDKTVIPSL----ALELMQYCLMRNPEERWSA 716

>Scas_640.16
          Length = 505

 Score = 87.4 bits (215), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 64/231 (27%), Positives = 108/231 (46%), Gaps = 11/231 (4%)

Query: 380 LTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVP 439
           L VLG+G+ G V + + K  +K++ALK +       + +      E       +  +IV 
Sbjct: 213 LGVLGEGAGGSVEKCKLKHGKKVFALKIVNTLNTDPEFQK-QIFRELQFNKSFKSDYIVR 271

Query: 440 LKFTFQ--TPEKLYLVLACINGGEL----FHHLQREGIFDISRARFYASELLLALDSLHK 493
               F       +Y+ +  + G  L     + L R G          +  +L  L  LH+
Sbjct: 272 YYGMFNDVNSSSIYIAMEYMGGKSLEAVYKNLLSRGGRISEKVLGKISESVLRGLSYLHE 331

Query: 494 MDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYT 553
             V++RD+KP+NIL + +G + LCDFG+    +  N   +TF GT  Y+APE + G+ Y+
Sbjct: 332 QKVIHRDIKPQNILFNEKGQVKLCDFGVSGEAV--NSLATTFTGTSFYMAPERIQGQPYS 389

Query: 554 KVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKD 604
              D W+LG+ + E+  G  P+  + ++     I    LI     +P+ KD
Sbjct: 390 VTCDIWSLGLTILEVAQGRFPFGSDKITATIAPIELLVLIL--TFNPELKD 438

>KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces
           cerevisiae YDL028c MPS1 serine/threonine/tyrosine
           protein kinase, hypothetical start
          Length = 793

 Score = 88.6 bits (218), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 77/258 (29%), Positives = 122/258 (47%), Gaps = 46/258 (17%)

Query: 351 LKQGLGTINLTVDF----KPSYSKP---VGIDDFELLTVLGKGSYGKVMQVRKKDTQKIY 403
           L +G   +N    F    + SY+ P   V    +E + +LGKG  GKV +V+  D  K+Y
Sbjct: 439 LNKGDNYLNYNGSFDTKKRTSYAVPTITVNGTAYEKVELLGKGGSGKVYKVKSSD-HKVY 497

Query: 404 ALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVPLKFTFQTPEK-LYLVLACINGGEL 462
           ALK +       +S +     E  +L ++E    V     +   +  L+L++ C   GE 
Sbjct: 498 ALKRVSFDEF-DESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMEC---GE- 552

Query: 463 FHHL-----QREGI-FDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIAL 516
            H L     QR  I FD    R++  E++  +  +H  D+V+ DLKP N +   +G + +
Sbjct: 553 -HDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVF-VKGMLKI 610

Query: 517 CDFGLCK------LNM-KDNEKTSTFCGTPEYLAPEVLLGKGYT------------KVVD 557
            DFG+        +N+ +DN+      GTP Y+APE L+   +T            K  D
Sbjct: 611 IDFGIANAVPDHTVNIYRDNQ-----IGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSD 665

Query: 558 WWTLGVLLYEMLTGLPPY 575
            W+ G +LY+M+ G PPY
Sbjct: 666 VWSCGCILYQMVYGKPPY 683

>KLLA0D09328g complement(788565..791705) some similarities with
           sp|P38990 Saccharomyces cerevisiae YER129w PAK1 DNA
           polymerase alpha suppressing protein kinase,
           hypothetical start
          Length = 1046

 Score = 88.6 bits (218), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 81/343 (23%), Positives = 146/343 (42%), Gaps = 68/343 (19%)

Query: 357 TINLTVDFKPSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRK------ 410
           T  +++++ P   + V ++ +E++  LG G +GKV   R   T+++ A+K + +      
Sbjct: 96  TNTVSLEYDPISKRKV-LNTYEIIEELGHGQHGKVKLARDLVTKQLVAIKIVNRHKKRTF 154

Query: 411 ------SYIVAKSEVIHTLAERTILARVEC--PFIVPLKFTFQTPE--KLYLVLACINGG 460
                  +   +S +     +R I    +C    +V L       +  K+YLVL   + G
Sbjct: 155 NDKFSNRFKTPQSGIEDEKIKREIAIMKKCHHEHVVKLIEVLDDAKSRKIYLVLEYCSKG 214

Query: 461 EL------FHHLQREG--IFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQG 512
           E+          +  G  +    R R     +LL L+ LH   +++RD+KP N+LL   G
Sbjct: 215 EIKWCPGDVIETKARGPPLLSFQRTREIFRGVLLGLEYLHFQGIIHRDIKPANLLLSEDG 274

Query: 513 HIALCDFGLCKLNMKDNEKTS-------TFCGTPEYLAPEVLLGKGYTKV---------- 555
            + + DFG+      D+   S          GTP + APE+ L +   K           
Sbjct: 275 IVKISDFGVSLAFSSDSSTDSLNELELAKTAGTPAFFAPEICLVEDTIKKFDLDPNSKEP 334

Query: 556 -----VDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMD----------- 599
                 D W +G+ L+ +L G+ P+  +   E++ KI+  PL+F                
Sbjct: 335 IISFPTDIWAMGITLHCLLFGMLPFISDYELELFDKIVNEPLVFEPYQKIEQCQVSQVEC 394

Query: 600 ----PDAKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDLIWD 638
                +A++LL +LL ++P +R+    A   K H +   + WD
Sbjct: 395 KEEYEEAQNLLNKLLEKNPKKRMAIQDA---KKHPW---VCWD 431

>CAGL0E01683g complement(166584..167711) highly similar to sp|P21965
           Saccharomyces cerevisiae YNL307c MCK1 or sp|Q12222
           Saccharomyces cerevisiae YOL128c, start by similarity
          Length = 375

 Score = 86.3 bits (212), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 86/323 (26%), Positives = 149/323 (46%), Gaps = 55/323 (17%)

Query: 383 LGKGSYGKVMQVR-KKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVPLK 441
           +G+G++G V+Q    +D Q  Y   AI+K  + A++E  +   E  IL   + P IV L+
Sbjct: 41  IGRGAFGTVVQAYLTQDEQTWYGPFAIKK--VPAQTE--YKSRELQILRLTDHPNIVKLE 96

Query: 442 --FTFQTPE--KLY--LVLACINGG---ELFHHLQREGIFDISRARFYASELLLALDSLH 492
             FT  +P+  K+Y  L + C+      E+  +        I   + Y+ ++   +  LH
Sbjct: 97  YFFTHTSPKDNKVYQHLAMECLPETLQIEINRYTSNNLQLAIKHVKLYSYQIARGMLYLH 156

Query: 493 KMDVVYRDLKPENILLDSQ-GHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGK- 550
            + + +RD+KP NIL+D + G + +CDFG  K  ++ N+ + ++  +  Y APE++LG  
Sbjct: 157 ALGICHRDIKPSNILVDPKTGVLKICDFGSAK-RLEPNQPSISYICSRFYRAPELILGST 215

Query: 551 GYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILK--------------------- 589
            YT  VD W LG ++ EML G   +  ++     ++I K                     
Sbjct: 216 QYTTQVDIWGLGCVIGEMLIGRAIFQGQDPLLQLREIAKLLGPPDKKFIFFSNPRYTGPL 275

Query: 590 --SPLIFPDGMD----------PDAKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDLIW 637
             +PL     ++          PD  DLL ++L  +P  R        I  H FF+DL  
Sbjct: 276 YSTPLFNGTSLERFQKYFGHAGPDGIDLLMKVLKYEPELRFSPR---RIMAHPFFDDLRN 332

Query: 638 DSIW--NKEYLPPFRPDVQNAND 658
           +  +   ++  P   P++ N N+
Sbjct: 333 EKYFFPREQTQPVLLPELFNFNE 355

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.136    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 22,141,019
Number of extensions: 987252
Number of successful extensions: 4253
Number of sequences better than 10.0: 664
Number of HSP's gapped: 3316
Number of HSP's successfully gapped: 741
Length of query: 693
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 584
Effective length of database: 12,822,747
Effective search space: 7488484248
Effective search space used: 7488484248
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)