Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0K06831g35835317800.0
Scas_686.2241635715800.0
YBR221C (PDB1)36634915440.0
AAR167C35934715360.0
Sklu_2171.436235315280.0
KLLA0F09603g35435215260.0
Kwal_14.178936332915160.0
Sklu_2101.356869700.93
Scas_696.4262556663.1
KLLA0A06996g20355635.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0K06831g
         (353 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0K06831g complement(665672..666748) highly similar to sp|P32...   690   0.0  
Scas_686.22                                                           613   0.0  
YBR221C (PDB1) [402] chr2 complement(665110..666210) Pyruvate de...   599   0.0  
AAR167C [355] [Homologous to ScYBR221C (PDB1) - SH] (642620..643...   596   0.0  
Sklu_2171.4 YBR221C, Contig c2171 8787-9875                           593   0.0  
KLLA0F09603g complement(882778..883842) highly similar to sp|P32...   592   0.0  
Kwal_14.1789                                                          588   0.0  
Sklu_2101.3 YMR171C, Contig c2101 5004-6710                            32   0.93 
Scas_696.42                                                            30   3.1  
KLLA0A06996g 631799..632410 some similarities with ca|CA3119|IPF...    29   5.2  

>CAGL0K06831g complement(665672..666748) highly similar to sp|P32473
           Saccharomyces cerevisiae YBR221c Pyruvate dehydrogenase,
           hypothetical start
          Length = 358

 Score =  690 bits (1780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/353 (96%), Positives = 339/353 (96%)

Query: 1   MLQFRTPLTRLTPMARLATRSAVRMASTKTMTVREALNSALAEELDRDDDVFIIGEEVAQ 60
           MLQFRTPLTRLTPMARLATRSAVRMASTKTMTVREALNSALAEELDRDDDVFIIGEEVAQ
Sbjct: 1   MLQFRTPLTRLTPMARLATRSAVRMASTKTMTVREALNSALAEELDRDDDVFIIGEEVAQ 60

Query: 61  YNGAYKVTKGLLDRFGERRVVDTPITEYXXXXXXXXXXXXXXKPIVEFMSFNFSMQAIDH 120
           YNGAYKVTKGLLDRFGERRVVDTPITEY              KPIVEFMSFNFSMQAIDH
Sbjct: 61  YNGAYKVTKGLLDRFGERRVVDTPITEYGFAGLAVGAALKGLKPIVEFMSFNFSMQAIDH 120

Query: 121 VVNSAAKTHYMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWYGSIPGLKVLVPYSAED 180
           VVNSAAKTHYMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWYGSIPGLKVLVPYSAED
Sbjct: 121 VVNSAAKTHYMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWYGSIPGLKVLVPYSAED 180

Query: 181 ARGLLKAAIRDPNPVVFLENELLYGEQFEVSEEALSPDFTLPYTAKVEKEGKDISIITYT 240
           ARGLLKAAIRDPNPVVFLENELLYGEQFEVSEEALSPDFTLPYTAKVEKEGKDISIITYT
Sbjct: 181 ARGLLKAAIRDPNPVVFLENELLYGEQFEVSEEALSPDFTLPYTAKVEKEGKDISIITYT 240

Query: 241 RNTEFSLAAAKILEEKYGVSAEVINLRSIRPLDIDAIVKTVKKTNHLITVESTFPSFGVG 300
           RNTEFSLAAAKILEEKYGVSAEVINLRSIRPLDIDAIVKTVKKTNHLITVESTFPSFGVG
Sbjct: 241 RNTEFSLAAAKILEEKYGVSAEVINLRSIRPLDIDAIVKTVKKTNHLITVESTFPSFGVG 300

Query: 301 AEIIAQVMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPDPETIVRAAKE 353
           AEIIAQVMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPDPETIVRAAKE
Sbjct: 301 AEIIAQVMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPDPETIVRAAKE 353

>Scas_686.22
          Length = 416

 Score =  613 bits (1580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/357 (84%), Positives = 319/357 (89%), Gaps = 7/357 (1%)

Query: 2   LQFRTPLTRLTPMARLATRS-----AVRMASTKTMTVREALNSALAEELDRDDDVFIIGE 56
           + FR P T +T   R+A+ S     A+R AS+KTMTVREALN+A+AEELDRDDDVFIIGE
Sbjct: 57  MSFRLPFTNVT--RRIASSSPLRFQALRYASSKTMTVREALNTAMAEELDRDDDVFIIGE 114

Query: 57  EVAQYNGAYKVTKGLLDRFGERRVVDTPITEYXXXXXXXXXXXXXXKPIVEFMSFNFSMQ 116
           EVAQYNGAYKVTKGLLDRFGERRVVDTPITE               KPIVEFMSFNFSMQ
Sbjct: 115 EVAQYNGAYKVTKGLLDRFGERRVVDTPITEMGFTGLAVGAALKGLKPIVEFMSFNFSMQ 174

Query: 117 AIDHVVNSAAKTHYMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWYGSIPGLKVLVPY 176
           AID VVNSAAKTHYMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWYGSIPGLKVLVPY
Sbjct: 175 AIDQVVNSAAKTHYMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWYGSIPGLKVLVPY 234

Query: 177 SAEDARGLLKAAIRDPNPVVFLENELLYGEQFEVSEEALSPDFTLPYTAKVEKEGKDISI 236
           SAEDARGLLKAAIRDPNPVVFLENELLYGE FE+S+EALSPDFTLPY AKVE+EG DISI
Sbjct: 235 SAEDARGLLKAAIRDPNPVVFLENELLYGESFEISDEALSPDFTLPYKAKVEREGTDISI 294

Query: 237 ITYTRNTEFSLAAAKILEEKYGVSAEVINLRSIRPLDIDAIVKTVKKTNHLITVESTFPS 296
           ITYTRN +FSL AA ILE++YGVS EVINLRSIRPLD+DAIVKTVKKTNHLITVESTFPS
Sbjct: 295 ITYTRNVQFSLEAAAILEKQYGVSVEVINLRSIRPLDVDAIVKTVKKTNHLITVESTFPS 354

Query: 297 FGVGAEIIAQVMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPDPETIVRAAKE 353
           FGVGAEIIA+VMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPDP+TIVRA KE
Sbjct: 355 FGVGAEIIARVMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPDPDTIVRAVKE 411

>YBR221C (PDB1) [402] chr2 complement(665110..666210) Pyruvate
           dehydrogenase complex, E1-beta subunit
           (pyruvate:lipoamide 2-oxidoreductase) [1101 bp, 366 aa]
          Length = 366

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/349 (83%), Positives = 313/349 (89%), Gaps = 3/349 (0%)

Query: 5   RTPLTRLTPMARLATRSAVRMASTKTMTVREALNSALAEELDRDDDVFIIGEEVAQYNGA 64
           R P + + P A  A   A+R +STKTMTVREALNSA+AEELDRDDDVF+IGEEVAQYNGA
Sbjct: 16  RAPTSFVRPSAAAA---ALRFSSTKTMTVREALNSAMAEELDRDDDVFLIGEEVAQYNGA 72

Query: 65  YKVTKGLLDRFGERRVVDTPITEYXXXXXXXXXXXXXXKPIVEFMSFNFSMQAIDHVVNS 124
           YKV+KGLLDRFGERRVVDTPITEY              KPIVEFMSFNFSMQAIDHVVNS
Sbjct: 73  YKVSKGLLDRFGERRVVDTPITEYGFTGLAVGAALKGLKPIVEFMSFNFSMQAIDHVVNS 132

Query: 125 AAKTHYMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWYGSIPGLKVLVPYSAEDARGL 184
           AAKTHYMSGGTQKCQ+VFRGPNG+AVGV AQHSQD+S WYGSIPGLKVLVPYSAEDARGL
Sbjct: 133 AAKTHYMSGGTQKCQMVFRGPNGAAVGVGAQHSQDFSPWYGSIPGLKVLVPYSAEDARGL 192

Query: 185 LKAAIRDPNPVVFLENELLYGEQFEVSEEALSPDFTLPYTAKVEKEGKDISIITYTRNTE 244
           LKAAIRDPNPVVFLENELLYGE FE+SEEALSP+FTLPY AK+E+EG DISI+TYTRN +
Sbjct: 193 LKAAIRDPNPVVFLENELLYGESFEISEEALSPEFTLPYKAKIEREGTDISIVTYTRNVQ 252

Query: 245 FSLAAAKILEEKYGVSAEVINLRSIRPLDIDAIVKTVKKTNHLITVESTFPSFGVGAEII 304
           FSL AA+IL++KYGVSAEVINLRSIRPLD +AI+KTVKKTNHLITVESTFPSFGVGAEI+
Sbjct: 253 FSLEAAEILQKKYGVSAEVINLRSIRPLDTEAIIKTVKKTNHLITVESTFPSFGVGAEIV 312

Query: 305 AQVMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPDPETIVRAAKE 353
           AQVMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPD  TIV+A KE
Sbjct: 313 AQVMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPDTPTIVKAVKE 361

>AAR167C [355] [Homologous to ScYBR221C (PDB1) - SH]
           (642620..643699) [1080 bp, 359 aa]
          Length = 359

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/347 (82%), Positives = 316/347 (91%), Gaps = 4/347 (1%)

Query: 8   LTR-LTPMARLATRSAVRMASTKTMTVREALNSALAEELDRDDDVFIIGEEVAQYNGAYK 66
           LTR L+ + R+     +R AS+K+MTVR+ALNSA+AEE+DRDDDVFIIGEEVAQYNGAYK
Sbjct: 11  LTRSLSSVGRM---QQMRFASSKSMTVRDALNSAMAEEMDRDDDVFIIGEEVAQYNGAYK 67

Query: 67  VTKGLLDRFGERRVVDTPITEYXXXXXXXXXXXXXXKPIVEFMSFNFSMQAIDHVVNSAA 126
           VTKGLLDRFGERRVVDTPITE               KPIVEFMSFNFSMQAIDHVVNSAA
Sbjct: 68  VTKGLLDRFGERRVVDTPITEMGFAGLAVGAALKGLKPIVEFMSFNFSMQAIDHVVNSAA 127

Query: 127 KTHYMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWYGSIPGLKVLVPYSAEDARGLLK 186
           KT+YMSGG Q CQIVFRGPNG+AVGVAAQHSQDY+AWYGSIPGLKVL PYSAEDARGLLK
Sbjct: 128 KTYYMSGGVQTCQIVFRGPNGAAVGVAAQHSQDYTAWYGSIPGLKVLCPYSAEDARGLLK 187

Query: 187 AAIRDPNPVVFLENELLYGEQFEVSEEALSPDFTLPYTAKVEKEGKDISIITYTRNTEFS 246
           AAIRDPNPVVFLENELLYGE FEVSEE LSPDFTLPYT+KVE+EG DISIITY+RN +FS
Sbjct: 188 AAIRDPNPVVFLENELLYGESFEVSEEVLSPDFTLPYTSKVEREGTDISIITYSRNVQFS 247

Query: 247 LAAAKILEEKYGVSAEVINLRSIRPLDIDAIVKTVKKTNHLITVESTFPSFGVGAEIIAQ 306
           LAAA+IL+++YGVSAEVIN+RSIRPLDIDAI+KTVKKTNHLITVE+TFP+FGVG+EIIAQ
Sbjct: 248 LAAAEILDKQYGVSAEVINMRSIRPLDIDAIIKTVKKTNHLITVEATFPAFGVGSEIIAQ 307

Query: 307 VMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPDPETIVRAAKE 353
           +MESEAFD+LDAP+QRVTGADVPTPYAKELEDFAFPDP+TIVRAAK+
Sbjct: 308 IMESEAFDHLDAPVQRVTGADVPTPYAKELEDFAFPDPDTIVRAAKQ 354

>Sklu_2171.4 YBR221C, Contig c2171 8787-9875
          Length = 362

 Score =  593 bits (1528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/353 (81%), Positives = 313/353 (88%), Gaps = 3/353 (0%)

Query: 4   FRTPLTRLTPMARLATR-SAVRMASTKT--MTVREALNSALAEELDRDDDVFIIGEEVAQ 60
           F   + R   +A    R +A RMASTKT  MTVREALNSA+AEELDRDDDVFIIGEEVAQ
Sbjct: 5   FSAAVARTAKLAAAPFRLNATRMASTKTTKMTVREALNSAMAEELDRDDDVFIIGEEVAQ 64

Query: 61  YNGAYKVTKGLLDRFGERRVVDTPITEYXXXXXXXXXXXXXXKPIVEFMSFNFSMQAIDH 120
           YNGAYKVTKGLLDR+GERRVVDTPITE               KP+VEFMSFNFSMQAIDH
Sbjct: 65  YNGAYKVTKGLLDRYGERRVVDTPITEMGFTGLAVGAALKGLKPVVEFMSFNFSMQAIDH 124

Query: 121 VVNSAAKTHYMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWYGSIPGLKVLVPYSAED 180
           VVNSAAKT+YMSGGTQKCQIVFRGPNG+AVGV AQHSQDY+AWYGSIPGLKVL PYSAED
Sbjct: 125 VVNSAAKTYYMSGGTQKCQIVFRGPNGAAVGVGAQHSQDYTAWYGSIPGLKVLSPYSAED 184

Query: 181 ARGLLKAAIRDPNPVVFLENELLYGEQFEVSEEALSPDFTLPYTAKVEKEGKDISIITYT 240
           ARGLLKAAIRDPNPVVFLENELLYGE F+VSEE LS DFTLPYTAKVE+EG DISI+TYT
Sbjct: 185 ARGLLKAAIRDPNPVVFLENELLYGESFDVSEEVLSTDFTLPYTAKVEREGSDISIVTYT 244

Query: 241 RNTEFSLAAAKILEEKYGVSAEVINLRSIRPLDIDAIVKTVKKTNHLITVESTFPSFGVG 300
           RN +FSL AA+ILE+++GVS EV+NLRSIRPLD+DAI+KTVKKTNHLITVESTFP+FGVG
Sbjct: 245 RNVQFSLQAAEILEKQHGVSVEVVNLRSIRPLDVDAIIKTVKKTNHLITVESTFPAFGVG 304

Query: 301 AEIIAQVMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPDPETIVRAAKE 353
           +EIIAQ+MESEAFDYLDAP+QRVTGADVPTPYAKELEDFAFPDP+TIVRA K+
Sbjct: 305 SEIIAQIMESEAFDYLDAPVQRVTGADVPTPYAKELEDFAFPDPDTIVRAVKK 357

>KLLA0F09603g complement(882778..883842) highly similar to sp|P32473
           Saccharomyces cerevisiae YBR221c PDB1 pyruvate
           dehydrogenase (lipoamide) beta chain precursor
           singleton, start by similarity
          Length = 354

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/352 (80%), Positives = 311/352 (88%), Gaps = 4/352 (1%)

Query: 1   MLQFRTPLTRLTPMARLATRSAVRMASTKTMTVREALNSALAEELDRDDDVFIIGEEVAQ 60
           M+       R  P    +   ++R ASTKTMTVREALNSA+AEE+DRDDDVFIIGEEVAQ
Sbjct: 1   MMMLSNTFKRAVP----SVVQSMRFASTKTMTVREALNSAMAEEMDRDDDVFIIGEEVAQ 56

Query: 61  YNGAYKVTKGLLDRFGERRVVDTPITEYXXXXXXXXXXXXXXKPIVEFMSFNFSMQAIDH 120
           YNGAYKVTKGLLDRFGERRVVDTPITE               KPIVEFMSFNFSMQA+D 
Sbjct: 57  YNGAYKVTKGLLDRFGERRVVDTPITEMGFTGLAVGAALKGLKPIVEFMSFNFSMQAMDQ 116

Query: 121 VVNSAAKTHYMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWYGSIPGLKVLVPYSAED 180
           V+NSAAKT+YMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWYGS+PG+KVLVPYSAED
Sbjct: 117 VINSAAKTYYMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWYGSVPGMKVLVPYSAED 176

Query: 181 ARGLLKAAIRDPNPVVFLENELLYGEQFEVSEEALSPDFTLPYTAKVEKEGKDISIITYT 240
           ARGLLKAAIRDPNPVVFLENELLYG+ FEVSEE+LS DFTLPY AKVE+EG DISII+YT
Sbjct: 177 ARGLLKAAIRDPNPVVFLENELLYGQSFEVSEESLSTDFTLPYKAKVEREGSDISIISYT 236

Query: 241 RNTEFSLAAAKILEEKYGVSAEVINLRSIRPLDIDAIVKTVKKTNHLITVESTFPSFGVG 300
           RN +FSL AA+IL ++YGVSAEVINLR+IRPLD++AI+ TVKKTNHLITVESTFP+FGVG
Sbjct: 237 RNVQFSLEAAEILSKQYGVSAEVINLRAIRPLDVEAIINTVKKTNHLITVESTFPAFGVG 296

Query: 301 AEIIAQVMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPDPETIVRAAK 352
           AEIIAQ+MESEAFDYLDAPIQRVTGA+VPTPYAKELEDFAFPDP+TIVRAAK
Sbjct: 297 AEIIAQIMESEAFDYLDAPIQRVTGAEVPTPYAKELEDFAFPDPDTIVRAAK 348

>Kwal_14.1789
          Length = 363

 Score =  588 bits (1516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/329 (84%), Positives = 303/329 (92%)

Query: 24  RMASTKTMTVREALNSALAEELDRDDDVFIIGEEVAQYNGAYKVTKGLLDRFGERRVVDT 83
           R+ASTKTMTVR+ALNSA+AEE+DRDDDVFIIGEEVAQYNGAYKVTKGLLDRFGERRVVDT
Sbjct: 29  RLASTKTMTVRDALNSAMAEEMDRDDDVFIIGEEVAQYNGAYKVTKGLLDRFGERRVVDT 88

Query: 84  PITEYXXXXXXXXXXXXXXKPIVEFMSFNFSMQAIDHVVNSAAKTHYMSGGTQKCQIVFR 143
           PITE               KPIVEFMSFNFSMQAID VVNSAAKT+YMSGGTQKCQIVFR
Sbjct: 89  PITEMGFTGLSVGAALKGLKPIVEFMSFNFSMQAIDQVVNSAAKTYYMSGGTQKCQIVFR 148

Query: 144 GPNGSAVGVAAQHSQDYSAWYGSIPGLKVLVPYSAEDARGLLKAAIRDPNPVVFLENELL 203
           GPNG+AVGV AQHSQD+SAWYGSIPG+KVLVPYSAEDARGLLKAAIRDPNPVVFLENELL
Sbjct: 149 GPNGAAVGVGAQHSQDFSAWYGSIPGMKVLVPYSAEDARGLLKAAIRDPNPVVFLENELL 208

Query: 204 YGEQFEVSEEALSPDFTLPYTAKVEKEGKDISIITYTRNTEFSLAAAKILEEKYGVSAEV 263
           YGE FEVSEE LS DFTLPYTAKVE+EG DISIITYTRN +FSL AA+IL+++YGVSAEV
Sbjct: 209 YGESFEVSEECLSTDFTLPYTAKVEREGTDISIITYTRNVQFSLQAAEILDKQYGVSAEV 268

Query: 264 INLRSIRPLDIDAIVKTVKKTNHLITVESTFPSFGVGAEIIAQVMESEAFDYLDAPIQRV 323
           INLRSIRP+D++AI+KTVKKTNHLITVESTFP+FGVG+EI+AQ+MESEAFDYLDAP++RV
Sbjct: 269 INLRSIRPMDVNAIIKTVKKTNHLITVESTFPNFGVGSEIVAQIMESEAFDYLDAPVKRV 328

Query: 324 TGADVPTPYAKELEDFAFPDPETIVRAAK 352
           TGADVPTPYAKELEDFAFPDP+ IV A K
Sbjct: 329 TGADVPTPYAKELEDFAFPDPDVIVSAVK 357

>Sklu_2101.3 YMR171C, Contig c2101 5004-6710
          Length = 568

 Score = 31.6 bits (70), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 36/69 (52%), Gaps = 8/69 (11%)

Query: 172 VLVPYSAEDARGLLKAAIRDPNPVVFLENELLYGEQFEVSEEALSPDFTLPYTAKVEKEG 231
           +L+P+ +ED++G+L   I D   + F+E E ++  +F+       PD  LP    + +  
Sbjct: 194 LLIPHRSEDSQGMLDPIIND-QTIRFIEEEGVHAWEFQ-------PDPNLPNDTILIENK 245

Query: 232 KDISIITYT 240
            +I+ + Y 
Sbjct: 246 TEITFLNYN 254

>Scas_696.42
          Length = 625

 Score = 30.0 bits (66), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 25/56 (44%), Gaps = 13/56 (23%)

Query: 295 PSFGVGAEIIAQVME-----SEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPDPE 345
           P  GVGAEI A+V        E  DYL    QR+     PT         +FP+PE
Sbjct: 256 PMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPT--------VSFPNPE 303

>KLLA0A06996g 631799..632410 some similarities with
           ca|CA3119|IPF5360.3 Candida albicans unknown function,
           3-prime end, hypothetical start
          Length = 203

 Score = 28.9 bits (63), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 233 DISIITYTRNTEFSLAAAKILEEKYG---VSAEVINLRSIRPLDIDAIVKTVKKT 284
           DI  I Y  N+  +LA  + L +KYG   ++A  + L S+ P     +VK +K+T
Sbjct: 149 DIVGIAYKANSRNTLALEQYLRKKYGGETIAASPVELGSVSPGRDPDLVKGLKQT 203

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.133    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,209,533
Number of extensions: 402320
Number of successful extensions: 1144
Number of sequences better than 10.0: 13
Number of HSP's gapped: 1166
Number of HSP's successfully gapped: 13
Length of query: 353
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 250
Effective length of database: 13,030,455
Effective search space: 3257613750
Effective search space used: 3257613750
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)