Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0K06787g1175115758230.0
CAGL0F06941g1180115451560.0
YBR218C (PYC2)1180115951200.0
YGL062W (PYC1)1178115750270.0
Scas_686.171176115050220.0
KLLA0C05764g1173115450210.0
Kwal_14.18031174115249380.0
Scas_563.121216116249340.0
AAR162C1171115148570.0
Sklu_1458.11132111448050.0
CAGL0M05533g18344568072e-88
Scas_721.4018344387379e-80
YBR208C (DUR1,2)18354487281e-78
Sklu_2124.118304597131e-76
KLLA0E08107g18294467084e-76
ADR051C18194617059e-76
Kwal_27.1195118694596915e-74
AAR071W22315685356e-55
CAGL0L10780g22335385331e-54
Scas_720.7422315385312e-54
KLLA0F06072g22315635204e-53
YNR016C (ACC1)22335275142e-52
YMR207C (HFA1)21234345099e-52
Kwal_23.615722305285081e-51
ABR157W11133221475e-09
Kwal_55.1978311212411412e-08
Sklu_2413.411222401252e-06
Sklu_2331.122203481252e-06
Kwal_33.1406122213341224e-06
KLLA0F03190g11172391207e-06
CAGL0L05676g22113361162e-05
Scas_582.4*21933041134e-05
ACR263C22403301126e-05
Scas_691.1911172381126e-05
YJL130C (URA2)22143291091e-04
YJR109C (CPA2)11182391045e-04
CAGL0C04917g1113193990.002
KLLA0E15444g2228306930.011
Kwal_27.1209039475860.050
KLLA0E23782g39398850.065
Scas_701.3543075830.12
Kwal_56.2440144175810.21
Kwal_47.1923179568810.27
KLLA0F05489g44175800.27
Sklu_2431.239498770.51
YDL131W (LYS21)44075780.53
CAGL0J09240g43775770.60
Scas_704.343875770.65
CAGL0J06402g43175770.69
ADR107W44275760.79
YDL182W (LYS20)42875760.85
AGR127C56258704.1
YLR432W (IMD3)523131704.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0K06787g
         (1157 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0K06787g complement(659290..662817) highly similar to sp|P32...  2247   0.0  
CAGL0F06941g 679960..683502 highly similar to sp|P11154 Saccharo...  1990   0.0  
YBR218C (PYC2) [399] chr2 complement(658664..662206) Pyruvate ca...  1976   0.0  
YGL062W (PYC1) [1917] chr7 (385197..388733) Pyruvate carboxylase...  1941   0.0  
Scas_686.17                                                          1939   0.0  
KLLA0C05764g complement(512470..515991) highly similar to sp|P32...  1938   0.0  
Kwal_14.1803                                                         1906   0.0  
Scas_563.12                                                          1905   0.0  
AAR162C [350] [Homologous to ScYGL062W (PYC1) - SH; ScYBR218C (P...  1875   0.0  
Sklu_1458.1 YGL062W, Contig c1458 155-3553 reverse complement        1855   0.0  
CAGL0M05533g complement(588667..594171) similar to sp|P32528 Sac...   315   2e-88
Scas_721.40                                                           288   9e-80
YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea amid...   285   1e-78
Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement          279   1e-76
KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharo...   277   4e-76
ADR051C [1792] [Homologous to ScYBR208C (DUR12) - SH] (796213..8...   276   9e-76
Kwal_27.11951                                                         270   5e-74
AAR071W [257] [Homologous to ScYNR016C (ACC1) - SH; ScYMR207C (H...   210   6e-55
CAGL0L10780g complement(1149588..1156289) highly similar to sp|Q...   209   1e-54
Scas_720.74                                                           209   2e-54
KLLA0F06072g 583276..589971 highly similar to sp|Q00955 Saccharo...   204   4e-53
YNR016C (ACC1) [4599] chr14 complement(654672..661373) Acetyl-Co...   202   2e-52
YMR207C (HFA1) [4163] chr13 complement(677192..683563) Protein w...   200   9e-52
Kwal_23.6157                                                          200   1e-51
ABR157W [750] [Homologous to ScYJR109C (CPA2) - SH] complement(6...    61   5e-09
Kwal_55.19783                                                          59   2e-08
Sklu_2413.4 YJR109C, Contig c2413 10886-14254                          53   2e-06
Sklu_2331.1 YJL130C, Contig c2331 2029-8691                            53   2e-06
Kwal_33.14061                                                          52   4e-06
KLLA0F03190g complement(296883..300236) highly similar to sp|P03...    51   7e-06
CAGL0L05676g 619734..626369 highly similar to sp|P07259 Saccharo...    49   2e-05
Scas_582.4*                                                            48   4e-05
ACR263C [1310] [Homologous to ScYJL130C (URA2) - SH] (827830..83...    48   6e-05
Scas_691.19                                                            48   6e-05
YJL130C (URA2) [2788] chr10 complement(165641..172285) Multifunc...    47   1e-04
YJR109C (CPA2) [3001] chr10 complement(629500..632856) Carbamoyl...    45   5e-04
CAGL0C04917g 457506..460847 highly similar to sp|P03965 Saccharo...    43   0.002
KLLA0E15444g 1370741..1377427 highly similar to sp|P07259 Saccha...    40   0.011
Kwal_27.12090                                                          38   0.050
KLLA0E23782g complement(2105401..2106582) highly similar to sp|Q...    37   0.065
Scas_701.35                                                            37   0.12 
Kwal_56.24401                                                          36   0.21 
Kwal_47.19231                                                          36   0.27 
KLLA0F05489g 541146..542471 highly similar to sp|Q12122 Saccharo...    35   0.27 
Sklu_2431.2 YDL131W, Contig c2431 3030-4214                            34   0.51 
YDL131W (LYS21) [738] chr4 (227393..228715) Homocitrate synthase...    35   0.53 
CAGL0J09240g 911669..912982 highly similar to sp|Q12122 Saccharo...    34   0.60 
Scas_704.3                                                             34   0.65 
CAGL0J06402g complement(608851..610146) highly similar to sp|Q12...    34   0.69 
ADR107W [1848] [Homologous to ScYDL131W (LYS21) - SH; ScYDL182W ...    34   0.79 
YDL182W (LYS20) [690] chr4 (133438..134724) Homocitrate synthase...    34   0.85 
AGR127C [4438] [Homologous to ScYDR062W (LCB2) - SH] (992732..99...    32   4.1  
YLR432W (IMD3) [3807] chr12 (1002553..1004124) Protein highly si...    32   4.8  

>CAGL0K06787g complement(659290..662817) highly similar to sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2 Pyruvate
            carboxylase 2, start by similarity
          Length = 1175

 Score = 2247 bits (5823), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1096/1157 (94%), Positives = 1096/1157 (94%)

Query: 1    MATNKMLTGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHR 60
            MATNKMLTGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHR
Sbjct: 1    MATNKMLTGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHR 60

Query: 61   LKADEAYVIGKEGEYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKAG 120
            LKADEAYVIGKEGEYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKAG
Sbjct: 61   LKADEAYVIGKEGEYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKAG 120

Query: 121  ITWIGPPPEVIESVGDKVSARNLAAKANVPTVPGTPGPIETVEEAQDFVNKYGYPVIIKA 180
            ITWIGPPPEVIESVGDKVSARNLAAKANVPTVPGTPGPIETVEEAQDFVNKYGYPVIIKA
Sbjct: 121  ITWIGPPPEVIESVGDKVSARNLAAKANVPTVPGTPGPIETVEEAQDFVNKYGYPVIIKA 180

Query: 181  AYXXXXXXXXXXXXXXXXADAFQRAKSEAITAFGNGTCFVERFLDKPKHIEVQLLADNHG 240
            AY                ADAFQRAKSEAITAFGNGTCFVERFLDKPKHIEVQLLADNHG
Sbjct: 181  AYGGGGRGMRVVREGDDVADAFQRAKSEAITAFGNGTCFVERFLDKPKHIEVQLLADNHG 240

Query: 241  NVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDSILTDAVRLAKEAGYRNAGTAEFLVD 300
            NVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDSILTDAVRLAKEAGYRNAGTAEFLVD
Sbjct: 241  NVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDSILTDAVRLAKEAGYRNAGTAEFLVD 300

Query: 301  NQNRHYFIEINPRIQVEHTITEEITGIDLVSAQIQIAAGASLPQLGLLQDRITTRGFAIQ 360
            NQNRHYFIEINPRIQVEHTITEEITGIDLVSAQIQIAAGASLPQLGLLQDRITTRGFAIQ
Sbjct: 301  NQNRHYFIEINPRIQVEHTITEEITGIDLVSAQIQIAAGASLPQLGLLQDRITTRGFAIQ 360

Query: 361  CRITTEDPAKNFQPDTGRLEVYRSAGGNGVRLDGGTAYAGAVISPHYDSMLVKCSCSGST 420
            CRITTEDPAKNFQPDTGRLEVYRSAGGNGVRLDGGTAYAGAVISPHYDSMLVKCSCSGST
Sbjct: 361  CRITTEDPAKNFQPDTGRLEVYRSAGGNGVRLDGGTAYAGAVISPHYDSMLVKCSCSGST 420

Query: 421  YEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFHMVSSRN 480
            YEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFHMVSSRN
Sbjct: 421  YEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFHMVSSRN 480

Query: 481  RAQKLLHYLADLAVNGSSIKGQIGEPKLKTHPQIPRLHDEDGSPVDVSVPPQKGWRYLLQ 540
            RAQKLLHYLADLAVNGSSIKGQIGEPKLKTHPQIPRLHDEDGSPVDVSVPPQKGWRYLLQ
Sbjct: 481  RAQKLLHYLADLAVNGSSIKGQIGEPKLKTHPQIPRLHDEDGSPVDVSVPPQKGWRYLLQ 540

Query: 541  SEGPEAFAKAVRHNQGTLVMDTTWRDAHQSLLATRVRTYDLXXXXXXXXXXXXXXXXLEC 600
            SEGPEAFAKAVRHNQGTLVMDTTWRDAHQSLLATRVRTYDL                LEC
Sbjct: 541  SEGPEAFAKAVRHNQGTLVMDTTWRDAHQSLLATRVRTYDLAAIAQTTAHAFAGAFALEC 600

Query: 601  WGGATFDVAMRFLHEDPWERLRILRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQA 660
            WGGATFDVAMRFLHEDPWERLRILRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQA
Sbjct: 601  WGGATFDVAMRFLHEDPWERLRILRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQA 660

Query: 661  KDNGVDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCYSGDMLQPGKKYNLDYYLDVT 720
            KDNGVDIFRVFDALNDLEQL                  CYSGDMLQPGKKYNLDYYLDVT
Sbjct: 661  KDNGVDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLDVT 720

Query: 721  EKIVAMGTHILGIKDMAGTMKPAAAKLLIGAIRAKFPDLPIHVHSHDSAGTAVASMAACA 780
            EKIVAMGTHILGIKDMAGTMKPAAAKLLIGAIRAKFPDLPIHVHSHDSAGTAVASMAACA
Sbjct: 721  EKIVAMGTHILGIKDMAGTMKPAAAKLLIGAIRAKFPDLPIHVHSHDSAGTAVASMAACA 780

Query: 781  LAGADVVDVAINSMSGLTSQASVNAVLASLDGQIDTGINVKHVCELDAYWAEMRLLYSCF 840
            LAGADVVDVAINSMSGLTSQASVNAVLASLDGQIDTGINVKHVCELDAYWAEMRLLYSCF
Sbjct: 781  LAGADVVDVAINSMSGLTSQASVNAVLASLDGQIDTGINVKHVCELDAYWAEMRLLYSCF 840

Query: 841  EADLKGPDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKKAYKQANQLLGDIVKVTPT 900
            EADLKGPDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKKAYKQANQLLGDIVKVTPT
Sbjct: 841  EADLKGPDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKKAYKQANQLLGDIVKVTPT 900

Query: 901  SKVVGDLAQFMVSNQLTPDDIRRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRTDIXXX 960
            SKVVGDLAQFMVSNQLTPDDIRRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRTDI   
Sbjct: 901  SKVVGDLAQFMVSNQLTPDDIRRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRTDILKN 960

Query: 961  XXXXXXXXPGLELAPFDLAKIREDLEARFGDINECDVASYNMYPKVYEDFQKILEEYGDL 1020
                    PGLELAPFDLAKIREDLEARFGDINECDVASYNMYPKVYEDFQKILEEYGDL
Sbjct: 961  KRRKLNRRPGLELAPFDLAKIREDLEARFGDINECDVASYNMYPKVYEDFQKILEEYGDL 1020

Query: 1021 SVLPTRNFLAKPRVGEEIEVHIEQGKTLIIKLQAVGDLNEETGIREVYFELNGETRKIRI 1080
            SVLPTRNFLAKPRVGEEIEVHIEQGKTLIIKLQAVGDLNEETGIREVYFELNGETRKIRI
Sbjct: 1021 SVLPTRNFLAKPRVGEEIEVHIEQGKTLIIKLQAVGDLNEETGIREVYFELNGETRKIRI 1080

Query: 1081 ADKSQVVQTIAKPKADGHDPLQIGAPMAGVIVEVKVHKGSQVKKGQPVAVLSAMKMEMVI 1140
            ADKSQVVQTIAKPKADGHDPLQIGAPMAGVIVEVKVHKGSQVKKGQPVAVLSAMKMEMVI
Sbjct: 1081 ADKSQVVQTIAKPKADGHDPLQIGAPMAGVIVEVKVHKGSQVKKGQPVAVLSAMKMEMVI 1140

Query: 1141 SSTGEGLVKDVLVKDGE 1157
            SSTGEGLVKDVLVKDGE
Sbjct: 1141 SSTGEGLVKDVLVKDGE 1157

>CAGL0F06941g 679960..683502 highly similar to sp|P11154 Saccharomyces
            cerevisiae YGL062w PYC1 pyruvate carboxylase or sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2, hypothetical start
          Length = 1180

 Score = 1990 bits (5156), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 968/1154 (83%), Positives = 1033/1154 (89%), Gaps = 1/1154 (0%)

Query: 5    KMLTGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKAD 64
            K L GLR NF++LGEK+KILVANRGEIPIRIFR+AHELSMRTVAIYSHEDRLSTHRLKAD
Sbjct: 8    KKLAGLRANFNILGEKDKILVANRGEIPIRIFRTAHELSMRTVAIYSHEDRLSTHRLKAD 67

Query: 65   EAYVIGKEGEYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKAGITWI 124
            EAYVIG+EG+YTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSEN+EFADKVQKAGITWI
Sbjct: 68   EAYVIGEEGQYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQKAGITWI 127

Query: 125  GPPPEVIESVGDKVSARNLAAKANVPTVPGTPGPIETVEEAQDFVNKYGYPVIIKAAYXX 184
            GPPPEVIESVGDKVSARNLAAKA VPTVPGTPGPI+TVEEA+ FV +YGYPVIIKAAY  
Sbjct: 128  GPPPEVIESVGDKVSARNLAAKAKVPTVPGTPGPIKTVEEAEAFVAEYGYPVIIKAAYGG 187

Query: 185  XXXXXXXXXXXXXXADAFQRAKSEAITAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVH 244
                           DAFQRA SEA TAFGNGTCFVERFLDKPKHIEVQLLADNHGNV+H
Sbjct: 188  GGRGMRVVREGEDIGDAFQRATSEAKTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVIH 247

Query: 245  LFERDCSVQRRHQKVVEVAPAKTLPREVRDSILTDAVRLAKEAGYRNAGTAEFLVDNQNR 304
            LFERDCSVQRRHQKVVEVAPAKTLPR+VRD+ILTDAV+LAKEAGYRNAGTAEFLVDNQNR
Sbjct: 248  LFERDCSVQRRHQKVVEVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQNR 307

Query: 305  HYFIEINPRIQVEHTITEEITGIDLVSAQIQIAAGASLPQLGLLQDRITTRGFAIQCRIT 364
            HYFIEINPRIQVEHTITEEITGID+V+AQIQIAAGASL +LGLLQDRITTRGFAIQCRIT
Sbjct: 308  HYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLTELGLLQDRITTRGFAIQCRIT 367

Query: 365  TEDPAKNFQPDTGRLEVYRSAGGNGVRLDGGTAYAGAVISPHYDSMLVKCSCSGSTYEIV 424
            TEDPAKNFQPDTGR+EVY S GGNGVRLDGG AYAGAVISPHYDSMLVKCSCSGSTYEIV
Sbjct: 368  TEDPAKNFQPDTGRIEVYGSTGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIV 427

Query: 425  RRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFHMVSSRNRAQK 484
            RRK++RALIEFRIRGVKTNIPFLLTLLTHPVFISG YWTTFIDDTPQLFHMVSS+NRAQK
Sbjct: 428  RRKIIRALIEFRIRGVKTNIPFLLTLLTHPVFISGQYWTTFIDDTPQLFHMVSSQNRAQK 487

Query: 485  LLHYLADLAVNGSSIKGQIGEPKLKTHPQIPRLHDEDGSPVDVS-VPPQKGWRYLLQSEG 543
            LLHYLADLAVNGSSIKGQIG PKL T P IP LHDE G  + V+ V P  GWR +L  +G
Sbjct: 488  LLHYLADLAVNGSSIKGQIGLPKLSTKPNIPHLHDEKGEIISVTKVAPPDGWRQVLLEKG 547

Query: 544  PEAFAKAVRHNQGTLVMDTTWRDAHQSLLATRVRTYDLXXXXXXXXXXXXXXXXLECWGG 603
            PE FAKAVR  +GTL+MDTTWRDAHQSLLATRVRT+DL                LECWGG
Sbjct: 548  PEGFAKAVRAFKGTLLMDTTWRDAHQSLLATRVRTHDLAAIAPTTAHALAGAFALECWGG 607

Query: 604  ATFDVAMRFLHEDPWERLRILRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDN 663
            ATFDVAMRFLHEDPWERLR+LRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDN
Sbjct: 608  ATFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDN 667

Query: 664  GVDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCYSGDMLQPGKKYNLDYYLDVTEKI 723
            GVDIFRVFDALNDLEQL                  CYSGDMLQPGKKYNLDYYL+VT+KI
Sbjct: 668  GVDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLEVTDKI 727

Query: 724  VAMGTHILGIKDMAGTMKPAAAKLLIGAIRAKFPDLPIHVHSHDSAGTAVASMAACALAG 783
            V MGTH+LGIKDMAGT+KP AAKLLIG+IRAK+PDLPIHVHSHDSAGTAVASMAACA AG
Sbjct: 728  VEMGTHVLGIKDMAGTLKPTAAKLLIGSIRAKYPDLPIHVHSHDSAGTAVASMAACAFAG 787

Query: 784  ADVVDVAINSMSGLTSQASVNAVLASLDGQIDTGINVKHVCELDAYWAEMRLLYSCFEAD 843
            ADVVDVAINSMSG+TSQAS+NA+LASLDG+IDTG+NVKH  ELDAYWAEMRLLYSCFEAD
Sbjct: 788  ADVVDVAINSMSGMTSQASINALLASLDGEIDTGVNVKHARELDAYWAEMRLLYSCFEAD 847

Query: 844  LKGPDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKKAYKQANQLLGDIVKVTPTSKV 903
            LKGPDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETK+AYK+AN LLGDIVKVTPTSKV
Sbjct: 848  LKGPDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKRAYKEANHLLGDIVKVTPTSKV 907

Query: 904  VGDLAQFMVSNQLTPDDIRRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRTDIXXXXXX 963
            VGDLAQFMV+NQLT +D++RLANSLDFPDSVMDFFEGLMGQPYGGFPEPLR+DI      
Sbjct: 908  VGDLAQFMVTNQLTSEDVKRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRSDILRNKRR 967

Query: 964  XXXXXPGLELAPFDLAKIREDLEARFGDINECDVASYNMYPKVYEDFQKILEEYGDLSVL 1023
                 PGLEL PFDL  IREDLE RFG+I+ECDVASYNMYPKVYEDFQK+ E YGDLSVL
Sbjct: 968  KLTVRPGLELEPFDLESIREDLENRFGEIDECDVASYNMYPKVYEDFQKMKELYGDLSVL 1027

Query: 1024 PTRNFLAKPRVGEEIEVHIEQGKTLIIKLQAVGDLNEETGIREVYFELNGETRKIRIADK 1083
            PT+NFLA P +GE+IEVH+EQGKTLIIKLQAVGDLN+ETG+R+VYFELNGE RKIR+ D+
Sbjct: 1028 PTKNFLAPPSIGEDIEVHLEQGKTLIIKLQAVGDLNKETGMRDVYFELNGEMRKIRVPDR 1087

Query: 1084 SQVVQTIAKPKADGHDPLQIGAPMAGVIVEVKVHKGSQVKKGQPVAVLSAMKMEMVISST 1143
            SQ V+ ++KPKAD HDP QIGAPMAGVIVEVKVHKGS VKKGQPVA+LSAMKMEMV+SS 
Sbjct: 1088 SQKVEKVSKPKADNHDPFQIGAPMAGVIVEVKVHKGSLVKKGQPVAILSAMKMEMVVSSQ 1147

Query: 1144 GEGLVKDVLVKDGE 1157
             +G VKDV VKD E
Sbjct: 1148 ADGQVKDVFVKDAE 1161

>YBR218C (PYC2) [399] chr2 complement(658664..662206) Pyruvate
            carboxylase 2 [3543 bp, 1180 aa]
          Length = 1180

 Score = 1976 bits (5120), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 957/1159 (82%), Positives = 1025/1159 (88%), Gaps = 3/1159 (0%)

Query: 1    MATNKMLTGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHR 60
            M+++K L GLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRT+AIYSHEDRLS HR
Sbjct: 1    MSSSKKLAGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTIAIYSHEDRLSMHR 60

Query: 61   LKADEAYVIGKEGEYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKAG 120
            LKADEAYVIG+EG+YTPVGAYLA+DEII+IAKKH VDFIHPGYGFLSEN+EFADKV KAG
Sbjct: 61   LKADEAYVIGEEGQYTPVGAYLAMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVVKAG 120

Query: 121  ITWIGPPPEVIESVGDKVSARNLAAKANVPTVPGTPGPIETVEEAQDFVNKYGYPVIIKA 180
            ITWIGPP EVI+SVGDKVSAR+LAA+ANVPTVPGTPGPIETV+EA DFVN+YGYPVIIKA
Sbjct: 121  ITWIGPPAEVIDSVGDKVSARHLAARANVPTVPGTPGPIETVQEALDFVNEYGYPVIIKA 180

Query: 181  AYXXXXXXXXXXXXXXXXADAFQRAKSEAITAFGNGTCFVERFLDKPKHIEVQLLADNHG 240
            A+                ADAFQRA SEA TAFGNGTCFVERFLDKPKHIEVQLLADNHG
Sbjct: 181  AFGGGGRGMRVVREGDDVADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHG 240

Query: 241  NVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDSILTDAVRLAKEAGYRNAGTAEFLVD 300
            NVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRD+ILTDAV+LAK  GYRNAGTAEFLVD
Sbjct: 241  NVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEFLVD 300

Query: 301  NQNRHYFIEINPRIQVEHTITEEITGIDLVSAQIQIAAGASLPQLGLLQDRITTRGFAIQ 360
            NQNRHYFIEINPRIQVEHTITEEITGID+VSAQIQIAAGA+L QLGLLQD+ITTRGF+IQ
Sbjct: 301  NQNRHYFIEINPRIQVEHTITEEITGIDIVSAQIQIAAGATLTQLGLLQDKITTRGFSIQ 360

Query: 361  CRITTEDPAKNFQPDTGRLEVYRSAGGNGVRLDGGTAYAGAVISPHYDSMLVKCSCSGST 420
            CRITTEDP+KNFQPDTGRLEVYRSAGGNGVRLDGG AYAGA ISPHYDSMLVKCSCSGST
Sbjct: 361  CRITTEDPSKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGST 420

Query: 421  YEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFHMVSSRN 480
            YEIVRRKM+RALIEFRIRGVKTNIPFLLTLLT+PVFI G YWTTFIDDTPQLF MVSS+N
Sbjct: 421  YEIVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQN 480

Query: 481  RAQKLLHYLADLAVNGSSIKGQIGEPKLKTHPQIPRLHDEDGSPVDV--SVPPQKGWRYL 538
            RAQKLLHYLADLAVNGSSIKGQIG PKLK++P +P LHD  G+ ++V  S PP  GWR +
Sbjct: 481  RAQKLLHYLADLAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPS-GWRQV 539

Query: 539  LQSEGPEAFAKAVRHNQGTLVMDTTWRDAHQSLLATRVRTYDLXXXXXXXXXXXXXXXXL 598
            L  +GP  FAK VR   GTL+MDTTWRDAHQSLLATRVRT+DL                L
Sbjct: 540  LLEKGPSEFAKQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGAFAL 599

Query: 599  ECWGGATFDVAMRFLHEDPWERLRILRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVK 658
            ECWGGATFDVAMRFLHEDPWERLR LR LVPNIPFQMLLRGANGVAYSSLPDNAIDHFVK
Sbjct: 600  ECWGGATFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVK 659

Query: 659  QAKDNGVDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCYSGDMLQPGKKYNLDYYLD 718
            QAKDNGVDIFRVFDALNDLEQL                  CYSGDMLQPGKKYNLDYYL+
Sbjct: 660  QAKDNGVDIFRVFDALNDLEQLKVGVNAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLE 719

Query: 719  VTEKIVAMGTHILGIKDMAGTMKPAAAKLLIGAIRAKFPDLPIHVHSHDSAGTAVASMAA 778
            V EKIV MGTHILGIKDMAGTMKPAAAKLLIG++R ++PDLPIHVHSHDSAGTAVASM A
Sbjct: 720  VVEKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRTRYPDLPIHVHSHDSAGTAVASMTA 779

Query: 779  CALAGADVVDVAINSMSGLTSQASVNAVLASLDGQIDTGINVKHVCELDAYWAEMRLLYS 838
            CALAGADVVDVAINSMSGLTSQ S+NA+LASL+G IDTGINV+HV ELDAYWAEMRLLYS
Sbjct: 780  CALAGADVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYS 839

Query: 839  CFEADLKGPDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKKAYKQANQLLGDIVKVT 898
            CFEADLKGPDPEVY HEIPGGQLTNLLFQAQQLGLGE+W ETK+AY++AN LLGDIVKVT
Sbjct: 840  CFEADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVT 899

Query: 899  PTSKVVGDLAQFMVSNQLTPDDIRRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRTDIX 958
            PTSKVVGDLAQFMVSN+LT DDIRRLANSLDFPDSVMDFFEGL+GQPYGGFPEPLR+D+ 
Sbjct: 900  PTSKVVGDLAQFMVSNKLTSDDIRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVL 959

Query: 959  XXXXXXXXXXPGLELAPFDLAKIREDLEARFGDINECDVASYNMYPKVYEDFQKILEEYG 1018
                      PGLEL PFDL KIREDL+ RFGDI+ECDVASYNMYP+VYEDFQKI E YG
Sbjct: 960  RNKRRKLTCRPGLELEPFDLEKIREDLQNRFGDIDECDVASYNMYPRVYEDFQKIRETYG 1019

Query: 1019 DLSVLPTRNFLAKPRVGEEIEVHIEQGKTLIIKLQAVGDLNEETGIREVYFELNGETRKI 1078
            DLSVLPT+NFLA     EEIEV IEQGKTLIIKLQAVGDLN++TG REVYFELNGE RKI
Sbjct: 1020 DLSVLPTKNFLAPAEPDEEIEVTIEQGKTLIIKLQAVGDLNKKTGQREVYFELNGELRKI 1079

Query: 1079 RIADKSQVVQTIAKPKADGHDPLQIGAPMAGVIVEVKVHKGSQVKKGQPVAVLSAMKMEM 1138
            R+ADKSQ +Q++AKPKAD HD  QIGAPMAGVI+EVKVHKGS VKKG+ +AVLSAMKMEM
Sbjct: 1080 RVADKSQNIQSVAKPKADVHDTHQIGAPMAGVIIEVKVHKGSLVKKGESIAVLSAMKMEM 1139

Query: 1139 VISSTGEGLVKDVLVKDGE 1157
            V+SS  +G VKDV +KDGE
Sbjct: 1140 VVSSPADGQVKDVFIKDGE 1158

>YGL062W (PYC1) [1917] chr7 (385197..388733) Pyruvate carboxylase 1,
            catalyzes conversion of pyruvate to oxaloacetate in the
            gluconeogenesis pathway [3537 bp, 1178 aa]
          Length = 1178

 Score = 1941 bits (5027), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 946/1157 (81%), Positives = 1019/1157 (88%), Gaps = 3/1157 (0%)

Query: 3    TNKMLTGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLK 62
            + +   GLRDNF+LLGEKNKILVANRGEIPIRIFR+AHELSM+TVAIYSHEDRLSTH+ K
Sbjct: 2    SQRKFAGLRDNFNLLGEKNKILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLSTHKQK 61

Query: 63   ADEAYVIGKEGEYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKAGIT 122
            ADEAYVIG+ G+YTPVGAYLAIDEII IA+KH VDFIHPGYGFLSEN+EFADKV KAGIT
Sbjct: 62   ADEAYVIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGIT 121

Query: 123  WIGPPPEVIESVGDKVSARNLAAKANVPTVPGTPGPIETVEEAQDFVNKYGYPVIIKAAY 182
            WIGPP EVI+SVGDKVSARNLAAKANVPTVPGTPGPIETVEEA DFVN+YGYPVIIKAA+
Sbjct: 122  WIGPPAEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVIIKAAF 181

Query: 183  XXXXXXXXXXXXXXXXADAFQRAKSEAITAFGNGTCFVERFLDKPKHIEVQLLADNHGNV 242
                            ADAFQRA SEA TAFGNGTCFVERFLDKPKHIEVQLLADNHGNV
Sbjct: 182  GGGGRGMRVVREGDDVADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNV 241

Query: 243  VHLFERDCSVQRRHQKVVEVAPAKTLPREVRDSILTDAVRLAKEAGYRNAGTAEFLVDNQ 302
            VHLFERDCSVQRRHQKVVEVAPAKTLPREVRD+ILTDAV+LAKE GYRNAGTAEFLVDNQ
Sbjct: 242  VHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQ 301

Query: 303  NRHYFIEINPRIQVEHTITEEITGIDLVSAQIQIAAGASLPQLGLLQDRITTRGFAIQCR 362
            NRHYFIEINPRIQVEHTITEEITGID+V+AQIQIAAGASLPQLGL QD+ITTRGFAIQCR
Sbjct: 302  NRHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLPQLGLFQDKITTRGFAIQCR 361

Query: 363  ITTEDPAKNFQPDTGRLEVYRSAGGNGVRLDGGTAYAGAVISPHYDSMLVKCSCSGSTYE 422
            ITTEDPAKNFQPDTGR+EVYRSAGGNGVRLDGG AYAG +ISPHYDSMLVKCSCSGSTYE
Sbjct: 362  ITTEDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGSTYE 421

Query: 423  IVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFHMVSSRNRA 482
            IVRRKM+RALIEFRIRGVKTNIPFLLTLLT+PVFI G YWTTFIDDTPQLF MVSS+NRA
Sbjct: 422  IVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNRA 481

Query: 483  QKLLHYLADLAVNGSSIKGQIGEPKLKTHPQIPRLHDEDGSPVDV--SVPPQKGWRYLLQ 540
            QKLLHYLAD+AVNGSSIKGQIG PKLK++P +P LHD  G+ ++V  S PP  GWR +L 
Sbjct: 482  QKLLHYLADVAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPS-GWRQVLL 540

Query: 541  SEGPEAFAKAVRHNQGTLVMDTTWRDAHQSLLATRVRTYDLXXXXXXXXXXXXXXXXLEC 600
             +GP  FA+ VR   GTL+MDTTWRDAHQSLLATRVRT+DL                LEC
Sbjct: 541  EKGPAEFARQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGRFALEC 600

Query: 601  WGGATFDVAMRFLHEDPWERLRILRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQA 660
            WGGATFDVAMRFLHEDPWERLR LR LVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQA
Sbjct: 601  WGGATFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQA 660

Query: 661  KDNGVDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCYSGDMLQPGKKYNLDYYLDVT 720
            KDNGVDIFRVFDALNDLEQL                  C+SGDMLQPGKKYNLDYYL++ 
Sbjct: 661  KDNGVDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCFSGDMLQPGKKYNLDYYLEIA 720

Query: 721  EKIVAMGTHILGIKDMAGTMKPAAAKLLIGAIRAKFPDLPIHVHSHDSAGTAVASMAACA 780
            EKIV MGTHILGIKDMAGTMKPAAAKLLIG++RAK+PDLPIHVH+HDSAGTAVASM ACA
Sbjct: 721  EKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYPDLPIHVHTHDSAGTAVASMTACA 780

Query: 781  LAGADVVDVAINSMSGLTSQASVNAVLASLDGQIDTGINVKHVCELDAYWAEMRLLYSCF 840
            LAGADVVDVAINSMSGLTSQ S+NA+LASL+G IDTGINV+HV ELDAYWAEMRLLYSCF
Sbjct: 781  LAGADVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSCF 840

Query: 841  EADLKGPDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKKAYKQANQLLGDIVKVTPT 900
            EADLKGPDPEVY HEIPGGQLTNLLFQAQQLGLGE+W ETK+AY++AN LLGDIVKVTPT
Sbjct: 841  EADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPT 900

Query: 901  SKVVGDLAQFMVSNQLTPDDIRRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRTDIXXX 960
            SKVVGDLAQFMVSN+LT DD+RRLANSLDFPDSVMDFFEGL+GQPYGGFPEP R+D+   
Sbjct: 901  SKVVGDLAQFMVSNKLTSDDVRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPFRSDVLRN 960

Query: 961  XXXXXXXXPGLELAPFDLAKIREDLEARFGDINECDVASYNMYPKVYEDFQKILEEYGDL 1020
                    PGLEL PFDL KIREDL+ RFGD++ECDVASYNMYP+VYEDFQK+ E YGDL
Sbjct: 961  KRRKLTCRPGLELEPFDLEKIREDLQNRFGDVDECDVASYNMYPRVYEDFQKMRETYGDL 1020

Query: 1021 SVLPTRNFLAKPRVGEEIEVHIEQGKTLIIKLQAVGDLNEETGIREVYFELNGETRKIRI 1080
            SVLPTR+FL+     EEIEV IEQGKTLIIKLQAVGDLN++TG REVYF+LNGE RKIR+
Sbjct: 1021 SVLPTRSFLSPLETDEEIEVVIEQGKTLIIKLQAVGDLNKKTGEREVYFDLNGEMRKIRV 1080

Query: 1081 ADKSQVVQTIAKPKADGHDPLQIGAPMAGVIVEVKVHKGSQVKKGQPVAVLSAMKMEMVI 1140
            AD+SQ V+T+ K KAD HDPL IGAPMAGVIVEVKVHKGS +KKGQPVAVLSAMKMEM+I
Sbjct: 1081 ADRSQKVETVTKSKADMHDPLHIGAPMAGVIVEVKVHKGSLIKKGQPVAVLSAMKMEMII 1140

Query: 1141 SSTGEGLVKDVLVKDGE 1157
            SS  +G VK+V V DGE
Sbjct: 1141 SSPSDGQVKEVFVSDGE 1157

>Scas_686.17
          Length = 1176

 Score = 1939 bits (5022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 941/1150 (81%), Positives = 1022/1150 (88%)

Query: 7    LTGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADEA 66
            L+GLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADE+
Sbjct: 6    LSGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADES 65

Query: 67   YVIGKEGEYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKAGITWIGP 126
            YVIG+EG++TPVGAYLAIDEII+IAKKH VDFIHPGYGFLSEN+EFADKV KAGITWIGP
Sbjct: 66   YVIGEEGQFTPVGAYLAIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVAKAGITWIGP 125

Query: 127  PPEVIESVGDKVSARNLAAKANVPTVPGTPGPIETVEEAQDFVNKYGYPVIIKAAYXXXX 186
            P EVI+SVGDKVSAR LAA+A+VPTVPGTPGPI++V+EA+DFV +YGYPVIIKAA+    
Sbjct: 126  PAEVIDSVGDKVSARYLAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVIIKAAFGGGG 185

Query: 187  XXXXXXXXXXXXADAFQRAKSEAITAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLF 246
                         DAFQRA SEA+TAFG+GTCFVERFLD PKHIEVQLL DN+GNVVHLF
Sbjct: 186  RGMRVVREGEDINDAFQRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGDNYGNVVHLF 245

Query: 247  ERDCSVQRRHQKVVEVAPAKTLPREVRDSILTDAVRLAKEAGYRNAGTAEFLVDNQNRHY 306
            ERDCSVQRRHQKVVEVAPAK +PREVRD+ILTDAV+LAKE GYRNAGTAEFLVDNQNRHY
Sbjct: 246  ERDCSVQRRHQKVVEVAPAKNIPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQNRHY 305

Query: 307  FIEINPRIQVEHTITEEITGIDLVSAQIQIAAGASLPQLGLLQDRITTRGFAIQCRITTE 366
            FIEINPRIQVEHTITEEITGIDLV+AQIQIAAGASL QLGLLQDRITTRGFAIQCRITTE
Sbjct: 306  FIEINPRIQVEHTITEEITGIDLVAAQIQIAAGASLAQLGLLQDRITTRGFAIQCRITTE 365

Query: 367  DPAKNFQPDTGRLEVYRSAGGNGVRLDGGTAYAGAVISPHYDSMLVKCSCSGSTYEIVRR 426
            DPAKNFQPDTGRLEVYRSAGGNGVRLDGG AYAGAVISPHYDSMLVKCSCSGSTYEIVRR
Sbjct: 366  DPAKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVRR 425

Query: 427  KMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFHMVSSRNRAQKLL 486
            KM+RALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLF MVSS+NRAQKLL
Sbjct: 426  KMIRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFKMVSSQNRAQKLL 485

Query: 487  HYLADLAVNGSSIKGQIGEPKLKTHPQIPRLHDEDGSPVDVSVPPQKGWRYLLQSEGPEA 546
            HYLADLAVNGSSIKGQIG PKLK +P +P LHD +G+ ++V+ PP  GWR +L  +GP  
Sbjct: 486  HYLADLAVNGSSIKGQIGLPKLKKNPDVPHLHDAEGNVINVATPPTAGWRKVLLEQGPAE 545

Query: 547  FAKAVRHNQGTLVMDTTWRDAHQSLLATRVRTYDLXXXXXXXXXXXXXXXXLECWGGATF 606
            FAK VR+ QGTL+MDTTWRDAHQSLLATRVRT+DL                LECWGGATF
Sbjct: 546  FAKQVRNFQGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALSGAFALECWGGATF 605

Query: 607  DVAMRFLHEDPWERLRILRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNGVD 666
            DVAMRFLHEDPW RLR LRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNGVD
Sbjct: 606  DVAMRFLHEDPWARLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNGVD 665

Query: 667  IFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCYSGDMLQPGKKYNLDYYLDVTEKIVAM 726
            IFRVFDALNDL+QL                  CYSGDMLQPGKKYNLDYYL+VTEKIV M
Sbjct: 666  IFRVFDALNDLDQLKVGVDAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLEVTEKIVQM 725

Query: 727  GTHILGIKDMAGTMKPAAAKLLIGAIRAKFPDLPIHVHSHDSAGTAVASMAACALAGADV 786
            GTHILGIKDMAGTMKPAAA+LLIG+IRAK+PDLPIHVH+HDSAGTAV+SM   AL+GADV
Sbjct: 726  GTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVSSMTVAALSGADV 785

Query: 787  VDVAINSMSGLTSQASVNAVLASLDGQIDTGINVKHVCELDAYWAEMRLLYSCFEADLKG 846
            VDVAINSMSGLTSQ S+NA+LASLDGQIDTGINV++V ELDAYWAEMRLLYSCFEADLKG
Sbjct: 786  VDVAINSMSGLTSQPSINALLASLDGQIDTGINVQNVRELDAYWAEMRLLYSCFEADLKG 845

Query: 847  PDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKKAYKQANQLLGDIVKVTPTSKVVGD 906
            PD EVY HEIPGGQLTNLLFQAQQ GLGE+W ETK+AY++AN LLGDIVKVTPTSKVVGD
Sbjct: 846  PDAEVYQHEIPGGQLTNLLFQAQQQGLGEQWAETKRAYREANYLLGDIVKVTPTSKVVGD 905

Query: 907  LAQFMVSNQLTPDDIRRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRTDIXXXXXXXXX 966
            LAQFMV+N+   DDI+RLAN+LDFPDS+MDFFEGL+GQPYGGFPEPLR+DI         
Sbjct: 906  LAQFMVTNKFNSDDIKRLANTLDFPDSIMDFFEGLIGQPYGGFPEPLRSDILRNKRRKLT 965

Query: 967  XXPGLELAPFDLAKIREDLEARFGDINECDVASYNMYPKVYEDFQKILEEYGDLSVLPTR 1026
              PGLELAPF++  IREDLE RFGDI+ECD+ASYNMYPKVYEDFQKI E+YGDLSVLPT+
Sbjct: 966  TRPGLELAPFNMQDIREDLETRFGDIDECDIASYNMYPKVYEDFQKIKEKYGDLSVLPTK 1025

Query: 1027 NFLAKPRVGEEIEVHIEQGKTLIIKLQAVGDLNEETGIREVYFELNGETRKIRIADKSQV 1086
            +FL+   V EEIEV IEQGKTLI+KLQA+GDLN+ TG+REVYF+LNGE RKIR+ D+SQ 
Sbjct: 1026 SFLSPLDVDEEIEVTIEQGKTLIVKLQAIGDLNKATGVREVYFDLNGELRKIRVVDRSQK 1085

Query: 1087 VQTIAKPKADGHDPLQIGAPMAGVIVEVKVHKGSQVKKGQPVAVLSAMKMEMVISSTGEG 1146
            V+TIAKPKAD HDP QIGAPMAGV+VEVKVHKGS VKKG+ VAVLSAMKMEMVISS  +G
Sbjct: 1086 VETIAKPKADAHDPYQIGAPMAGVVVEVKVHKGSLVKKGEAVAVLSAMKMEMVISSPADG 1145

Query: 1147 LVKDVLVKDG 1156
             VK+VLV +G
Sbjct: 1146 QVKEVLVSNG 1155

>KLLA0C05764g complement(512470..515991) highly similar to sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2 pyruvate
            carboxylase 2, start by similarity
          Length = 1173

 Score = 1938 bits (5021), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 936/1154 (81%), Positives = 1022/1154 (88%)

Query: 4    NKMLTGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKA 63
            +  L GLRDN +L+GEKNK+LVANRGEIPIRIFR+AHELSM+TVAIYSHEDRLS HRLKA
Sbjct: 2    SSQLAGLRDNSNLMGEKNKLLVANRGEIPIRIFRTAHELSMKTVAIYSHEDRLSMHRLKA 61

Query: 64   DEAYVIGKEGEYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKAGITW 123
            DEAYVIG++G+YTPVGAYLAIDEII+IAK HGV+FIHPGYGFLSEN+EFA+KV  +GITW
Sbjct: 62   DEAYVIGEQGKYTPVGAYLAIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAASGITW 121

Query: 124  IGPPPEVIESVGDKVSARNLAAKANVPTVPGTPGPIETVEEAQDFVNKYGYPVIIKAAYX 183
            +GPP  VI+SVGDKVSARNLA KANVP VPGTPGPIETVEEAQ FV+KYG+PVIIKAA+ 
Sbjct: 122  VGPPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIETVEEAQAFVDKYGFPVIIKAAFG 181

Query: 184  XXXXXXXXXXXXXXXADAFQRAKSEAITAFGNGTCFVERFLDKPKHIEVQLLADNHGNVV 243
                           +DAFQRAKSEAITAFGNGTCF+ERFLDKPKHIEVQLLADN+GNVV
Sbjct: 182  GGGRGMRVVREGDDISDAFQRAKSEAITAFGNGTCFIERFLDKPKHIEVQLLADNYGNVV 241

Query: 244  HLFERDCSVQRRHQKVVEVAPAKTLPREVRDSILTDAVRLAKEAGYRNAGTAEFLVDNQN 303
            HLFERDCSVQRRHQKVVEVAPAKTLP EVRD+ILTDAV+LAKEAGYRNAGTAEFLVDNQN
Sbjct: 242  HLFERDCSVQRRHQKVVEVAPAKTLPEEVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQN 301

Query: 304  RHYFIEINPRIQVEHTITEEITGIDLVSAQIQIAAGASLPQLGLLQDRITTRGFAIQCRI 363
            RHYFIEINPRIQVEHTITEEITGID+V+AQIQIAAGA+L QLGL+QD+ITTRGFAIQCRI
Sbjct: 302  RHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGATLEQLGLMQDKITTRGFAIQCRI 361

Query: 364  TTEDPAKNFQPDTGRLEVYRSAGGNGVRLDGGTAYAGAVISPHYDSMLVKCSCSGSTYEI 423
            TTEDP+KNFQPDTGR++VYRSAGGNGVRLDGG A+AG+VISPHYDSMLVKCSCSGSTYEI
Sbjct: 362  TTEDPSKNFQPDTGRIDVYRSAGGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSGSTYEI 421

Query: 424  VRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFHMVSSRNRAQ 483
            VRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVF SG+YWTTFIDDTPQLF MVSS+NRAQ
Sbjct: 422  VRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFKSGEYWTTFIDDTPQLFEMVSSQNRAQ 481

Query: 484  KLLHYLADLAVNGSSIKGQIGEPKLKTHPQIPRLHDEDGSPVDVSVPPQKGWRYLLQSEG 543
            KLLHYLADLAVNGSSIKGQIG PKL THP IP LH+EDGS VDVS  P  GWR +L   G
Sbjct: 482  KLLHYLADLAVNGSSIKGQIGLPKLTTHPTIPHLHNEDGSLVDVSAKPPAGWRDVLLDYG 541

Query: 544  PEAFAKAVRHNQGTLVMDTTWRDAHQSLLATRVRTYDLXXXXXXXXXXXXXXXXLECWGG 603
            PE FAK VR   GTL+MDTTWRDAHQSLLATRVRTYDL                LECWGG
Sbjct: 542  PEEFAKQVRKFNGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHAMSGAFALECWGG 601

Query: 604  ATFDVAMRFLHEDPWERLRILRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDN 663
            ATFDV+MRFLHEDPWERLR LRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDN
Sbjct: 602  ATFDVSMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDN 661

Query: 664  GVDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCYSGDMLQPGKKYNLDYYLDVTEKI 723
            GVDIFRVFDALNDLEQL                  CYSGDML PGKKYNLDYYLD+TEKI
Sbjct: 662  GVDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATICYSGDMLAPGKKYNLDYYLDITEKI 721

Query: 724  VAMGTHILGIKDMAGTMKPAAAKLLIGAIRAKFPDLPIHVHSHDSAGTAVASMAACALAG 783
            V  GTHILGIKDMAGT+KP+AA+LLIG+IRAK+P+LPIHVH+HDSAGT VASMAACAL+G
Sbjct: 722  VNSGTHILGIKDMAGTLKPSAARLLIGSIRAKYPELPIHVHTHDSAGTGVASMAACALSG 781

Query: 784  ADVVDVAINSMSGLTSQASVNAVLASLDGQIDTGINVKHVCELDAYWAEMRLLYSCFEAD 843
            ADVVDVA NSMSGLTSQ S+NA+LA+LDG+ID  +NV +V ELDAYWAEMRLLYSCFEAD
Sbjct: 782  ADVVDVATNSMSGLTSQPSINALLAALDGEIDNNVNVGYVRELDAYWAEMRLLYSCFEAD 841

Query: 844  LKGPDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKKAYKQANQLLGDIVKVTPTSKV 903
            LKGPDPEVY HEIPGGQLTNLLFQAQQLGLGEKW ETK+AY++AN LLGD+VKVTPTSKV
Sbjct: 842  LKGPDPEVYVHEIPGGQLTNLLFQAQQLGLGEKWAETKRAYREANLLLGDLVKVTPTSKV 901

Query: 904  VGDLAQFMVSNQLTPDDIRRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRTDIXXXXXX 963
            VGDLAQFMVSN+LT DD+RRLA+SLDFPDSVMDFFEGL+GQPYGGFPEPLRTD+      
Sbjct: 902  VGDLAQFMVSNKLTSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRTDVLRNKRR 961

Query: 964  XXXXXPGLELAPFDLAKIREDLEARFGDINECDVASYNMYPKVYEDFQKILEEYGDLSVL 1023
                 PGLELAPF+L KI+EDL  RF DI+ECDVASYNMYPKVYEDF+KI E+YGDLSVL
Sbjct: 962  KLTQRPGLELAPFELEKIKEDLSTRFSDIDECDVASYNMYPKVYEDFRKIKEKYGDLSVL 1021

Query: 1024 PTRNFLAKPRVGEEIEVHIEQGKTLIIKLQAVGDLNEETGIREVYFELNGETRKIRIADK 1083
            PT+NFL+ P +GEEI V IEQGKTLIIK QA+GDLN+ETGIREVYFELNGE RK+ +AD+
Sbjct: 1022 PTKNFLSPPVIGEEIVVTIEQGKTLIIKPQAIGDLNKETGIREVYFELNGELRKVSVADR 1081

Query: 1084 SQVVQTIAKPKADGHDPLQIGAPMAGVIVEVKVHKGSQVKKGQPVAVLSAMKMEMVISST 1143
            SQ V++++KPKAD HDP QIG+PMAGV+VEVKVHKGS + KGQPVAVLSAMKMEMVISS 
Sbjct: 1082 SQKVESVSKPKADAHDPFQIGSPMAGVVVEVKVHKGSLIAKGQPVAVLSAMKMEMVISSP 1141

Query: 1144 GEGLVKDVLVKDGE 1157
             +G VK+VLVKDGE
Sbjct: 1142 ADGQVKEVLVKDGE 1155

>Kwal_14.1803
          Length = 1174

 Score = 1906 bits (4938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 926/1152 (80%), Positives = 1015/1152 (88%), Gaps = 1/1152 (0%)

Query: 7    LTGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADEA 66
            L GLRD+ +LLGEKNKILVANRGEIPIRIFRSAHELSM+TVAIYSHEDRLS HRLKADEA
Sbjct: 4    LAGLRDSSNLLGEKNKILVANRGEIPIRIFRSAHELSMKTVAIYSHEDRLSMHRLKADEA 63

Query: 67   YVIGKEGEYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKAGITWIGP 126
            Y+IGK+G+YTPVGAYLAIDEI++IAK+H VDFIHPGYGFLSEN+EFA KV++AGITWIGP
Sbjct: 64   YMIGKQGKYTPVGAYLAIDEILEIAKEHNVDFIHPGYGFLSENSEFARKVEEAGITWIGP 123

Query: 127  PPEVIESVGDKVSARNLAAKANVPTVPGTPGPIETVEEAQDFVNKYGYPVIIKAAYXXXX 186
              EVI+SVGDKVSARNLAAKANVP VPGTPGPI++VEEAQ FV +YGYPVIIKAA+    
Sbjct: 124  SAEVIDSVGDKVSARNLAAKANVPVVPGTPGPIDSVEEAQAFVAEYGYPVIIKAAFGGGG 183

Query: 187  XXXXXXXXXXXXADAFQRAKSEAITAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLF 246
                        ADAFQRA SEA T+FGNGTCF+ERFL+KPKHIEVQLLAD +GNVVHLF
Sbjct: 184  RGMRVVREGDDIADAFQRATSEAKTSFGNGTCFIERFLNKPKHIEVQLLADGYGNVVHLF 243

Query: 247  ERDCSVQRRHQKVVEVAPAKTLPREVRDSILTDAVRLAKEAGYRNAGTAEFLVDNQNRHY 306
            ERDCSVQRRHQKVVEVAPAKTLP++VRD+ILTDAV+LA  A Y+NAGTAEFLVD+QNRHY
Sbjct: 244  ERDCSVQRRHQKVVEVAPAKTLPKDVRDAILTDAVKLASVANYKNAGTAEFLVDDQNRHY 303

Query: 307  FIEINPRIQVEHTITEEITGIDLVSAQIQIAAGASLPQLGLLQDRITTRGFAIQCRITTE 366
            FIEINPRIQVEHTITEEITGID+V+AQIQIAAGASL QLGLLQDRITTRGFAIQCRITTE
Sbjct: 304  FIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLQQLGLLQDRITTRGFAIQCRITTE 363

Query: 367  DPAKNFQPDTGRLEVYRSAGGNGVRLDGGTAYAGAVISPHYDSMLVKCSCSGSTYEIVRR 426
            DPAKNFQPDTGR+EVYRSAGGNGVRLDGG AYAG++ISPHYDSMLVKCSCSGSTYEIVRR
Sbjct: 364  DPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTYEIVRR 423

Query: 427  KMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFHMVSSRNRAQKLL 486
            KMLRALIEFRIRGVKTNIPFLLTLLT+PVFI G YWTTFIDDTP+LF MVSS+NRAQKLL
Sbjct: 424  KMLRALIEFRIRGVKTNIPFLLTLLTNPVFIDGTYWTTFIDDTPELFKMVSSQNRAQKLL 483

Query: 487  HYLADLAVNGSSIKGQIGEPKLKTHPQIPRLHDEDGSPVDV-SVPPQKGWRYLLQSEGPE 545
            HYLADLAVNGSSIKGQ+G PKL T P +P +HD  G+ +DV +  P  GWR +L  +GP 
Sbjct: 484  HYLADLAVNGSSIKGQMGLPKLHTQPTVPPIHDAQGNVIDVLTTAPPSGWRQVLLEKGPA 543

Query: 546  AFAKAVRHNQGTLVMDTTWRDAHQSLLATRVRTYDLXXXXXXXXXXXXXXXXLECWGGAT 605
             FAKAVR N GTL+MDTTWRDAHQSLLATRVRTYDL                LECWGGAT
Sbjct: 544  EFAKAVRENNGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHALSGAFALECWGGAT 603

Query: 606  FDVAMRFLHEDPWERLRILRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNGV 665
            FDVAMRFLHEDPWERLR+LRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAK+NGV
Sbjct: 604  FDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKENGV 663

Query: 666  DIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCYSGDMLQPGKKYNLDYYLDVTEKIVA 725
            DIFRVFDALNDLEQL                  CYSGDMLQ GKKYNLDYYL++T+KIVA
Sbjct: 664  DIFRVFDALNDLEQLKVGVDAVKKAKGVVEATICYSGDMLQSGKKYNLDYYLEITDKIVA 723

Query: 726  MGTHILGIKDMAGTMKPAAAKLLIGAIRAKFPDLPIHVHSHDSAGTAVASMAACALAGAD 785
            MGTHILGIKDMAGT+KP+AAKLLIG+IRAK+PDLPIHVH+HDSAGTAVASMAACA AGAD
Sbjct: 724  MGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIHVHTHDSAGTAVASMAACAFAGAD 783

Query: 786  VVDVAINSMSGLTSQASVNAVLASLDGQIDTGINVKHVCELDAYWAEMRLLYSCFEADLK 845
            VVDVA NSMSGLTSQ S+NA+LASLDG+I+T INV  V ELDAYWA+MRLLYSCFEADLK
Sbjct: 784  VVDVATNSMSGLTSQPSINALLASLDGEIETNINVNMVRELDAYWAQMRLLYSCFEADLK 843

Query: 846  GPDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKKAYKQANQLLGDIVKVTPTSKVVG 905
            GPDPEVY HEIPGGQLTNLLFQAQQLGLGEKW ETK+AY++AN LLGD+VKVTPTSKVVG
Sbjct: 844  GPDPEVYQHEIPGGQLTNLLFQAQQLGLGEKWSETKRAYREANYLLGDLVKVTPTSKVVG 903

Query: 906  DLAQFMVSNQLTPDDIRRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRTDIXXXXXXXX 965
            DLAQFMVSN+L+ DD+RRLA+SLDFPDSVMDFFEGL+GQPYGGFPEPLR+D+        
Sbjct: 904  DLAQFMVSNKLSSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLKNKRRKL 963

Query: 966  XXXPGLELAPFDLAKIREDLEARFGDINECDVASYNMYPKVYEDFQKILEEYGDLSVLPT 1025
               PGLE+APFDLAKI+EDL+ RFGDI ECDVASYNMYPKVYEDF+KI E YGDLSVLPT
Sbjct: 964  TCRPGLEMAPFDLAKIKEDLQDRFGDIEECDVASYNMYPKVYEDFRKIRETYGDLSVLPT 1023

Query: 1026 RNFLAKPRVGEEIEVHIEQGKTLIIKLQAVGDLNEETGIREVYFELNGETRKIRIADKSQ 1085
            +NFL+ P VGEEI V IE+GKTLIIK QA+G+LN+ETG+REVYF+LNGE RK+ + DKSQ
Sbjct: 1024 KNFLSPPTVGEEIVVTIEKGKTLIIKPQAIGELNKETGLREVYFDLNGELRKVAVVDKSQ 1083

Query: 1086 VVQTIAKPKADGHDPLQIGAPMAGVIVEVKVHKGSQVKKGQPVAVLSAMKMEMVISSTGE 1145
             V  I+KPKAD HD  QIGAPMAGVI+EVKVH GS VK+GQPVAVLSAMKMEMVISS  +
Sbjct: 1084 KVDLISKPKADAHDSYQIGAPMAGVIIEVKVHTGSLVKQGQPVAVLSAMKMEMVISSPID 1143

Query: 1146 GLVKDVLVKDGE 1157
            G VK+VLVKDGE
Sbjct: 1144 GQVKEVLVKDGE 1155

>Scas_563.12
          Length = 1216

 Score = 1905 bits (4934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 929/1162 (79%), Positives = 1018/1162 (87%), Gaps = 5/1162 (0%)

Query: 1    MATNKMLTGLRDNFSLLGEKNK----ILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRL 56
            MA NK L G RDNF+LLG +N+    I+V +    P+  FRSAHELSM+TVAIYSHEDRL
Sbjct: 37   MAINKKLNGPRDNFNLLGTRNRFLSPIVVKSPSYPPVCNFRSAHELSMQTVAIYSHEDRL 96

Query: 57   STHRLKADEAYVIGKEGEYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKV 116
            STHRLKADE+YVIG+  ++TPVGAYLAIDEII+IAK+HGVD+IHPGYGFLSEN+EFADKV
Sbjct: 97   STHRLKADESYVIGEPHQFTPVGAYLAIDEIINIAKRHGVDYIHPGYGFLSENSEFADKV 156

Query: 117  QKAGITWIGPPPEVIESVGDKVSARNLAAKANVPTVPGTPGPIETVEEAQDFVNKYGYPV 176
             KAGITWIGPP  VI+SVGDKVSARNLA KANVPTVPGTPGPI TV++AQDFVN+YGYPV
Sbjct: 157  AKAGITWIGPPASVIDSVGDKVSARNLATKANVPTVPGTPGPIRTVQDAQDFVNEYGYPV 216

Query: 177  IIKAAYXXXXXXXXXXXXXXXXADAFQRAKSEAITAFGNGTCFVERFLDKPKHIEVQLLA 236
            IIKAA+                ADAFQRA SEA+TAFG+GTCFVERFL+KPKHIEVQLLA
Sbjct: 217  IIKAAFGGGGRGMRVVNEGDDLADAFQRASSEALTAFGDGTCFVERFLNKPKHIEVQLLA 276

Query: 237  DNHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDSILTDAVRLAKEAGYRNAGTAE 296
            D HGNV+HLFERDCSVQRRHQKVVEVAPAKTLPREVRD+ILTDAV+LAKE GY+NAGTAE
Sbjct: 277  DTHGNVIHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYQNAGTAE 336

Query: 297  FLVDNQNRHYFIEINPRIQVEHTITEEITGIDLVSAQIQIAAGASLPQLGLLQDRITTRG 356
            FLVD+QNRHYFIEINPRIQVEHTITEEITGID+V+AQIQIAAGASL QLGLLQD+ITTRG
Sbjct: 337  FLVDDQNRHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLEQLGLLQDKITTRG 396

Query: 357  FAIQCRITTEDPAKNFQPDTGRLEVYRSAGGNGVRLDGGTAYAGAVISPHYDSMLVKCSC 416
            FAIQCRITTEDPAKNFQPDTGRLEVY SAGGNGVRLDGG AYAGA+ISPHYDSMLVKCSC
Sbjct: 397  FAIQCRITTEDPAKNFQPDTGRLEVYDSAGGNGVRLDGGNAYAGAIISPHYDSMLVKCSC 456

Query: 417  SGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFHMV 476
            SGSTYE+VRRKM+RALIEFRIRGVKTNIPFLLTLLTHPVFI+GDYWTTFIDDTPQLF MV
Sbjct: 457  SGSTYEVVRRKMIRALIEFRIRGVKTNIPFLLTLLTHPVFIAGDYWTTFIDDTPQLFKMV 516

Query: 477  SSRNRAQKLLHYLADLAVNGSSIKGQIGEPKLKTHPQIPRLHDEDGSPVDVS-VPPQKGW 535
            SS+NRAQKLLHYLADLAVNGSSIKGQ+G P+LK  P IP +HD  G+ +DV+ VPP  GW
Sbjct: 517  SSQNRAQKLLHYLADLAVNGSSIKGQVGIPQLKKVPDIPHIHDAQGNVIDVTNVPPPAGW 576

Query: 536  RYLLQSEGPEAFAKAVRHNQGTLVMDTTWRDAHQSLLATRVRTYDLXXXXXXXXXXXXXX 595
            R +L  +GPE FAK VR  QGTL+MDTTWRDAHQSLLATRVRT+DL              
Sbjct: 577  RQVLLEQGPEEFAKQVRQFQGTLLMDTTWRDAHQSLLATRVRTHDLAKIAPTTAHALASA 636

Query: 596  XXLECWGGATFDVAMRFLHEDPWERLRILRKLVPNIPFQMLLRGANGVAYSSLPDNAIDH 655
              LECWGGATFDVAMRFLHEDPW+RLR LRKLVPNIPFQMLLRGANGVAYSSLPDNAIDH
Sbjct: 637  FALECWGGATFDVAMRFLHEDPWKRLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDH 696

Query: 656  FVKQAKDNGVDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCYSGDMLQPGKKYNLDY 715
            FVKQAKDNGVDIFRVFDALNDL+QL                  CYSGDMLQPGKKYNLDY
Sbjct: 697  FVKQAKDNGVDIFRVFDALNDLDQLKVGVDAVKKAGGVVEATVCYSGDMLQPGKKYNLDY 756

Query: 716  YLDVTEKIVAMGTHILGIKDMAGTMKPAAAKLLIGAIRAKFPDLPIHVHSHDSAGTAVAS 775
            YL+VTEKIV MGTHILGIKDMAGTMKPAAA+LLIG+IRAK+PDLPIHVH+HDSAGTAVAS
Sbjct: 757  YLEVTEKIVQMGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVAS 816

Query: 776  MAACALAGADVVDVAINSMSGLTSQASVNAVLASLDGQIDTGINVKHVCELDAYWAEMRL 835
            M+A A AGADV+DVA NSMSGLTSQ S+NA+LASLDG+I+T INV+HV ELDAYWAEMRL
Sbjct: 817  MSAAAYAGADVIDVATNSMSGLTSQPSINALLASLDGEINTSINVQHVRELDAYWAEMRL 876

Query: 836  LYSCFEADLKGPDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKKAYKQANQLLGDIV 895
            LYSCF ADLKGPDPEVY+HEIPGGQLTNLLFQAQQLGLGE+W ETK+AYK+AN LLGDIV
Sbjct: 877  LYSCFGADLKGPDPEVYEHEIPGGQLTNLLFQAQQLGLGEQWTETKRAYKEANMLLGDIV 936

Query: 896  KVTPTSKVVGDLAQFMVSNQLTPDDIRRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRT 955
            KVTPTSKVVGDLAQFMVSN+LT +D++RLANSLDFPDSVMDFFEGLMGQPYGGFPEPLR+
Sbjct: 937  KVTPTSKVVGDLAQFMVSNKLTSEDVKRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRS 996

Query: 956  DIXXXXXXXXXXXPGLELAPFDLAKIREDLEARFGDINECDVASYNMYPKVYEDFQKILE 1015
            DI           PGLEL PF+L  I+EDL+ RFGDINECD+ASYNMYPKVYEDFQK+ E
Sbjct: 997  DILRNKRRKLTCRPGLELVPFELNNIKEDLQTRFGDINECDIASYNMYPKVYEDFQKMKE 1056

Query: 1016 EYGDLSVLPTRNFLAKPRVGEEIEVHIEQGKTLIIKLQAVGDLNEETGIREVYFELNGET 1075
            +YGDLSVLPT++FLA   +GEEI V I+QGKTLIIKLQA+GDLN+ETG REV+FELNGE 
Sbjct: 1057 KYGDLSVLPTKSFLAPAEIGEEILVTIQQGKTLIIKLQAIGDLNKETGKREVFFELNGEM 1116

Query: 1076 RKIRIADKSQVVQTIAKPKADGHDPLQIGAPMAGVIVEVKVHKGSQVKKGQPVAVLSAMK 1135
            RKI + DKSQ V+T+AKPKAD HDP QIGAPMAGVIVEVKVHKGS VKKG+ VAVLSAMK
Sbjct: 1117 RKISVTDKSQKVETVAKPKADTHDPFQIGAPMAGVIVEVKVHKGSLVKKGEAVAVLSAMK 1176

Query: 1136 MEMVISSTGEGLVKDVLVKDGE 1157
            MEMVISS  +GLVK+VLV + E
Sbjct: 1177 MEMVISSPADGLVKEVLVNESE 1198

>AAR162C [350] [Homologous to ScYGL062W (PYC1) - SH; ScYBR218C (PYC2)
            - SH] (634067..637582) [3516 bp, 1171 aa]
          Length = 1171

 Score = 1875 bits (4857), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 911/1151 (79%), Positives = 993/1151 (86%)

Query: 7    LTGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADEA 66
            L G R + +LLGEKNK+LVANRGEIPIRIFR+AHELSM TVA+YS+EDRLS HR KADEA
Sbjct: 5    LAGFRRHSNLLGEKNKVLVANRGEIPIRIFRTAHELSMATVAVYSYEDRLSMHRQKADEA 64

Query: 67   YVIGKEGEYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKAGITWIGP 126
            Y+IG+EG+YTPVGAYLAIDEI+ IA+ H VDFIHPGYGFLSENAEFA KV+ AGITWIGP
Sbjct: 65   YMIGREGQYTPVGAYLAIDEILRIARDHDVDFIHPGYGFLSENAEFAAKVEGAGITWIGP 124

Query: 127  PPEVIESVGDKVSARNLAAKANVPTVPGTPGPIETVEEAQDFVNKYGYPVIIKAAYXXXX 186
            P  VIE+VGDKVSARNLAA A+VPTVPGT GPI +VEEA++FV KYGYPVIIKAA+    
Sbjct: 125  PASVIEAVGDKVSARNLAAVADVPTVPGTEGPISSVEEAEEFVQKYGYPVIIKAAFGGGG 184

Query: 187  XXXXXXXXXXXXADAFQRAKSEAITAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLF 246
                         DAFQRA+SEA TAFGNGTCFVERFLD+PKHIEVQLLADN+GNVVHLF
Sbjct: 185  RGMRVVREGDDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHIEVQLLADNYGNVVHLF 244

Query: 247  ERDCSVQRRHQKVVEVAPAKTLPREVRDSILTDAVRLAKEAGYRNAGTAEFLVDNQNRHY 306
            ERDCSVQRRHQKVVEVAPAKTL +EVRD+ILTDAV+LAK +GYRNAGTAEFLVD QNRHY
Sbjct: 245  ERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTDAVKLAKASGYRNAGTAEFLVDKQNRHY 304

Query: 307  FIEINPRIQVEHTITEEITGIDLVSAQIQIAAGASLPQLGLLQDRITTRGFAIQCRITTE 366
            FIEINPRIQVEHTITEEITG+D+V+AQIQIAAGASL QLGL+QDRITTRGFAIQCRITTE
Sbjct: 305  FIEINPRIQVEHTITEEITGVDIVAAQIQIAAGASLEQLGLMQDRITTRGFAIQCRITTE 364

Query: 367  DPAKNFQPDTGRLEVYRSAGGNGVRLDGGTAYAGAVISPHYDSMLVKCSCSGSTYEIVRR 426
            DP+KNFQPDTGRL+VYRSAGGNGVRLDGG A+AGAVISPHYDSMLVKCSCSGSTYEIVRR
Sbjct: 365  DPSKNFQPDTGRLDVYRSAGGNGVRLDGGNAFAGAVISPHYDSMLVKCSCSGSTYEIVRR 424

Query: 427  KMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFHMVSSRNRAQKLL 486
            KMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLF MV+S+NRAQKLL
Sbjct: 425  KMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFEMVASQNRAQKLL 484

Query: 487  HYLADLAVNGSSIKGQIGEPKLKTHPQIPRLHDEDGSPVDVSVPPQKGWRYLLQSEGPEA 546
             YL+DLAVNGSSIKGQ+G PKL   P IP+LH+  G  +DV   P  GWR +L   GPE 
Sbjct: 485  QYLSDLAVNGSSIKGQMGVPKLLAQPSIPQLHNAKGEVIDVQSQPPAGWRQVLLEHGPEV 544

Query: 547  FAKAVRHNQGTLVMDTTWRDAHQSLLATRVRTYDLXXXXXXXXXXXXXXXXLECWGGATF 606
            FAK VR   GTL+ DTTWRDAHQSLLATRVRTYDL                LECWGGATF
Sbjct: 545  FAKKVREFDGTLLTDTTWRDAHQSLLATRVRTYDLAAIAPTTAHALAGAFALECWGGATF 604

Query: 607  DVAMRFLHEDPWERLRILRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNGVD 666
            DVAMRFLHEDPWERLR LRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAK+NGVD
Sbjct: 605  DVAMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKENGVD 664

Query: 667  IFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCYSGDMLQPGKKYNLDYYLDVTEKIVAM 726
            IFRVFDALNDLEQL                  CYSGDMLQPGKKYNLDYYL++TEKIVAM
Sbjct: 665  IFRVFDALNDLEQLKVGVDAVKKAEGLVEATICYSGDMLQPGKKYNLDYYLELTEKIVAM 724

Query: 727  GTHILGIKDMAGTMKPAAAKLLIGAIRAKFPDLPIHVHSHDSAGTAVASMAACALAGADV 786
            GTHILGIKDMAGTMKP AAKLLIG+IRAK+PDLPIHVH+HDSAGT VASM  CA++GADV
Sbjct: 725  GTHILGIKDMAGTMKPGAAKLLIGSIRAKYPDLPIHVHTHDSAGTGVASMVQCAISGADV 784

Query: 787  VDVAINSMSGLTSQASVNAVLASLDGQIDTGINVKHVCELDAYWAEMRLLYSCFEADLKG 846
            VDVA NSMSGLTSQ S+ A+ ASL G I TG++  H  ELDAYWAEMRLLYSCFEADLKG
Sbjct: 785  VDVATNSMSGLTSQPSITALQASLGGDIATGVDPDHAIELDAYWAEMRLLYSCFEADLKG 844

Query: 847  PDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKKAYKQANQLLGDIVKVTPTSKVVGD 906
            PDPEVY HEIPGGQLTNLLFQAQQLGLGE+W ETK+AY +ANQLLGD+VKVTPTSKVVGD
Sbjct: 845  PDPEVYKHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYAEANQLLGDLVKVTPTSKVVGD 904

Query: 907  LAQFMVSNQLTPDDIRRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRTDIXXXXXXXXX 966
            LAQFMVSN+L  DD+RRLA+SLDFPDSVMDFFEGL+GQPYGGFPEPLR+D+         
Sbjct: 905  LAQFMVSNRLNSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLRNKRRKLK 964

Query: 967  XXPGLELAPFDLAKIREDLEARFGDINECDVASYNMYPKVYEDFQKILEEYGDLSVLPTR 1026
              PGLELAPFDL KIRE+L +RF +I+ECDVASYNMYPKVYEDF+KI E YGDLSVLPT 
Sbjct: 965  VRPGLELAPFDLDKIREELRSRFDNIDECDVASYNMYPKVYEDFRKIRETYGDLSVLPTH 1024

Query: 1027 NFLAKPRVGEEIEVHIEQGKTLIIKLQAVGDLNEETGIREVYFELNGETRKIRIADKSQV 1086
            NFL+ P++GEEI V IEQGK LIIKLQA+GDLN+ETG REVYFELNGE RK+ +ADKSQ 
Sbjct: 1025 NFLSPPKIGEEIIVTIEQGKVLIIKLQAIGDLNKETGKREVYFELNGELRKVSVADKSQK 1084

Query: 1087 VQTIAKPKADGHDPLQIGAPMAGVIVEVKVHKGSQVKKGQPVAVLSAMKMEMVISSTGEG 1146
            ++T++K KAD HD  Q+GAPMAGVI+EVKVHKGS V KGQPVAVLSAMKMEMVISS  +G
Sbjct: 1085 LETVSKLKADAHDQFQVGAPMAGVIIEVKVHKGSAVTKGQPVAVLSAMKMEMVISSPSDG 1144

Query: 1147 LVKDVLVKDGE 1157
             VKDV V DGE
Sbjct: 1145 QVKDVFVSDGE 1155

>Sklu_1458.1 YGL062W, Contig c1458 155-3553 reverse complement
          Length = 1132

 Score = 1855 bits (4805), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 902/1114 (80%), Positives = 979/1114 (87%)

Query: 44   MRTVAIYSHEDRLSTHRLKADEAYVIGKEGEYTPVGAYLAIDEIIDIAKKHGVDFIHPGY 103
            M+TVAIYS+EDRLS HRLKADEAY+IG+ G+YTPVGAYLAIDEII IAK+HGV FIHPGY
Sbjct: 1    MKTVAIYSNEDRLSMHRLKADEAYMIGEGGKYTPVGAYLAIDEIISIAKEHGVSFIHPGY 60

Query: 104  GFLSENAEFADKVQKAGITWIGPPPEVIESVGDKVSARNLAAKANVPTVPGTPGPIETVE 163
            GFLSENAEFA KV  AGITWIGPPPEVI SVGDKVSAR+LAAKANVPTVPGTPGPIE+VE
Sbjct: 61   GFLSENAEFAAKVIDAGITWIGPPPEVINSVGDKVSARDLAAKANVPTVPGTPGPIESVE 120

Query: 164  EAQDFVNKYGYPVIIKAAYXXXXXXXXXXXXXXXXADAFQRAKSEAITAFGNGTCFVERF 223
            EA+ FV +YGYPVIIKAA+                 DAFQRA SEA TAFGNGTCFVERF
Sbjct: 121  EAEAFVAEYGYPVIIKAAFGGGGRGMRVVREGDDIGDAFQRATSEAKTAFGNGTCFVERF 180

Query: 224  LDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDSILTDAVRL 283
            LDKPKHIEVQLLADN+GNV+HLFERDCSVQRRHQKVVEVAPAKTLP+EVRDSILTDAV+L
Sbjct: 181  LDKPKHIEVQLLADNYGNVIHLFERDCSVQRRHQKVVEVAPAKTLPKEVRDSILTDAVKL 240

Query: 284  AKEAGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITGIDLVSAQIQIAAGASLP 343
            AKEA YRNAGTAEFLVD QNRHYFIEINPRIQVEHTITEEITG+D+V+AQIQIAAGASL 
Sbjct: 241  AKEAKYRNAGTAEFLVDAQNRHYFIEINPRIQVEHTITEEITGVDVVAAQIQIAAGASLQ 300

Query: 344  QLGLLQDRITTRGFAIQCRITTEDPAKNFQPDTGRLEVYRSAGGNGVRLDGGTAYAGAVI 403
            QLGLLQD+ITTRGFAIQCRITTEDP+KNFQPDTGR+EVYRSAGGNGVRLDGG AYAGAVI
Sbjct: 301  QLGLLQDKITTRGFAIQCRITTEDPSKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGAVI 360

Query: 404  SPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWT 463
            SPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTH VF SG+YWT
Sbjct: 361  SPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHSVFKSGEYWT 420

Query: 464  TFIDDTPQLFHMVSSRNRAQKLLHYLADLAVNGSSIKGQIGEPKLKTHPQIPRLHDEDGS 523
            TFIDDTPQLF MVSS+NRAQKLLHYLADLAVNGSSIKGQIG PKL T P +P LHD +G+
Sbjct: 421  TFIDDTPQLFEMVSSQNRAQKLLHYLADLAVNGSSIKGQIGLPKLTTQPSVPTLHDSNGN 480

Query: 524  PVDVSVPPQKGWRYLLQSEGPEAFAKAVRHNQGTLVMDTTWRDAHQSLLATRVRTYDLXX 583
             VDV   P  GWR +L  +GPE FAK VR   GTL+MDTTWRDAHQSLLATRVRT+DL  
Sbjct: 481  VVDVLAAPPAGWRDVLLEQGPEGFAKQVRKYNGTLLMDTTWRDAHQSLLATRVRTHDLAT 540

Query: 584  XXXXXXXXXXXXXXLECWGGATFDVAMRFLHEDPWERLRILRKLVPNIPFQMLLRGANGV 643
                          LECWGGATF VAMRFLHEDPWERLR+LRKLVPNIPFQMLLRGANGV
Sbjct: 541  IAPTTAHALAGAFALECWGGATFVVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGV 600

Query: 644  AYSSLPDNAIDHFVKQAKDNGVDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCYSGD 703
            AYSSLPDNAIDHFV QAK+NGVDIFRVFDALNDLEQL                  CYSGD
Sbjct: 601  AYSSLPDNAIDHFVLQAKENGVDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCYSGD 660

Query: 704  MLQPGKKYNLDYYLDVTEKIVAMGTHILGIKDMAGTMKPAAAKLLIGAIRAKFPDLPIHV 763
            MLQPGKKYNLDYYL++T+KIV MGTHILGIKDMAGT+KP+AAKLLIG+IRAK+PDLPIHV
Sbjct: 661  MLQPGKKYNLDYYLEITDKIVKMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIHV 720

Query: 764  HSHDSAGTAVASMAACALAGADVVDVAINSMSGLTSQASVNAVLASLDGQIDTGINVKHV 823
            H+HDSAGTAVASMAACALAGADVVDVA NSMSGLTSQ S+NA+LASLDG+I+  ++V  V
Sbjct: 721  HTHDSAGTAVASMAACALAGADVVDVATNSMSGLTSQPSINALLASLDGEINNNVDVNMV 780

Query: 824  CELDAYWAEMRLLYSCFEADLKGPDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKKA 883
             ELDAYWA+MRLLYSCFEADLKGPDPEVY HEIPGGQLTNLLFQAQQLGLGE+W ETK+A
Sbjct: 781  RELDAYWAQMRLLYSCFEADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGERWAETKRA 840

Query: 884  YKQANQLLGDIVKVTPTSKVVGDLAQFMVSNQLTPDDIRRLANSLDFPDSVMDFFEGLMG 943
            Y++AN LLGD+VKVTPTSKVVGDLAQFMV+N+L  DD+RRLA+SLDFPDSVMDFFEGL+G
Sbjct: 841  YREANYLLGDLVKVTPTSKVVGDLAQFMVTNKLNSDDVRRLASSLDFPDSVMDFFEGLIG 900

Query: 944  QPYGGFPEPLRTDIXXXXXXXXXXXPGLELAPFDLAKIREDLEARFGDINECDVASYNMY 1003
            QPYGGFPEPLRTD+           PGLEL PFDL +I+EDL +RFGDI+ECDVASYNMY
Sbjct: 901  QPYGGFPEPLRTDVLKNKRRKLTCRPGLELPPFDLERIKEDLSSRFGDIDECDVASYNMY 960

Query: 1004 PKVYEDFQKILEEYGDLSVLPTRNFLAKPRVGEEIEVHIEQGKTLIIKLQAVGDLNEETG 1063
            PKVYEDF+KI E+YGDLSVLPT+NFL+ P VGEEI V IEQGKTLIIK QA+GDLN++TG
Sbjct: 961  PKVYEDFRKIREQYGDLSVLPTKNFLSPPAVGEEIVVTIEQGKTLIIKPQAIGDLNKDTG 1020

Query: 1064 IREVYFELNGETRKIRIADKSQVVQTIAKPKADGHDPLQIGAPMAGVIVEVKVHKGSQVK 1123
            IREVYFELNGE RK+ + D+SQ V+TI+KPKAD HDP Q+GAPMAGV+VEVKVHKGS VK
Sbjct: 1021 IREVYFELNGELRKVSVVDRSQKVETISKPKADAHDPYQVGAPMAGVVVEVKVHKGSLVK 1080

Query: 1124 KGQPVAVLSAMKMEMVISSTGEGLVKDVLVKDGE 1157
            KGQPVAVLSAMKMEMVISS   GLVKDVL+KDGE
Sbjct: 1081 KGQPVAVLSAMKMEMVISSPAAGLVKDVLIKDGE 1114

>CAGL0M05533g complement(588667..594171) similar to sp|P32528
            Saccharomyces cerevisiae YBR208c DUR1 urea amidolyase,
            hypothetical start
          Length = 1834

 Score =  315 bits (807), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 182/456 (39%), Positives = 260/456 (57%), Gaps = 11/456 (2%)

Query: 13   NFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGKE 72
            N S  G    +LVANRGEI +RI ++   + ++++AIYS  D+ S H L  D A  +   
Sbjct: 623  NESKKGHFKTVLVANRGEIAVRIIKTLKSMQIKSLAIYSATDKYSQHVLDVDMAQALDG- 681

Query: 73   GEYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKAGITWIGPPPEVIE 132
              +T    YL +++II IAKK+ VD I PGYGFLSENA FAD+ ++ GI +IGP  E I 
Sbjct: 682  --HTVEETYLHVEKIISIAKKYDVDAIIPGYGFLSENASFADRCEQEGIQFIGPRGETIR 739

Query: 133  SVGDKVSARNLAAKANVPTVPGTPGPIETVEEAQDFVNKYGYPVIIKAAYXXXXXXXXXX 192
             +G K SAR +A  A VP VPG+P  ++  +EA       GYPV++K+            
Sbjct: 740  KLGLKHSAREVAKSAGVPLVPGSP-LVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKV 798

Query: 193  XXXXXXADAFQRAKSEAITAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSV 252
                    AF+  K +  + FG+   F+E+F+D  +H+EVQ++ D  G  + L ERDCS+
Sbjct: 799  DNEQDMRKAFETVKHQGSSYFGDSGVFMEKFIDNARHVEVQIMGDGKGKTLALGERDCSL 858

Query: 253  QRRHQKVVEVAPAKTLPREVRDSILTDAVRLAKEAGYRNAGTAEFLVDNQ-NRHYFIEIN 311
            QRR+QKV+E  PA  LPRE R  +LT A RL     YR AGT EF+ D Q ++ YF+E+N
Sbjct: 859  QRRNQKVIEETPAPNLPRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVN 918

Query: 312  PRIQVEHTITEEITGIDLVSAQIQIAAGASLPQLGLLQDRITTRGFAIQCRITTEDPAKN 371
             R+QVEH ITE +TG+DLV   I+I+AG  +P L      I+  G +I+ R+  E+P K+
Sbjct: 919  TRLQVEHPITEMVTGLDLVEWMIKISAGV-MPSLDEFN--ISQNGASIEVRVYAENPLKD 975

Query: 372  FQPDTGRLEVYRSAGGNGVRLDGGTAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKMLRA 431
            F+P  G  E+      N  R+D      G  ISP +D  L K    G        KM +A
Sbjct: 976  FRPSPG--ELVDVQFPNDCRVDTWVK-KGTKISPEFDPTLAKIIVHGKDRNEAILKMKKA 1032

Query: 432  LIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFID 467
            L E +I G  TN+ +L +L++  +F +    T +++
Sbjct: 1033 LNETKIYGCVTNVDYLKSLISSEMFRNAQLSTNYLN 1068

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 40/77 (51%)

Query: 1081 ADKSQVVQTIAKPKADGHDPLQIGAPMAGVIVEVKVHKGSQVKKGQPVAVLSAMKMEMVI 1140
            AD  Q    + +      D   I +  AG   +  V  G+ ++K Q VAV+ AMK EM++
Sbjct: 1744 ADLKQTTTEVIEQNILEDDCEYIFSEYAGRFWKPIVEIGASIEKDQGVAVIEAMKTEMIV 1803

Query: 1141 SSTGEGLVKDVLVKDGE 1157
            SS+  G +K  L K+G+
Sbjct: 1804 SSSVVGKLKKFLFKNGD 1820

>Scas_721.40
          Length = 1834

 Score =  288 bits (737), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 166/438 (37%), Positives = 250/438 (57%), Gaps = 17/438 (3%)

Query: 23   ILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGKEGEYTPVGAYL 82
            +LVANRGEI +RI ++  ++ +++VAI+S  DR S H + AD    +  +G  +    YL
Sbjct: 630  VLVANRGEIAVRIIKTLKKMEIQSVAIFSTPDRYSQHVIDAD--LTVDLKG-VSAADTYL 686

Query: 83   AIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKAGITWIGPPPEVIESVGDKVSARN 142
             I++IID AKK G   I PGYGFLSENA+F+++    GIT++GP  +V+  +G K SAR 
Sbjct: 687  NIEKIIDAAKKTGAQAIIPGYGFLSENADFSERCDAEGITFVGPSGDVMRGLGLKHSARE 746

Query: 143  LAAKANVPTVPGTPGPIETVEEAQDFVNKYGYPVIIKAAYXXXXXXXXXXXXXXXXADAF 202
            +A KANVP VPG+   I T  EA++   K  YP+++K+                     F
Sbjct: 747  IAKKANVPLVPGS-SLITTAHEAKEIAAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIF 805

Query: 203  QRAKSEAITAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEV 262
            +  K +    FG+   F+ERF++  +H+EVQ++ D  GN + + ERDCS+QRR+QK++E 
Sbjct: 806  ETVKHQGAAYFGDSGVFMERFIENARHVEVQIMGDGLGNALAIGERDCSLQRRNQKIIEE 865

Query: 263  APAKTLPREVRDSILTDAVRLAKEAGYRNAGTAEFLVDN-QNRHYFIEINPRIQVEHTIT 321
             PA  LP   R  +   A RL     Y+ AGT EF+ D  ++  YF+E+N R+QVEH IT
Sbjct: 866  TPAPNLPETTRQKLREAAQRLGSLLKYKCAGTVEFIYDEIRDEFYFLEVNTRLQVEHPIT 925

Query: 322  EEITGIDLVSAQIQIAAGASLPQLGLLQDRITTRGFAIQCRITTEDPAKNFQPDTGRL-- 379
            E +TGIDLV   + IAA  + P    L  +I   G A++ R+  E+P  +F+P  G+L  
Sbjct: 926  EMVTGIDLVEWMLVIAADMA-PDFNQL--KIDVNGVAMEARLYAENPVHDFKPSPGQLVE 982

Query: 380  -EVYRSAGGNGVRLDGGTAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIR 438
             E  + A     R+D   +  G +++P YD  L K    G        K+ +AL+E ++ 
Sbjct: 983  VEFPKWA-----RIDTWVS-KGTIVTPEYDPTLAKIIVHGKDRHDALEKLNKALVETKVS 1036

Query: 439  GVKTNIPFLLTLLTHPVF 456
            G  TNI +L ++ +  +F
Sbjct: 1037 GCITNIDYLRSISSSEMF 1054

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 26/41 (63%)

Query: 1116 VHKGSQVKKGQPVAVLSAMKMEMVISSTGEGLVKDVLVKDG 1156
            V +G  VK GQ + ++ AMK EM++ +  +G V  ++ K+G
Sbjct: 1777 VTEGEFVKSGQGLIIIEAMKTEMLVPTLHDGKVLKIVHKNG 1817

>YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea
            amidolyase, contains urea carboxylase and allophanate
            hydrolase activities fused together in a single
            polypeptide [5508 bp, 1835 aa]
          Length = 1835

 Score =  285 bits (728), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 168/448 (37%), Positives = 249/448 (55%), Gaps = 11/448 (2%)

Query: 21   NKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGKEGEYTPVGA 80
            + +L+ANRGEI +RI ++  +L +R+VA+YS  D+ S H   AD +  +      T    
Sbjct: 634  DTVLIANRGEIAVRIIKTLKKLGIRSVAVYSDPDKYSQHVTDADVSVPLHGT---TAAQT 690

Query: 81   YLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKAGITWIGPPPEVIESVGDKVSA 140
            YL +++IID AK+     I PGYGFLSENA+F+D    AGIT++GP  ++I  +G K SA
Sbjct: 691  YLDMNKIIDAAKQTNAQAIIPGYGFLSENADFSDACTSAGITFVGPSGDIIRGLGLKHSA 750

Query: 141  RNLAAKANVPTVPGTPGPIETVEEAQDFVNKYGYPVIIKAAYXXXXXXXXXXXXXXXXAD 200
            R +A KA VP VPG+   I +VEEA+    +  YPV++K+                    
Sbjct: 751  RQIAQKAGVPLVPGSL-LITSVEEAKKVAAELEYPVMVKSTAGGGGIGLQKVDSEEDIEH 809

Query: 201  AFQRAKSEAITAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVV 260
             F+  K +  T FG+   F+ERF++  +H+EVQL+ D  G  + L ERDCS+QRR+QKV+
Sbjct: 810  IFETVKHQGETFFGDAGVFLERFIENARHVEVQLMGDGFGKAIALGERDCSLQRRNQKVI 869

Query: 261  EVAPAKTLPREVRDSILTDAVRLAKEAGYRNAGTAEFLVD-NQNRHYFIEINPRIQVEHT 319
            E  PA  LP + R ++   A  L     Y+ AGT EF+ D  ++  YF+E+N R+QVEH 
Sbjct: 870  EETPAPNLPEKTRLALRKAAESLGSLLNYKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHP 929

Query: 320  ITEEITGIDLVSAQIQIAAGASLPQLGLLQDRITTRGFAIQCRITTEDPAKNFQPDTGRL 379
            ITE +TG+DLV   I+IAA  + P       ++   G +++ R+  E+P KNF+P  G L
Sbjct: 930  ITEMVTGLDLVEWMIRIAANDA-PDFD--STKVEVNGVSMEARLYAENPLKNFRPSPGLL 986

Query: 380  EVYRSAGGNGVRLDGGTAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRG 439
               +    +  R+D      G  ISP YD  L K    G   +    K+ +AL E ++ G
Sbjct: 987  VDVKFP--DWARVDTWVK-KGTNISPEYDPTLAKIIVHGKDRDDAISKLNQALEETKVYG 1043

Query: 440  VKTNIPFLLTLLTHPVFISGDYWTTFID 467
              TNI +L +++T   F      T  ++
Sbjct: 1044 CITNIDYLKSIITSDFFAKAKVSTNILN 1071

>Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement
          Length = 1830

 Score =  279 bits (713), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 167/459 (36%), Positives = 246/459 (53%), Gaps = 14/459 (3%)

Query: 23   ILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGKEGEYTPVGAYL 82
            +L+ANRGEI +RI ++  +L++R+VA+YS  D+ S H + AD    +      T    YL
Sbjct: 629  VLIANRGEIAVRIIKTLKKLNIRSVAVYSDPDKYSQHVIDADLGVALNGR---TAAETYL 685

Query: 83   AIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKAGITWIGPPPEVIESVGDKVSARN 142
             ID+II  AK      I PGYGFLSENAEFADK  + GI ++GP  E I  +G K SAR 
Sbjct: 686  DIDKIIKAAKDTNAQAIIPGYGFLSENAEFADKCVEEGIVFVGPSGEAIRKLGLKHSARE 745

Query: 143  LAAKANVPTVPGTPGPIETVEEAQDFVNKYGYPVIIKAAYXXXXXXXXXXXXXXXXADAF 202
            +A KA VP VPG+ G + + +EA++  NK  YPV++K+                     F
Sbjct: 746  IAEKAGVPLVPGS-GLVTSAKEAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVF 804

Query: 203  QRAKSEAITAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEV 262
            +  + +    FG+   F+ERF++  +H+E+Q++ D +G  + + ERDCS+QRR+QK++E 
Sbjct: 805  ETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGYGKAIAIGERDCSLQRRNQKIIEE 864

Query: 263  APAKTLPREVRDSILTDAVRLAKEAGYRNAGTAEFLVDN-QNRHYFIEINPRIQVEHTIT 321
             PA  L    R  +   A  L     Y+ AGT EF+ D  ++  YF+E+N R+QVEH IT
Sbjct: 865  TPAPNLGETTRTKMRQAAESLGSLLKYKCAGTVEFIYDERRDEFYFLEVNARLQVEHPIT 924

Query: 322  EEITGIDLVSAQIQIAAGASLPQLGLLQDRITTRGFAIQCRITTEDPAKNFQPDTGRLEV 381
            E +TG+DLV   ++IAA  + P        I   G +I+ R+  E+PAK+F+P  G L  
Sbjct: 925  EMVTGLDLVEWMLRIAADDA-PDFE--SANIVVTGASIEARLYAENPAKDFRPSPGLLTD 981

Query: 382  YRSAGGNGVRLDGGTAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVK 441
                     R+D   +  G  +S  YD  L K    G        KM +AL E  + G  
Sbjct: 982  VHFP--EWARVDTWVS-KGTTVSAEYDPTLAKIIVHGKDRNDAIMKMNKALNETVVYGCI 1038

Query: 442  TNIPFLLTLLTHPVFISGDYWTTFIDD---TPQLFHMVS 477
            TNI +L ++ +  +F +    T  +D     P  F + S
Sbjct: 1039 TNIDYLRSIASSEMFKTAKVATKILDSYDYKPCAFEVTS 1077

 Score = 31.2 bits (69), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 24/42 (57%)

Query: 1116 VHKGSQVKKGQPVAVLSAMKMEMVISSTGEGLVKDVLVKDGE 1157
            V  G  V KG  + ++ AMK EMV+ +   G V  ++ K+G+
Sbjct: 1777 VSAGDTVTKGDGLVIVEAMKTEMVVPAKKSGKVLKIVHKNGD 1818

>KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharomyces
            cerevisiae YBR208c DUR1_2 urea amidolyase, start by
            similarity
          Length = 1829

 Score =  277 bits (708), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 161/446 (36%), Positives = 245/446 (54%), Gaps = 11/446 (2%)

Query: 23   ILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGKEGEYTPVGAYL 82
            +L+ANRGEI +RI ++   + +++VA+YS  D+ S H   AD  + +   G  T    YL
Sbjct: 627  VLIANRGEIAVRIMKTLKRMGIKSVAVYSDPDKYSQHVTDAD--FSVALHGR-TAAETYL 683

Query: 83   AIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKAGITWIGPPPEVIESVGDKVSARN 142
             ID+II+ AKK G   I PGYGFLSENA+F+D+  +  I ++GP  + I  +G K SAR 
Sbjct: 684  DIDKIINAAKKTGAQAIIPGYGFLSENADFSDRCSQENIVFVGPSGDAIRKLGLKHSARE 743

Query: 143  LAAKANVPTVPGTPGPIETVEEAQDFVNKYGYPVIIKAAYXXXXXXXXXXXXXXXXADAF 202
            +A +A VP VPG+ G I+  +EA++   K  YPV++K+                     F
Sbjct: 744  IAERAKVPLVPGS-GLIKDAKEAKEVAKKLEYPVMVKSTAGGGGIGLQKVDSEDDIERVF 802

Query: 203  QRAKSEAITAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEV 262
            +  + +  + FG+   F+ERF++  +H+E+Q++ D  G  + + ERDCS+QRR+QKV+E 
Sbjct: 803  ETVQHQGKSYFGDAGVFMERFVNNARHVEIQMMGDGFGKAIAIGERDCSLQRRNQKVIEE 862

Query: 263  APAKTLPREVRDSILTDAVRLAKEAGYRNAGTAEFLVDNQ-NRHYFIEINPRIQVEHTIT 321
             PA  LP   R  +   + RL     Y+ AGT EF+ D Q +  YF+E+N R+QVEH IT
Sbjct: 863  TPAPNLPEATRAKMRAASERLGSLLKYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPIT 922

Query: 322  EEITGIDLVSAQIQIAAGASLPQLGLLQDRITTRGFAIQCRITTEDPAKNFQPDTGRLEV 381
            E +TG+DLV   ++IAA  S P       +I   G +I+ R+  E+P K+F+P  G+L  
Sbjct: 923  EMVTGLDLVEWMLRIAANDS-PDFD--NTKIEVSGASIEARLYAENPVKDFRPSPGQLT- 978

Query: 382  YRSAGGNGVRLDGGTAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVK 441
               +  +  R+D      G  +S  YD  L K    G        K+ +AL E  + G  
Sbjct: 979  -SVSFPSWARVDTWVK-KGTNVSAEYDPTLAKIIVHGKDRNDAIMKLNQALNETAVYGCI 1036

Query: 442  TNIPFLLTLLTHPVFISGDYWTTFID 467
            TNI +L ++ +  +F      T  +D
Sbjct: 1037 TNIDYLRSIASSKMFKEAKVATKVLD 1062

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%)

Query: 1119 GSQVKKGQPVAVLSAMKMEMVISSTGEGLVKDVLVKDGE 1157
            G  V+ G  V ++ AMK EMV+ +T  G V  +L K+G+
Sbjct: 1779 GDHVEAGDGVIIIEAMKTEMVVGATKSGKVYKILHKNGD 1817

>ADR051C [1792] [Homologous to ScYBR208C (DUR12) - SH]
            (796213..801672) [5460 bp, 1819 aa]
          Length = 1819

 Score =  276 bits (705), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 170/461 (36%), Positives = 243/461 (52%), Gaps = 19/461 (4%)

Query: 21   NKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGKEGEYTPVGA 80
            + +LVANRGEI +RI R+   L +R+VA+YS  DR S H   AD A  +G     +    
Sbjct: 623  DTVLVANRGEIAVRIIRTLKRLGIRSVAVYSDPDRHSQHVRDADVAVALGGS---SAAET 679

Query: 81   YLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKAGITWIGPPPEVIESVGDKVSA 140
            YL ID+I+  AKK     I PGYGFLSENA FA++    GI ++GP  + I  +G K  A
Sbjct: 680  YLDIDKILAAAKKTDTQAIIPGYGFLSENATFAERCGAEGIVFVGPSGDSIRKLGLKHWA 739

Query: 141  RNLAAKANVPTVPGTPGPIETVEEAQDFVNKYGYPVIIKAAYXXXXXXXXXXXXXXXXAD 200
            R LAA A VP   GT G +++   A +   + GYP+++K+                  A 
Sbjct: 740  RELAASAGVPLTKGT-GLLQSASAALEAGEEIGYPLMVKSTAGGGGIGLQRVDSAAELAA 798

Query: 201  AFQRAKSEAITAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVV 260
            AF++ + +    F +   F+E F+ + +H+EVQ++ D HG  V L ERDCS+QRR+QK++
Sbjct: 799  AFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGDGHGRTVALGERDCSLQRRNQKII 858

Query: 261  EVAPAKTLPREVRDSILTDAVRLAKEAGYRNAGTAEFLVDNQ-NRHYFIEINPRIQVEHT 319
            E  PA  LP   R  +   A RL     Y+ AGT EF+ D Q +  YF+E+N R+QVEH 
Sbjct: 859  EETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQKDEFYFLEVNTRLQVEHP 918

Query: 320  ITEEITGIDLVSAQIQIAAGASLPQLGLLQDRITTRGFAIQCRITTEDPAKNFQPDTGRL 379
            ITE +TG+DLV   ++IAA    P        +   G +++ R+  E+P K F P  G L
Sbjct: 919  ITEMVTGLDLVEWMLRIAANTP-PD---FDAGVEIEGVSMEARVYVENPVKGFTPSPGLL 974

Query: 380  E--VYRSAGGNGVRLDGGTAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRI 437
               V+ S      R+D      G  ++  YD  L K    G   E    K+L AL E RI
Sbjct: 975  TEVVFPSWA----RVDTWI-LKGTRVAAEYDPTLAKIIVHGKDREDAVSKLLLALSETRI 1029

Query: 438  RGVKTNIPFLLTLLTHPVFISGDYWTTFIDD---TPQLFHM 475
             G  TN+ +L ++ +   F     +T  ++D   TP  F +
Sbjct: 1030 AGCMTNLDYLKSIASSEEFRKASVFTRLLNDFEYTPTAFEV 1070

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 44/81 (54%)

Query: 1077 KIRIADKSQVVQTIAKPKADGHDPLQIGAPMAGVIVEVKVHKGSQVKKGQPVAVLSAMKM 1136
            K+  +D    V+  A+P     D   + +  AG   +  V  G +VK+G  + ++ AMK 
Sbjct: 1725 KVANSDLETAVRKEAEPVEYPEDAHMVYSEYAGRFWKQVVSVGDKVKEGDKLVIIEAMKT 1784

Query: 1137 EMVISSTGEGLVKDVLVKDGE 1157
            EMV+S+T +G V ++L  +G+
Sbjct: 1785 EMVVSATADGEVINILHANGD 1805

>Kwal_27.11951
          Length = 1869

 Score =  270 bits (691), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 167/459 (36%), Positives = 250/459 (54%), Gaps = 14/459 (3%)

Query: 23   ILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGKEGEYTPVGAYL 82
            +LVANRGEI +RI ++  +L +++VA+YS  D+ S H   AD A  +      T    YL
Sbjct: 668  VLVANRGEIAVRIIKTLKKLKIKSVAVYSDPDKYSQHVTDADVAVALKGR---TAAETYL 724

Query: 83   AIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKAGITWIGPPPEVIESVGDKVSARN 142
             ID+II  AK+ G + I PGYGFLSENA+F+D+    GI ++GP  + I  +G K SAR 
Sbjct: 725  DIDKIIAAAKETGTEAIIPGYGFLSENADFSDRCASEGIVFVGPAGDAIRKLGLKHSARE 784

Query: 143  LAAKANVPTVPGTPGPIETVEEAQDFVNKYGYPVIIKAAYXXXXXXXXXXXXXXXXADAF 202
            +A KA VP VPG+ G ++T +EA++      YPV++K+                     F
Sbjct: 785  IAEKAGVPLVPGS-GLVKTPQEAREIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIERVF 843

Query: 203  QRAKSEAITAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEV 262
            +  + +    FG+   F+ERF++  +H+E+Q++ D  G  + + ERDCS+QRR+QKV+E 
Sbjct: 844  ETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGKGKAIAIGERDCSLQRRNQKVIEE 903

Query: 263  APAKTLPREVRDSILTDAVRLAKEAGYRNAGTAEFLVDN-QNRHYFIEINPRIQVEHTIT 321
             PA  L  + R  +   +  L     YR AGT EF+ D  ++  YF+E+N R+QVEH IT
Sbjct: 904  TPAPNLSEKTRARMREASENLGSLLKYRCAGTVEFIYDERRDEFYFLEVNARLQVEHPIT 963

Query: 322  EEITGIDLVSAQIQIAAGASLPQLGLLQDRITTRGFAIQCRITTEDPAKNFQPDTGRLEV 381
            E +TG+DLV   + IAAG   P       +IT  G +I+ R+  E+P K+F+P  G+L  
Sbjct: 964  EMVTGLDLVEWMLLIAAGTP-PDFD--ATKITVTGASIEARLYAENPVKDFRPSPGQLT- 1019

Query: 382  YRSAGGNGVRLDGGTAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVK 441
               +     R+D   +  G  IS  YD  L K    G   +   +K+ +AL E  I G  
Sbjct: 1020 -DVSFPEWARVDTWVS-KGTTISAEYDPTLAKIIVHGKDRDEAIQKLNQALNETSIYGCI 1077

Query: 442  TNIPFLLTLLTHPVFISGDYWTTFIDD---TPQLFHMVS 477
            TNI +L ++ +  +F +    T  +D     P  F + S
Sbjct: 1078 TNIDYLRSIASSEMFKTAKVATKVLDSYDYRPSAFEITS 1116

>AAR071W [257] [Homologous to ScYNR016C (ACC1) - SH; ScYMR207C
           (HFA1) - SH] complement(466791..473486) [6696 bp, 2231
           aa]
          Length = 2231

 Score =  210 bits (535), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 174/568 (30%), Positives = 264/568 (46%), Gaps = 94/568 (16%)

Query: 10  LRDNFSLLGEK---NKILVANRGEIPIRIFRSAHELSMRT---------VAIYSHED-RL 56
           LRD   L G     +KIL+AN G   ++  RS  + +  T         V + + ED   
Sbjct: 46  LRDYVRLHGGHTVISKILIANNGIAAVKEIRSVRKWAYETFGDGKVVQFVVMATPEDLEA 105

Query: 57  STHRLKADEAYVIGKEGEYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKV 116
           +T  ++  + YV    G  T    Y  +D I+D+A++  VD +  G+G  SEN    +K+
Sbjct: 106 NTEYIRMADQYVEVPGG--TNNNNYANVDLIVDVAERADVDAVWAGWGHASENPLLPEKL 163

Query: 117 --QKAGITWIGPPPEVIESVGDKVSARNLAAKANVPTVPGTPGPIETVE----------- 163
              K  + +IGPP   + S+GDK+S+  +A  A VP +P +   ++ VE           
Sbjct: 164 ARSKRKVVFIGPPGSAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDQVEIDPHTKLVSVA 223

Query: 164 ----------EAQDFVNK---YGYPVIIKAAYXXXXXXXXXXXXXXXXADAFQRAKSEAI 210
                       +D +NK    G+PV++KA+                    +Q+A +E  
Sbjct: 224 DDIYQKGCCLSPEDGLNKAKQIGFPVMVKASEGGGGKGIRKVVREEDFISLYQQAANE-- 281

Query: 211 TAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPR 270
                   F+ +   K +H+EVQLLAD +G  + LF RDCSVQRRHQK++E AP      
Sbjct: 282 --IPGSPIFIMKLAGKARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKP 339

Query: 271 EVRDSILTDAVRLAKEAGYRNAGTAEFLVDN-QNRHYFIEINPRIQVEHTITEEITGIDL 329
           +    +   AVRL K  GY +AGT E+L  + +++ YF+E+NPR+QVEH  TE +TG++L
Sbjct: 340 DTFAEMERAAVRLGKLVGYVSAGTVEYLYSHEEDKFYFLELNPRLQVEHPTTEMVTGVNL 399

Query: 330 VSAQIQIAAGASLPQL-------GL-------------------LQDRITTRGFAIQCRI 363
            +AQ+QIA G  L ++       GL                    Q R   +G    CRI
Sbjct: 400 PAAQLQIAMGIPLHRIRDIRLFYGLDPHTATEIDFEFSSADALQTQRRPIPKGHCTACRI 459

Query: 364 TTEDPAKNFQPDTGRLEV--YRSA----GGNGVRLDGGTAYAGAVISPHYDSMLVKCSCS 417
           T+EDP + F+P  G L    +RS+    G   V  +GG       I    DS        
Sbjct: 460 TSEDPNEGFKPSGGSLHELNFRSSSNVWGYFSVGNNGG-------IHSFSDSQFGHIFAF 512

Query: 418 GSTYEIVRRKMLRALIEFRIRG-VKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFHMV 476
           G   +  R+ M+ AL E  IRG  +T + +L+ LL    F      T ++DD      ++
Sbjct: 513 GENRQASRKHMVVALKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLDD------LI 566

Query: 477 SSRNRAQKLLHYLADLAVNGSSIKGQIG 504
           S +  A+K    LA   + G++ K  I 
Sbjct: 567 SQKISAEKPDPMLA--VICGATTKAHIA 592

 Score = 38.1 bits (87), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 29/52 (55%)

Query: 1098 HDPLQIGAPMAGVIVEVKVHKGSQVKKGQPVAVLSAMKMEMVISSTGEGLVK 1149
            +DP Q+  P  G +V   V  G  ++ GQP A +  MKM+M + +   G+++
Sbjct: 698  NDPTQLRTPSPGKLVNFLVESGDHLEAGQPYAEIEVMKMQMPLIAQESGVLQ 749

>CAGL0L10780g complement(1149588..1156289) highly similar to
           sp|Q00955 Saccharomyces cerevisiae YNR016c ACC1 or
           sp|P32874 Saccharomyces cerevisiae YMR207c HFA1, start
           by similarity
          Length = 2233

 Score =  209 bits (533), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 164/538 (30%), Positives = 252/538 (46%), Gaps = 97/538 (18%)

Query: 21  NKILVANRGEIPIRIFRSAHELSMRT---------VAIYSHEDRLSTHRLKADEAYV-IG 70
           +K+L+AN G   ++  RS  + +  T         VA+ + ED      L+A+  Y+ + 
Sbjct: 60  SKVLIANNGIAAVKEIRSVRKWAYETFGDEKIVQFVAMATPED------LEANAEYIRMA 113

Query: 71  KEGEYTPVGA----YLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKV--QKAGITWI 124
            +    P G     Y  +D I+DIA++  VD +  G+G  SEN    +K+   K  I +I
Sbjct: 114 DQYVEVPGGTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLARSKRKILFI 173

Query: 125 GPPPEVIESVGDKVSARNLAAKANVPTVPGTPGPIETV---------------------- 162
           GPP   + S+GDK+S+  +A  A VP +P +   ++TV                      
Sbjct: 174 GPPGNAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDTVHIDEKNGLVSVDDDIYQKGCCS 233

Query: 163 --EEAQDFVNKYGYPVIIKAAYXXXXXXXXXXXXXXXXADAFQRAKSEAITAFGNGTCFV 220
             E+  +   K G+PV+IKA+                  + + +A +E          F+
Sbjct: 234 SPEDGLEKAKKIGFPVMIKASEGGGGKGIRQVTREEDFINLYHQAANE----IPGSPIFI 289

Query: 221 ERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDSILTDA 280
            +   K +H+EVQLLAD +G  + LF RDCSVQRRHQK++E AP      E    +   A
Sbjct: 290 MKLAGKARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAGPETFGEMEKAA 349

Query: 281 VRLAKEAGYRNAGTAEFLVD-NQNRHYFIEINPRIQVEHTITEEITGIDLVSAQIQIAAG 339
           VRL K  GY +AGT E+L   + N+ YF+E+NPR+QVEH  TE +TG++L +AQ+QIA G
Sbjct: 350 VRLGKLVGYVSAGTVEYLYSHDDNKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMG 409

Query: 340 ASLPQLGLL--------------------QDRITT------RGFAIQCRITTEDPAKNFQ 373
             + ++  +                    +D + T      +G    CRIT+EDP   F+
Sbjct: 410 IPMHRISDIRIFYGLNPRGSSEIDFEFKSEDSLKTQRKPIPKGHCTACRITSEDPNDGFK 469

Query: 374 PDTGRLEV--YRSA----GGNGVRLDGGTAYAGAVISPHYDSMLVKCSCSGSTYEIVRRK 427
           P  G L    +RS+    G   V  +GG       I    DS        G   +  R+ 
Sbjct: 470 PSGGTLNELNFRSSSNVWGYFSVGNNGG-------IHSFSDSQFGHIFAFGENRQASRKH 522

Query: 428 MLRALIEFRIRG-VKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFHMVSSRNRAQK 484
           M+ AL E  IRG  +T + +L+ LL    F      T ++DD      ++S++  A+K
Sbjct: 523 MVVALKELSIRGDFRTTVEYLIKLLETEDFEENTITTGWLDD------LISTKMTAKK 574

 Score = 37.7 bits (86), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%)

Query: 1098 HDPLQIGAPMAGVIVEVKVHKGSQVKKGQPVAVLSAMKMEMVISSTGEGLVK 1149
            +DP Q+  P  G +V+  V  G  +  GQ  A +  MKM+M + S   G+V+
Sbjct: 698  NDPTQLRTPSPGKLVKFLVENGDHIAAGQAYAEIEVMKMQMPLLSQENGIVQ 749

>Scas_720.74
          Length = 2231

 Score =  209 bits (531), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 162/538 (30%), Positives = 252/538 (46%), Gaps = 97/538 (18%)

Query: 21  NKILVANRGEIPIRIFRS---------AHELSMRTVAIYSHEDRLSTHRLKADEAYV-IG 70
           +KIL+AN G   ++  RS          +E +++ VA+ + ED      L+A+  Y+ + 
Sbjct: 60  SKILIANNGIAAVKEIRSVRKWAYETFGNERTIQFVAMATPED------LEANAEYIRMA 113

Query: 71  KEGEYTPVGA----YLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKV--QKAGITWI 124
            +    P G     Y  +D I+DIA++  VD +  G+G  SEN    +K+   K  + +I
Sbjct: 114 DQYVEVPGGTNNKNYANVDLIVDIAERADVDAVWAGWGHASENPHLPEKLAMSKRKVVFI 173

Query: 125 GPPPEVIESVGDKVSARNLAAKANVPTVPGTPGPIETV---------------------- 162
           GPP   + S+GDK+S+  +A  A+VP +P +   I+ V                      
Sbjct: 174 GPPGSAMRSLGDKISSTIVAQSAHVPCIPWSGTGIDKVQVDKDTGLVSVADEVYAQGCCS 233

Query: 163 --EEAQDFVNKYGYPVIIKAAYXXXXXXXXXXXXXXXXADAFQRAKSEAITAFGNGTCFV 220
             E+  +   K G+PV+IKA+                    + +A +E          F+
Sbjct: 234 SPEDGLEKAKKIGFPVMIKASEGGGGKGIRQVEREEDFIALYHQAANE----IPGSPIFI 289

Query: 221 ERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDSILTDA 280
            +   K +H+EVQLLAD +GN + LF RDCSVQRRHQK++E AP      E    +   A
Sbjct: 290 MKLAGKARHLEVQLLADQYGNNISLFGRDCSVQRRHQKIIEEAPVTIAAPETFAMMEKSA 349

Query: 281 VRLAKEAGYRNAGTAEFLVDNQNRH-YFIEINPRIQVEHTITEEITGIDLVSAQIQIAAG 339
           VRL K  GY +AGT E+L  ++++  YF+E+NPR+QVEH  TE +TG++L + Q+QIA G
Sbjct: 350 VRLGKLVGYVSAGTVEYLYSHEDKKFYFLELNPRLQVEHPTTEMVTGVNLPATQLQIAMG 409

Query: 340 ASLPQLGLL--------------------------QDRITTRGFAIQCRITTEDPAKNFQ 373
             + ++  +                          Q +   +G    CRIT+EDP + F+
Sbjct: 410 IPMHRISDIRVFYGMNPHTASEIDFDFSTEESLKTQRKPVPKGHCTACRITSEDPDEGFK 469

Query: 374 PDTGRLEV--YRSA----GGNGVRLDGGTAYAGAVISPHYDSMLVKCSCSGSTYEIVRRK 427
           P  G L    +RS+    G   V  +GG       I    DS        G   +  R+ 
Sbjct: 470 PSGGSLHELNFRSSSNVWGYFSVGNNGG-------IHSFSDSQFGHIFAFGENRQASRKH 522

Query: 428 MLRALIEFRIRG-VKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFHMVSSRNRAQK 484
           M+ AL E  IRG  +T + +L+ LL    F      T ++DD      ++S +  A+K
Sbjct: 523 MVVALKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLDD------LISHKMTAEK 574

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 29/52 (55%)

Query: 1098 HDPLQIGAPMAGVIVEVKVHKGSQVKKGQPVAVLSAMKMEMVISSTGEGLVK 1149
            +DP Q+  P  G +V+  V  G  +  GQP A +  MKM+M + +   G+++
Sbjct: 698  NDPTQLRTPSPGKLVKFLVESGDHIAAGQPYAEIEVMKMQMPLVAQETGIIQ 749

>KLLA0F06072g 583276..589971 highly similar to sp|Q00955
           Saccharomyces cerevisiae YNR016c ACC1 acetyl-CoA
           carboxylase, start by similarity
          Length = 2231

 Score =  204 bits (520), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 162/563 (28%), Positives = 259/563 (46%), Gaps = 99/563 (17%)

Query: 21  NKILVANRGEIPIRIFRSAHELSMRT---------VAIYSHEDRLSTHRLKADEAYV-IG 70
           +K+L+AN G   ++  RS  + +  T         VA+ + ED      L+A+  Y+ + 
Sbjct: 61  SKVLIANNGIAAVKEIRSVRKWAYETFGDERTVQFVAMATPED------LEANAEYIRMA 114

Query: 71  KEGEYTPVGA----YLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKA--GITWI 124
            +    P G     Y  +D I+++A++  VD +  G+G  SEN    +++  +   I +I
Sbjct: 115 DQYIEVPGGTNNNNYANVDLIVEVAERADVDAVWAGWGHASENPLLPERLAASHRKIIFI 174

Query: 125 GPPPEVIESVGDKVSARNLAAKANVPTVPGTPGPIETV---------------------- 162
           GPP   + S+GDK+S+  +A  A VP +P +   ++ V                      
Sbjct: 175 GPPGNAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDEVHVDKETNLVSVEDKVYQEGCCS 234

Query: 163 --EEAQDFVNKYGYPVIIKAAYXXXXXXXXXXXXXXXXADAFQRAKSEAITAFGNGTCFV 220
             E+      + G+P+++KA+                    +Q+A +E          F+
Sbjct: 235 SPEDGLKKAKEIGFPIMVKASEGGGGKGIRKVENEDEFLSLYQQAANE----IPGSPIFI 290

Query: 221 ERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDSILTDA 280
            +   K +H+EVQLLAD +G  + LF RDCSVQRRHQK++E AP      +    +   A
Sbjct: 291 MKLAGKARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFTEMEKAA 350

Query: 281 VRLAKEAGYRNAGTAEFLVD-NQNRHYFIEINPRIQVEHTITEEITGIDLVSAQIQIAAG 339
           VRL +  GY +AGT E+L   ++++ YF+E+NPR+QVEH  TE +TG++L SAQ+QIA G
Sbjct: 351 VRLGQLVGYVSAGTVEYLYSHDEDKFYFLELNPRLQVEHPTTEMVTGVNLPSAQLQIAMG 410

Query: 340 A--------------------------SLPQLGLLQDRITTRGFAIQCRITTEDPAKNFQ 373
                                      S P+    Q + T +G    CRIT+EDP + F+
Sbjct: 411 IPMHRIRDIRLLYGVDPKSASEIDFNFSTPESAKTQRKPTPKGHCTACRITSEDPNEGFK 470

Query: 374 PDTGRLEV--YRSA----GGNGVRLDGGTAYAGAVISPHYDSMLVKCSCSGSTYEIVRRK 427
           P  G L    +RS+    G   V  +GG       I    DS        G   +  R+ 
Sbjct: 471 PSGGALHELNFRSSSNVWGYFSVGNNGG-------IHSFSDSQFGHIFAFGENRQASRKH 523

Query: 428 MLRALIEFRIRG-VKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFHMVSSRNRAQKLL 486
           M+ AL E  IRG  +T + +L+ LL    F      T ++DD      ++S +  A+K  
Sbjct: 524 MVVALKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLDD------LISQKMTAEKPD 577

Query: 487 HYLADLAVNGSSIKGQIGEPKLK 509
             L+   + G++ K  I   K +
Sbjct: 578 RTLS--VICGAATKAHIASQKAR 598

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%)

Query: 1098 HDPLQIGAPMAGVIVEVKVHKGSQVKKGQPVAVLSAMKMEMVISSTGEGLVK 1149
            +DP Q+  P  G +V+  V  G  V  GQP A +  MKM+M + S   G+V+
Sbjct: 699  NDPTQLRTPSPGKLVKFLVENGDHVIAGQPYAEVEVMKMQMPLISQENGVVQ 750

>YNR016C (ACC1) [4599] chr14 complement(654672..661373) Acetyl-CoA
           carboxylase, first and rate-limiting step in fatty acid
           biosynthesis pathway [6702 bp, 2233 aa]
          Length = 2233

 Score =  202 bits (514), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 156/527 (29%), Positives = 236/527 (44%), Gaps = 101/527 (19%)

Query: 21  NKILVANRGEIPIRIFRSAHELSMRT---------VAIYSHEDRLSTHRLKADEAYV-IG 70
           +KIL+AN G   ++  RS  + +  T         VA+ + ED      L+A+  Y+ + 
Sbjct: 60  SKILIANNGIAAVKEIRSVRKWAYETFGDDRTVQFVAMATPED------LEANAEYIRMA 113

Query: 71  KEGEYTPVGA----YLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQ--KAGITWI 124
            +    P G     Y  +D I+DIA++  VD +  G+G  SEN    +K+   K  + +I
Sbjct: 114 DQYIEVPGGTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLSQSKRKVIFI 173

Query: 125 GPPPEVIESVGDKVSARNLAAKANVPTVPGTPGPIETV---------------------- 162
           GPP   + S+GDK+S+  +A  A VP +P +   ++TV                      
Sbjct: 174 GPPGNAMRSLGDKISSTIVAQSAKVPCIPWSGTGVDTVHVDEKTGLVSVDDDIYQKGCCT 233

Query: 163 --EEAQDFVNKYGYPVIIKAAYXXXXXXXXXXXXXXXXADAFQRAKSEAITAFGNGTCFV 220
             E+      + G+PV+IKA+                    + +A +E          F+
Sbjct: 234 SPEDGLQKAKRIGFPVMIKASEGGGGKGIRQVEREEDFIALYHQAANE----IPGSPIFI 289

Query: 221 ERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDSILTDA 280
            +   + +H+EVQLLAD +G  + LF RDCSVQRRHQK++E AP      E    +   A
Sbjct: 290 MKLAGRARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKAETFHEMEKAA 349

Query: 281 VRLAKEAGYRNAGTAEFLVDNQN-RHYFIEINPRIQVEHTITEEITGIDLVSAQIQIAAG 339
           VRL K  GY +AGT E+L  + + + YF+E+NPR+QVEH  TE ++G++L +AQ+QIA G
Sbjct: 350 VRLGKLVGYVSAGTVEYLYSHDDGKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMG 409

Query: 340 ASLPQLGLL--------------------------QDRITTRGFAIQCRITTEDPAKNFQ 373
             + ++  +                          Q R   +G    CRIT+EDP   F+
Sbjct: 410 IPMHRISDIRTLYGMNPHSASEIDFEFKTQDATKKQRRPIPKGHCTACRITSEDPNDGFK 469

Query: 374 PDTGRLEV-----------YRSAGGNGVRLDGGTAYAGAVISPHYDSMLVKCSCSGSTYE 422
           P  G L             Y S G NG             I    DS        G   +
Sbjct: 470 PSGGTLHELNFRSSSNVWGYFSVGNNG------------NIHSFSDSQFGHIFAFGENRQ 517

Query: 423 IVRRKMLRALIEFRIRG-VKTNIPFLLTLLTHPVFISGDYWTTFIDD 468
             R+ M+ AL E  IRG  +T + +L+ LL    F      T ++DD
Sbjct: 518 ASRKHMVVALKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLDD 564

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%)

Query: 1098 HDPLQIGAPMAGVIVEVKVHKGSQVKKGQPVAVLSAMKMEMVISSTGEGLVK 1149
            +DP Q+  P  G +V+  V  G  + KGQP A +  MKM+M + S   G+V+
Sbjct: 698  NDPTQLRTPSPGKLVKFLVENGEHIIKGQPYAEIEVMKMQMPLVSQENGIVQ 749

>YMR207C (HFA1) [4163] chr13 complement(677192..683563) Protein with
           similarity to acetyl-CoA carboxylase [6372 bp, 2123 aa]
          Length = 2123

 Score =  200 bits (509), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 136/434 (31%), Positives = 211/434 (48%), Gaps = 51/434 (11%)

Query: 81  YLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKA--GITWIGPPPEVIESVGDKV 138
           Y  ID I+D+A++  VD +  G+G  SEN    + +  +   I +IGPP   + S+GDK+
Sbjct: 54  YANIDLILDVAEQTDVDAVWAGWGHASENPCLPELLASSQRKILFIGPPGRAMRSLGDKI 113

Query: 139 SARNLAAKANVPTVPGTPGPIETV------------------------EEAQDFVNKYGY 174
           S+  +A  A +P +P +   I+T+                        E+A +     G+
Sbjct: 114 SSTIVAQSAKIPCIPWSGSHIDTIHIDNKTNFVSVPDDVYVRGCCSSPEDALEKAKLIGF 173

Query: 175 PVIIKAAYXXXXXXXXXXXXXXXXADAFQRAKSEAITAFGNGTCFVERFLDKPKHIEVQL 234
           PV+IKA+                  D F     +A+        FV + +   +H+EVQL
Sbjct: 174 PVMIKAS----EGGGGKGIRRVDNEDDFIALYRQAVNETPGSPMFVMKVVTDARHLEVQL 229

Query: 235 LADNHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDSILTDAVRLAKEAGYRNAGT 294
           LAD +G  + LF RDCS+QRRHQK++E AP      E    +   A+RL +  GY +AGT
Sbjct: 230 LADQYGTNITLFGRDCSIQRRHQKIIEEAPVTITKPETFQRMERAAIRLGELVGYVSAGT 289

Query: 295 AEFLVD-NQNRHYFIEINPRIQVEHTITEEITGIDLVSAQIQIAAGASLPQLGLLQ---- 349
            E+L     ++ YF+E+NPR+QVEH  TE I+G++L + Q+QIA G  +  +  ++    
Sbjct: 290 VEYLYSPKDDKFYFLELNPRLQVEHPTTEMISGVNLPATQLQIAMGIPMHMISDIRKLYG 349

Query: 350 --------------DRITTRGFAIQCRITTEDPAKNFQPDTGRLEVYRSAGGNGVRLDGG 395
                          R + +G  I CRIT+EDP + F+P TG++        + V     
Sbjct: 350 LDPTGTSYIDFKNLKRPSPKGHCISCRITSEDPNEGFKPSTGKIHELNFRSSSNVWGYFS 409

Query: 396 TAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRG-VKTNIPFLLTLLTHP 454
               GA+ S   DS        G+  +  ++ M+ AL +F IRG  KT I +L+ LL   
Sbjct: 410 VGNNGAIHS-FSDSQFGHIFAVGNDRQDAKQNMVLALKDFSIRGEFKTPIEYLIELLETR 468

Query: 455 VFISGDYWTTFIDD 468
            F S +  T ++DD
Sbjct: 469 DFESNNISTGWLDD 482

 Score = 35.0 bits (79), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 29/51 (56%)

Query: 1099 DPLQIGAPMAGVIVEVKVHKGSQVKKGQPVAVLSAMKMEMVISSTGEGLVK 1149
            +P Q+ +P  G +V+  V  G  V  GQ  A +  MKM+M + +  +G+++
Sbjct: 618  NPTQVISPTPGKLVKYLVRSGDHVFAGQQYAEIEIMKMQMPLVAKSDGVIE 668

>Kwal_23.6157
          Length = 2230

 Score =  200 bits (508), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 152/528 (28%), Positives = 246/528 (46%), Gaps = 77/528 (14%)

Query: 21  NKILVANRGEIPIRIFRS---------AHELSMRTVAIYSHED-RLSTHRLKADEAYVIG 70
           +K+L+AN G   ++  RS          +E +++ VA+ + ED   +   L+  + YV  
Sbjct: 61  SKVLIANNGIAAVKEIRSVRKWAYETFGNERAVQFVAMATPEDLEANAEYLRMADQYVEV 120

Query: 71  KEGEYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKA--GITWIGPPP 128
             G  T    Y  +D I+++A++  VD +  G+G  SEN    +++  +   + +IGPP 
Sbjct: 121 PGG--TNNNNYANVDLIVELAERADVDAVWAGWGHASENPLLPERLAASPRKVIFIGPPG 178

Query: 129 EVIESVGDKVSARNLAAKANVPTVP--GT----------------------PGPIETVEE 164
             + S+GDK+S+  +A  A VP +P  GT                       G  ++ E+
Sbjct: 179 NAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDQVHLDEENGLVSVTDDIYQKGCCDSPED 238

Query: 165 AQDFVNKYGYPVIIKAAYXXXXXXXXXXXXXXXXADAFQRAKSEAITAFGNGTCFVERFL 224
                 K G+PV++KA+                    +++A +E          F+ +  
Sbjct: 239 GLAKAKKIGFPVMVKASEGGGGKGIRKVEREQDFIPLYKQAANE----IPGSPIFIMKLA 294

Query: 225 DKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDSILTDAVRLA 284
              +H+EVQLLAD +G  + LF RDCSVQRRHQK++E AP      +    +   AVRL 
Sbjct: 295 GNARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFTEMERSAVRLG 354

Query: 285 KEAGYRNAGTAEFLVD-NQNRHYFIEINPRIQVEHTITEEITGIDLVSAQIQIAAGASLP 343
           K  GY +AGT E+L   + ++ YF+E+NPR+QVEH  TE ++G++L +AQ+QIA G  + 
Sbjct: 355 KLVGYVSAGTVEYLYSHDDDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPMH 414

Query: 344 QLG--------------------------LLQDRITTRGFAIQCRITTEDPAKNFQPDTG 377
           ++                            +Q R T +G    CRIT+EDP + F+P  G
Sbjct: 415 RIKDIRLMYGVDPHTATEIDFDFSSKDSTKIQRRPTPKGHCTACRITSEDPNEGFKPSGG 474

Query: 378 RLEVYRSAGGNGVRLDGGTAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRI 437
            L        + V      + +G + S   DS        G   +  R+ M+ AL E  I
Sbjct: 475 SLHELNFRSSSNVWGYFSVSSSGGIHS-FSDSQFGHIFAFGENRQASRKHMVVALKELSI 533

Query: 438 RG-VKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFHMVSSRNRAQK 484
           RG  +T + +L+ LL    F      T ++DD      ++S +  A+K
Sbjct: 534 RGDFRTTVEYLIKLLETEDFEGNSITTGWLDD------LISQKMTAEK 575

 Score = 38.5 bits (88), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%)

Query: 1098 HDPLQIGAPMAGVIVEVKVHKGSQVKKGQPVAVLSAMKMEMVISSTGEGLVK 1149
            +DP Q+  P  G +V+     G  V  GQP A +  MKM+M + S   G+++
Sbjct: 699  NDPTQLRTPSPGKLVKFLFESGDHVIAGQPYAEVEVMKMQMPLVSQESGIIQ 750

>ABR157W [750] [Homologous to ScYJR109C (CPA2) - SH]
           complement(695747..699088) [3342 bp, 1113 aa]
          Length = 1113

 Score = 61.2 bits (147), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 76/322 (23%), Positives = 129/322 (40%), Gaps = 37/322 (11%)

Query: 37  RSAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGKEGEYTPVGAYLAIDEIIDIAKKHGV 96
           ++  E   RT+ I  +     T    ADE Y +    E+        I  +I   +  G+
Sbjct: 56  KALKETGKRTILINPNIATNQTSYSLADEVYFLPVTPEF--------ITHVIKRERPDGI 107

Query: 97  DFIHPGYGFLSENAEF--ADKVQKAGITWIGPPPEVIESVGDKVSARNLAAKA----NVP 150
                G   L+       A  ++K G+T +G P  V+E+  D    R L A+A    N+P
Sbjct: 108 LLTFGGQTGLNCGVALQRAVTLEKYGVTVLGTPISVLETTED----RELFARALKEINMP 163

Query: 151 TVPGTPGPIETVEEAQDFVNKYGYPVIIKAAYXXXXXXXXXXXXXXXXADAFQRAKSEAI 210
                     TVE+A    N  GYPVI+++AY                 D  Q  +  A 
Sbjct: 164 IAESVA--CSTVEDAVAAANDIGYPVIVRSAYALGGLGSGFAD------DDLQLRQLCAQ 215

Query: 211 TAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQR------RHQKVVEVAP 264
           +   +    VE+ L   K IE +++ D  GN + +    C+++            + +AP
Sbjct: 216 SLALSPQVLVEKSLKGWKEIEYEVVRDRVGNCITV----CNMENFDPLGIHTGDSIVLAP 271

Query: 265 AKTLPREVRDSILTDAVRLAKEAGYRNAGTAEFLVDNQNRHY-FIEINPRIQVEHTITEE 323
           ++TL  E    + T A+ + +  G       ++ +      +  IE+N R+     +  +
Sbjct: 272 SQTLSDEEFHMLRTAAIEIIRHLGVVGECNVQYALQPDGLAFKVIEVNARLSRSSALASK 331

Query: 324 ITGIDLVSAQIQIAAGASLPQL 345
            TG  L     +IA G +LP+L
Sbjct: 332 ATGYPLAYTAAKIALGYTLPEL 353

>Kwal_55.19783
          Length = 1121

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/241 (24%), Positives = 104/241 (43%), Gaps = 27/241 (11%)

Query: 116 VQKAGITWIGPPPEVIESVGDKVSARNLAAKA----NVPTVPGTPGPIETVEEAQDFVNK 171
           +QK G+  +G P + +E+  D    R+L A+A    N+PT        ETV+EA    ++
Sbjct: 132 LQKYGVKVLGTPIKTLETSED----RDLFAQALKEINIPTAESFA--CETVDEALSAASR 185

Query: 172 YGYPVIIKAAYXXXXXXXXXXXXXXXXADAFQRAKSEAITAFGNGTCFVERFLDKPKHIE 231
            GYPVI+++AY                 +   +A S +          VE+ L   K +E
Sbjct: 186 VGYPVIVRSAYALGGLGSGFAENEAEMKELAAQALSLS------PQILVEKSLKGWKEVE 239

Query: 232 VQLLADNHGNVVHLFERDCSVQR------RHQKVVEVAPAKTLPREVRDSILTDAVRLAK 285
            +++ D   N + +    C+++            +  AP++TL  E    + T A+++ +
Sbjct: 240 YEVVRDRVDNCITV----CNMENFDPLGVHTGDSIVFAPSQTLSDEEFHMLRTAAIKIIR 295

Query: 286 EAGYRNAGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEITGIDLVSAQIQIAAGASLPQ 344
             G       ++ +      Y  IE+N R+     +  + TG  L     +IA G +LP+
Sbjct: 296 HLGVVGECNVQYALQPDGLDYRVIEVNARLSRSSALASKATGYPLAYTAAKIALGYTLPE 355

Query: 345 L 345
           L
Sbjct: 356 L 356

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 61/319 (19%), Positives = 121/319 (37%), Gaps = 36/319 (11%)

Query: 37  RSAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGKEGEYTPVGAYLAIDEIIDIAK-KHG 95
           R+  E   +T+ I  + + +ST   + D  Y              L+ + ++DI + +H 
Sbjct: 609 RALREKGKKTIMINYNPETVSTDFDEVDRLYF-----------EELSFERVMDIYELEHS 657

Query: 96  VDFIHPGYGFLSENAEFADKVQKAGITWIGPPPEVIESVGDKVSARNLAAKANVPTVPGT 155
              +    G L +N   A K+ + G   +G  PE I+       A N    +++    G 
Sbjct: 658 EGAVISVGGQLPQN--IALKMLENGANILGTSPEDIDR------AENRHKFSSILDTIGV 709

Query: 156 PGP----IETVEEAQDFVNKYGYPVIIKAAYXXXXXXXXXXXXXXXXADAFQRAKSEAIT 211
             P    + +V EA+DF    GYPV+I+ +Y                 D  +   + A  
Sbjct: 710 DQPEWSELSSVSEAKDFSKSVGYPVLIRPSYVLSGAAMSVVNSE----DELETKLTNASD 765

Query: 212 AFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPR 270
              +    + +F++  + I+V  +A N   +VH           H      + P ++L  
Sbjct: 766 VSPDHPVVISKFIEGAQEIDVDAVAYNGEVLVHAISEHVENAGVHSGDATLILPPQSLSE 825

Query: 271 EVRDSILTDAVRLAKEAGYRNAGTAEFLVDNQNRH-----YFIEINPRIQVEHTITEEIT 325
            +++ +   A ++A    ++  G     +   +RH       IE N R         ++ 
Sbjct: 826 SIKERLYDIAKKVAH--AWKITGPFNMQIIKDDRHEGTSLKVIECNIRASRSFPFVSKVL 883

Query: 326 GIDLVSAQIQIAAGASLPQ 344
           G + +   ++   G  +P+
Sbjct: 884 GCNFIDVAVKAFIGEDVPE 902

>Sklu_2413.4 YJR109C, Contig c2413 10886-14254
          Length = 1122

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 55/240 (22%), Positives = 102/240 (42%), Gaps = 27/240 (11%)

Query: 117 QKAGITWIGPPPEVIESVGDKVSARNLAAKA----NVPTVPGTPGPIETVEEAQDFVNKY 172
           +K G+  +G P + +E+  D    R+L A+A    N+P         ET+++A +   K 
Sbjct: 133 EKYGVKVLGTPIKTLETSED----RDLFAQALKEINIPIAESFA--CETIDQALEAAAKV 186

Query: 173 GYPVIIKAAYXXXXXXXXXXXXXXXXADAFQRAKSEAITAFGNGTCFVERFLDKPKHIEV 232
            YPVI+++AY                 +   ++ S A          VE+ L   K IE 
Sbjct: 187 KYPVIVRSAYALGGLGSGFANDEQEMKELASQSLSLA------PQILVEKSLKGWKEIEY 240

Query: 233 QLLADNHGNVVHLFERDCSVQR------RHQKVVEVAPAKTLPREVRDSILTDAVRLAKE 286
           +++ D  GN + +    C+++            +  AP++TL  E    + + A+++ + 
Sbjct: 241 EVVRDRVGNCITV----CNMENFDPLGIHTGDSIVFAPSQTLSDEEFHMLRSAAIKIIRH 296

Query: 287 AGYRNAGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEITGIDLVSAQIQIAAGASLPQL 345
            G       ++ +      Y  IE+N R+     +  + TG  L     +IA G +LP+L
Sbjct: 297 LGVVGECNVQYALQPDGLDYRVIEVNARLSRSSALASKATGYPLAYTAAKIALGYTLPEL 356

 Score = 31.6 bits (70), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 34/187 (18%), Positives = 71/187 (37%), Gaps = 8/187 (4%)

Query: 159 IETVEEAQDFVNKYGYPVIIKAAYXXXXXXXXXXXXXXXXADAFQRAKSEAITAFGNGTC 218
           + +V EA+ F +K GYPV+I+ +Y                 D  +   + A     +   
Sbjct: 717 LTSVNEAKIFASKVGYPVLIRPSYVLSGAAMSVVNSE----DELEVKLTNASDVSPDHPV 772

Query: 219 FVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVE-VAPAKTLPREVRDSIL 277
            + +F++  + I+V  +A +   +VH           H      + P + L  E +  + 
Sbjct: 773 VISKFIEGAQEIDVDAVAYDGKVLVHAISEHVENAGVHSGDASLILPPQHLSEETKQRLK 832

Query: 278 TDAVRLAKEAGYRNAGTAEFLVDNQNRHY---FIEINPRIQVEHTITEEITGIDLVSAQI 334
             A ++AK          + + D+++       IE N R         ++ GI+ +   +
Sbjct: 833 DIADKVAKAWNICGPFNMQIIKDDRDHGTSLKVIECNIRASRSFPFVSKVLGINFIDVAV 892

Query: 335 QIAAGAS 341
           +   G +
Sbjct: 893 KAFLGGN 899

>Sklu_2331.1 YJL130C, Contig c2331 2029-8691
          Length = 2220

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 72/348 (20%), Positives = 138/348 (39%), Gaps = 50/348 (14%)

Query: 19  EKNKILVANRGEIPI-----------RIFRSAHELSMRTVAIYSHEDRLSTHRLKADEAY 67
           E  K+LV   G + I           +  ++  E  + T+ I  +   + T +  AD+ Y
Sbjct: 437 EAKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVY 496

Query: 68  VIGKEGEYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKAGITWIGPP 127
            +    E+        + ++I   +   +     G   LS   E  D+ +  G+  +G P
Sbjct: 497 FLPVTAEF--------VRKVILHERPDAIYVTFGGQTALSVGIEMKDEFETLGVKVLGTP 548

Query: 128 PEVIESVGDKVSARNLAAKANVPTVPGTPGPIETVEEAQDFVNKYGYPVIIKAAYXXXXX 187
            + + +  D+    N   + N            TV+EA + V + G+PVI++AAY     
Sbjct: 549 IDTVITTEDRELFSNAMDEINEKCAKSKAA--STVKEALEAVKEIGFPVIVRAAY----- 601

Query: 188 XXXXXXXXXXXADAFQRAKSEAI----TAFGNG-TCFVERFLDKPKHIEVQLLADNHGNV 242
                         F   ++E +     AF +     VER +   K +E +++ D   N 
Sbjct: 602 ------ALGGLGSGFASNETELVDLCNVAFASSPQVLVERSMKGWKEVEYEVVRDAFDNC 655

Query: 243 VHLFERDCSVQR------RHQKVVEVAPAKTLPREVRDSILTDAVRLAKEAGYRNAGTAE 296
           + +    C+++            + VAP++TL  E  + + T AV + +  G       +
Sbjct: 656 ITV----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQ 711

Query: 297 FLVDNQNRHY-FIEINPRIQVEHTITEEITGIDLVSAQIQIAAGASLP 343
           + ++  ++ Y  IE+N R+     +  + TG  L  A I    G ++P
Sbjct: 712 YALNPFSKEYCIIEVNARLSRSSALASKATGYPL--AFIAAKLGLNIP 757

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 53/309 (17%), Positives = 117/309 (37%), Gaps = 24/309 (7%)

Query: 37   RSAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGKEGEYTPVGAYLAIDEIIDIAKKHGV 96
            R+    +++T+ +  + + +ST   +AD  Y              + ++ I+DI +    
Sbjct: 1007 RTLRANNVKTIMVNYNPETVSTDYDEADRLYF-----------ETINLERILDIYEAEAS 1055

Query: 97   DFIHPGYGFLSENAEFADKVQKAGITWIGPPPEVIESVGDKVSARNLAAKANVPTVPGTP 156
              +    G  + N   A  + +  +  +G  PE+I+S  ++     +  +  V      P
Sbjct: 1056 AGVVISMGGQTSN-NIAMSLHREKVKILGTSPEMIDSAENRYKFSRMLDQIGV----DQP 1110

Query: 157  G--PIETVEEAQDFVNKYGYPVIIKAAYXXXXXXXXXXXXXXXXADAFQRAKSEAITAFG 214
                + +++EA+ F    GYPV+++ +Y                A       ++A+    
Sbjct: 1111 AWKELTSIDEAEGFAENVGYPVLVRPSYVLSGAAMNTVYSKDDLASYL----NQAVEVSR 1166

Query: 215  NGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPREVR 273
            +    + ++++  K IE+  +A +   V+H+          H      + P + L  E  
Sbjct: 1167 DYPVVITKYIENAKEIEMDAVAKDGELVMHVVSEHVENAGVHSGDATLIVPPQDLDPETV 1226

Query: 274  DSILTDAVRLAKEAGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITGIDLVSAQ 333
            + I+    ++ K          +F+  N N    IE N R         ++ G++L+   
Sbjct: 1227 NRIVVATAKIGKALKITGPYNIQFIAKN-NDIKVIECNVRASRSFPFISKVVGVNLIEMA 1285

Query: 334  IQIAAGASL 342
             +   G  L
Sbjct: 1286 TKAVMGLPL 1294

>Kwal_33.14061
          Length = 2221

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 71/334 (21%), Positives = 131/334 (39%), Gaps = 48/334 (14%)

Query: 19  EKNKILVANRGEIPI-----------RIFRSAHELSMRTVAIYSHEDRLSTHRLKADEAY 67
           E  K+LV   G + I           +  ++  E  + T+ I  +   + T +  AD+ Y
Sbjct: 437 EAKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVY 496

Query: 68  VIGKEGEYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKAGITWIGPP 127
                  + PV A   + ++I   +   +     G   LS   E  D+ +  G+  +G P
Sbjct: 497 -------FLPVNAEF-VRKVILHERPDAIYVTFGGQTALSVGIEMKDEFEALGVKVLGTP 548

Query: 128 PEVIESVGDKVSARNLAAKANVPTVPGTPGPIETVEEAQDFVNKYGYPVIIKAAYXXXXX 187
            + + +  D+    N   + N            TVEEA + V + G+PVI +AAY     
Sbjct: 549 IDTVITTEDRELFSNAMDEINEKCAKSKAAA--TVEEALEAVKEIGFPVICRAAY----- 601

Query: 188 XXXXXXXXXXXADAFQRAKSEAI----TAFGNG-TCFVERFLDKPKHIEVQLLADNHGNV 242
                         F   + E +     AF +     VER +   K +E +++ D   N 
Sbjct: 602 ------ALGGLGSGFANNEKELVDLCNIAFASSPQVLVERSMKGWKEVEYEVVRDAFDNC 655

Query: 243 VHLFERDCSVQR------RHQKVVEVAPAKTLPREVRDSILTDAVRLAKEAGYRNAGTAE 296
           + +    C+++            + VAP++TL  E  + + T AV + +  G       +
Sbjct: 656 ITV----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQ 711

Query: 297 FLVDNQNRHY-FIEINPRIQVEHTITEEITGIDL 329
           + ++  ++ Y  IE+N R+     +  + TG  L
Sbjct: 712 YALNPFSKEYCIIEVNARLSRSSALASKATGYPL 745

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 49/306 (16%), Positives = 115/306 (37%), Gaps = 24/306 (7%)

Query: 37   RSAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGKEGEYTPVGAYLAIDEIIDIAKKHGV 96
            R+  +  ++++ +  + + +ST   +AD  Y              + ++ I+DI +    
Sbjct: 1007 RTLRKEKIKSIMVNYNPETVSTDYDEADRLYF-----------ETICLERILDIYEIESS 1055

Query: 97   DFIHPGYGFLSENAEFADKVQKAGITWIGPPPEVIESVGDKVSARNLAAKANVPTVPGTP 156
              +    G  + N   A  + +  +  +G  PE+I+S  ++     +  +  V      P
Sbjct: 1056 AGVVVSMGGQTSN-NIAMSLHRENVKILGTTPEMIDSAENRYKFSRMLDQIGV----DQP 1110

Query: 157  G--PIETVEEAQDFVNKYGYPVIIKAAYXXXXXXXXXXXXXXXXADAFQRAKSEAITAFG 214
                + ++EEA+ F +   +PV+++ +Y                 D      ++A+    
Sbjct: 1111 AWKELTSIEEAEQFADAVSFPVLVRPSYVLSGAAMNTVYSK----DDLASYLNQAVEVSR 1166

Query: 215  NGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPREVR 273
            +    + ++++  K IE+  +A +   V+H+          H      + P + L  E  
Sbjct: 1167 DYPVVITKYIENAKEIEMDAVAKDGELVMHVVSEHVENAGVHSGDATLIVPPQDLDPETV 1226

Query: 274  DSILTDAVRLAKEAGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITGIDLVSAQ 333
            + I+    ++ K          +F+  N N    IE N R         ++  ++L+   
Sbjct: 1227 ERIVVATAKIGKALKITGPFNIQFIAKN-NDIKVIECNVRASRSFPFISKVVNVNLIEMA 1285

Query: 334  IQIAAG 339
             +   G
Sbjct: 1286 TKAIMG 1291

>KLLA0F03190g complement(296883..300236) highly similar to sp|P03965
           Saccharomyces cerevisiae YJR109c CPA2 arginine-specific
           carbamoylphosphate synthase, large chain, start by
           similarity
          Length = 1117

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 54/239 (22%), Positives = 105/239 (43%), Gaps = 27/239 (11%)

Query: 118 KAGITWIGPPPEVIESVGDKVSARNLAAKA----NVPTVPGTPGPIETVEEAQDFVNKYG 173
           K  I  +G P + +E+  D    R+L A+A    ++PT        ETV+ A +  +  G
Sbjct: 132 KYNIKVLGTPIKTLETSED----RDLFAQALKEIDIPTAESIA--CETVDAALEAADIVG 185

Query: 174 YPVIIKAAYXXXXXXXXXXXXXXXXADAFQRAKSEAITAFGNGTCFVERFLDKPKHIEVQ 233
           +PVI+++AY                A   ++  S++++        VE+ L   K +E +
Sbjct: 186 FPVIVRSAYALGGLGSGFANN----AQEMKQLASQSLSLAPQ--ILVEKSLKGWKEVEYE 239

Query: 234 LLADNHGNVVHLFERDCSVQR------RHQKVVEVAPAKTLPREVRDSILTDAVRLAKEA 287
           ++ D  GN + +    C+++            +  AP++TL  E    + + A+++ +  
Sbjct: 240 VVRDRVGNCITV----CNMENFDPLGIHTGDSIVFAPSQTLSDEEFHMLRSAAIKIIRHL 295

Query: 288 GYRNAGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEITGIDLVSAQIQIAAGASLPQL 345
           G       ++ +   +  Y  IE+N R+     +  + TG  L     +IA G +LP+L
Sbjct: 296 GVIGECNVQYALSPDSLDYRVIEVNARLSRSSALASKATGYPLAYTAAKIALGYTLPEL 354

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/197 (19%), Positives = 78/197 (39%), Gaps = 8/197 (4%)

Query: 159 IETVEEAQDFVNKYGYPVIIKAAYXXXXXXXXXXXXXXXXADAFQRAKSEAITAFGNGTC 218
           + +VEEA+ F N+ GYPV+I+ +Y                    +   + A     +   
Sbjct: 714 LSSVEEAKVFANQVGYPVLIRPSYVLSGAAMSVVTGEHE----LEVKLTTASDVSPDHPV 769

Query: 219 FVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPREVRDSIL 277
            + +F++  + I+V  +A N   +VH           H      V P + L + ++D + 
Sbjct: 770 VMSKFIEGAQEIDVDAVAHNGMVLVHAISEHVENAGIHSGDATLVLPPQNLSQNIKDRLK 829

Query: 278 TDAVRLAKEAGYRNAGTAEFLVDNQNRHY---FIEINPRIQVEHTITEEITGIDLVSAQI 334
             A ++AK          + + D+++       IE N R         ++ G++ + A +
Sbjct: 830 EIADKVAKAWNITGPFNMQIIKDDRDEGVSLKVIECNIRASRSFPFVSKVLGVNFIEAAV 889

Query: 335 QIAAGASLPQLGLLQDR 351
           Q      +P+   L D+
Sbjct: 890 QAFLSKDVPEPVNLMDK 906

>CAGL0L05676g 619734..626369 highly similar to sp|P07259
           Saccharomyces cerevisiae YJL130c URA2, start by
           similarity
          Length = 2211

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 72/336 (21%), Positives = 130/336 (38%), Gaps = 52/336 (15%)

Query: 19  EKNKILVANRGEIPI-----------RIFRSAHELSMRTVAIYSHEDRLSTHRLKADEAY 67
           E  K+LV   G + I           +  ++  E  + T+ I  +   + T +  AD+ Y
Sbjct: 435 EAKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVY 494

Query: 68  VIGKEGEYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKAGITWIGPP 127
            +    E+        + ++I   +   +     G   LS   E  D+ +  G+  +G P
Sbjct: 495 FLPVTAEF--------VRKVILHERPDAIYVTFGGQTALSVGIEMKDEFESLGVKVLGTP 546

Query: 128 PEVIESVGDKVSARNLAAKA--NVPTVPGTPGPIETVEEAQDFVNKYGYPVIIKAAYXXX 185
            + I +  D    R L A A   +           +VEEA   V   G+PVI++AAY   
Sbjct: 547 IDTIITTED----RELFANAIDEIDEKCAKSQAANSVEEALAAVKDIGFPVIVRAAY--- 599

Query: 186 XXXXXXXXXXXXXADAFQRAKSEAI----TAFGNG-TCFVERFLDKPKHIEVQLLADNHG 240
                           F   + E I     AF +     VER +   K +E +++ D   
Sbjct: 600 --------ALGGLGSGFANNEQELIDLCNVAFASSPQVLVERSMKGWKEVEYEVVRDAFD 651

Query: 241 NVVHLFERDCSVQR------RHQKVVEVAPAKTLPREVRDSILTDAVRLAKEAGYRNAGT 294
           N + +    C+++            + VAP++TL  E  + + T AV + +  G      
Sbjct: 652 NCITV----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECN 707

Query: 295 AEFLVDNQNRHY-FIEINPRIQVEHTITEEITGIDL 329
            ++ ++  ++ Y  IE+N R+     +  + TG  L
Sbjct: 708 IQYALNPFSKEYCIIEVNARLSRSSALASKATGYPL 743

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/297 (17%), Positives = 118/297 (39%), Gaps = 24/297 (8%)

Query: 37   RSAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGKEGEYTPVGAYLAIDEIIDIAKKHGV 96
            R+    +++T+ I  + + +ST   +AD  Y              + ++ ++DI +    
Sbjct: 1005 RTLRANNIKTIMINYNPETVSTDYDEADRLYF-----------ETINLERVLDIYEAEAS 1053

Query: 97   DFIHPGYGFLSENAEFADKVQKAGITWIGPPPEVIESVGDKVSARNLAAKANVPTVPGTP 156
            + +    G  + N   A  + +  +  +G  P++I+S  ++     +  +  V      P
Sbjct: 1054 NGVVVSMGGQTSN-NIAMSLHRENVKILGTSPDMIDSAENRYKFSRMLDQIGV----DQP 1108

Query: 157  G--PIETVEEAQDFVNKYGYPVIIKAAYXXXXXXXXXXXXXXXXADAFQRAKSEAITAFG 214
                + +++EA+DF  K GYPV+++ +Y                 +  +   ++A+    
Sbjct: 1109 AWKELTSMDEAEDFAEKVGYPVLVRPSYVLSGAAMNTVYSK----NDLESYLNQAVEVSR 1164

Query: 215  NGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPREVR 273
            +    + ++++  K IE+  +A N   V+H+          H      + P + L  E  
Sbjct: 1165 DYPVVITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLIVPPQDLAPETV 1224

Query: 274  DSILTDAVRLAKEAGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITGIDLV 330
            D I+    ++ K          +F+  + N    IE N R         ++ G++L+
Sbjct: 1225 DRIVVATAKIGKALKITGPYNIQFIAKD-NEIKVIECNVRASRSFPFISKVVGVNLI 1280

>Scas_582.4*
          Length = 2193

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 55/304 (18%), Positives = 117/304 (38%), Gaps = 20/304 (6%)

Query: 37   RSAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGKEGEYTPVGAYLAIDEIIDIAKKHGV 96
            R+     ++T+ I  + + +ST   +AD  Y              + ++ I+DI +    
Sbjct: 982  RTLRANKIKTIMINYNPETVSTDYDEADRLYF-----------ETINLERILDIYEIENS 1030

Query: 97   DFIHPGYGFLSENAEFADKVQKAGITWIGPPPEVIESVGDKVSARNLAAKANVPTVPGTP 156
              +    G  + N   A  + +  +  +G  PE+I+S  ++     +  +  V   P   
Sbjct: 1031 SGVVVSMGGQTSN-NIAMSLHRENVKILGTSPEMIDSAENRYKFSRMLDQIGVDQ-PAWK 1088

Query: 157  GPIETVEEAQDFVNKYGYPVIIKAAYXXXXXXXXXXXXXXXXADAFQRAKSEAITAFGNG 216
              + +++EA+ F  K GYPV+++ +Y                A       ++A+    + 
Sbjct: 1089 -ELTSMDEAESFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLASYL----NQAVEVSRDY 1143

Query: 217  TCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPREVRDS 275
               + ++++  K IE+  +A N   V+H+          H      + P + L +E  D 
Sbjct: 1144 PVVITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLIVPPQDLAKETVDR 1203

Query: 276  ILTDAVRLAKEAGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITGIDLVSAQIQ 335
            I+    ++ K          +F+  + N    IE N R         ++ G++L+    +
Sbjct: 1204 IVVATAKIGKALKITGPYNIQFIAKD-NEIKVIECNVRASRSFPFISKVVGVNLIELATK 1262

Query: 336  IAAG 339
               G
Sbjct: 1263 AVMG 1266

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 70/334 (20%), Positives = 127/334 (38%), Gaps = 48/334 (14%)

Query: 19  EKNKILVANRGEIPI-----------RIFRSAHELSMRTVAIYSHEDRLSTHRLKADEAY 67
           E  K+LV   G + I           +  ++  E  + T+ I  +   + T +  AD+ Y
Sbjct: 432 EAKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVY 491

Query: 68  VIGKEGEYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKAGITWIGPP 127
            +    E+        + ++I   +   +     G   LS   E  D+ +  G+  +G  
Sbjct: 492 FLPVTAEF--------VRKVILHERPDAIYVTFGGQTALSVGIEMKDEFESLGVKVLGTQ 543

Query: 128 PEVIESVGDKVSARNLAAKANVPTVPGTPGPIETVEEAQDFVNKYGYPVIIKAAYXXXXX 187
            + I +  D+    N   + N            +VEEA   V   G+PVI++AAY     
Sbjct: 544 IDTIITTEDRELFANAIDEINEKCAKSHAA--NSVEEALTAVKDIGFPVIVRAAY----- 596

Query: 188 XXXXXXXXXXXADAFQRAKSEAI----TAFGNG-TCFVERFLDKPKHIEVQLLADNHGNV 242
                         F   + E I     AF +     VER +   K IE +++ D   N 
Sbjct: 597 ------ALGGLGSGFANNEQELIDLCNVAFASSPQVLVERSMKGWKEIEYEVVRDAFDNC 650

Query: 243 VHLFERDCSVQR------RHQKVVEVAPAKTLPREVRDSILTDAVRLAKEAGYRNAGTAE 296
           V +    C+++            + VAP++TL  E  + +   AV + +  G       +
Sbjct: 651 VTV----CNMENFDPLGIHTGDSIVVAPSQTLSDEEYNMLRNTAVNVIRHLGVVGECNIQ 706

Query: 297 FLVDNQNRHY-FIEINPRIQVEHTITEEITGIDL 329
           + ++  ++ Y  IE+N R+     +  + TG  L
Sbjct: 707 YALNPFSKEYCIIEVNARLSRSSALASKATGYPL 740

>ACR263C [1310] [Homologous to ScYJL130C (URA2) - SH]
           (827830..834552) [6723 bp, 2240 aa]
          Length = 2240

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 67/330 (20%), Positives = 126/330 (38%), Gaps = 40/330 (12%)

Query: 19  EKNKILVANRGEIPI-----------RIFRSAHELSMRTVAIYSHEDRLSTHRLKADEAY 67
           E  K+LV   G + I           +  ++  E  + T+ I  +   + T +  AD+ Y
Sbjct: 453 EPKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVY 512

Query: 68  VIGKEGEYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKAGITWIGPP 127
            +    E+        + ++I   +   +     G   LS   E  D+ +  G+  +G  
Sbjct: 513 FLPVTAEF--------VRKVILHERPDAIYVTFGGQTALSVGIEMKDEFEALGVKVLGTS 564

Query: 128 PEVIESVGDKVSARNLAAKANVPTVPGTPGPIETVEEAQDFVNKYGYPVIIKAAYXXXXX 187
            + I +  D+    N   + N            TV+EA + V   G+PVI++AAY     
Sbjct: 565 IDTIITTEDRELFANAMDEINEKCAKSKAA--STVDEALEAVKDIGFPVIVRAAYALGGL 622

Query: 188 XXXXXXXXXXXADAFQRAKSEAITAFGNG-TCFVERFLDKPKHIEVQLLADNHGNVVHLF 246
                       D           AF +     VER +   K +E +++ D   N + + 
Sbjct: 623 GSGFASNEQELVDLCN-------VAFASSPQVLVERSMKGWKEVEYEVVRDAFDNCITV- 674

Query: 247 ERDCSVQR------RHQKVVEVAPAKTLPREVRDSILTDAVRLAKEAGYRNAGTAEFLVD 300
              C+++            + VAP++TL  E  + + T AV + +  G       ++ ++
Sbjct: 675 ---CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALN 731

Query: 301 NQNRHY-FIEINPRIQVEHTITEEITGIDL 329
             ++ Y  IE+N R+     +  + TG  L
Sbjct: 732 PFSKEYCIIEVNARLSRSSALASKATGYPL 761

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/306 (17%), Positives = 118/306 (38%), Gaps = 24/306 (7%)

Query: 37   RSAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGKEGEYTPVGAYLAIDEIIDIAKKHGV 96
            R+  + +++T+ +  + + +ST   + D  Y              + ++ I+DI +    
Sbjct: 1023 RTLRQNNVKTIMVNYNPETVSTDYDEVDRLYF-----------ETINMERILDIYEVESS 1071

Query: 97   DFIHPGYGFLSENAEFADKVQKAGITWIGPPPEVIESVGDKVSARNLAAKANVPTVPGTP 156
              +    G  + N   A  + +  +  +G  PE+I+S  ++     +  +  V      P
Sbjct: 1072 AGVVVSMGGQTSN-NIAMSLHRENVKILGTSPEMIDSAENRYKFSRMLDQIEV----DQP 1126

Query: 157  G--PIETVEEAQDFVNKYGYPVIIKAAYXXXXXXXXXXXXXXXXADAFQRAKSEAITAFG 214
                + ++EEA+DF NK GYPV+++ +Y                 D  +   ++A+    
Sbjct: 1127 AWKELTSMEEAEDFANKVGYPVLVRPSYVLSGAAMNTVYSK----DDLESYLNQAVEVSR 1182

Query: 215  NGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPREVR 273
                 + ++++  K IE+  +A +   ++H+          H      + P + L  E  
Sbjct: 1183 EYPVVITKYIENAKEIEMDAVAKDGEMIMHVVSEHVENAGVHSGDATLIVPPQDLDPETV 1242

Query: 274  DSILTDAVRLAKEAGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITGIDLVSAQ 333
              I+    ++ +          +F+  N N    IE N R         ++ G++L+   
Sbjct: 1243 RRIVDATAKIGRALKITGPYNIQFIAKN-NEIKVIECNVRASRSFPFISKVIGVNLIEMA 1301

Query: 334  IQIAAG 339
             +   G
Sbjct: 1302 TKAIMG 1307

>Scas_691.19
          Length = 1117

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 52/238 (21%), Positives = 97/238 (40%), Gaps = 21/238 (8%)

Query: 116 VQKAGITWIGPPPEVIESVGDKVSARNLAAKANVPTVPGTPGPIETVEEAQDFVNKYGYP 175
           ++K  +  +G P + + +  D+    N   + N+P          TV+EA    N   YP
Sbjct: 129 LKKYNVKVLGTPIKTLITSEDRDLFANALKEINIPIANSIA--CATVDEALAAANSIKYP 186

Query: 176 VIIKAAYXXXXXXXXXXXXXXXXADAFQRAKSEAITAFGNGT-CFVERFLDKPKHIEVQL 234
           VII++AY                A+  Q  K  +  +        VER +   K +E ++
Sbjct: 187 VIIRSAYALGGLGSGF-------ANNDQELKQLSSQSLSLSPQILVERSMKGWKEVEYEV 239

Query: 235 LADNHGNVVHLFERDCSVQR------RHQKVVEVAPAKTLPREVRDSILTDAVRLAKEAG 288
           + D  GN + +    C+++            +  AP++TL  E    + + A+++ +  G
Sbjct: 240 VRDRVGNCITV----CNMENFDPLGVHTGDSIVFAPSQTLSDEEYHMLRSAAIKIIRHLG 295

Query: 289 YRNAGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEITGIDLVSAQIQIAAGASLPQL 345
                  ++ +      Y  IE+N R+     +  + TG  L     +IA G +LP+L
Sbjct: 296 VIGECNVQYALQPDGLDYCVIEVNARLSRSSALASKATGYPLAYTAAKIALGYTLPEL 353

 Score = 30.8 bits (68), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 6/65 (9%)

Query: 120 GITWIGPPPEVIESVGDKVSARNLAAKANVPTVPGTPG--PIETVEEAQDFVNKYGYPVI 177
           G   +G  P  I+   D+    ++    NV    G P    + +V+EA+ F +K GYPV+
Sbjct: 677 GCKILGTSPVDIDRAEDRHKFSSILDSINV----GQPAWSELTSVDEAKVFADKVGYPVL 732

Query: 178 IKAAY 182
           I+ +Y
Sbjct: 733 IRPSY 737

>YJL130C (URA2) [2788] chr10 complement(165641..172285)
           Multifunctional protein of pyrimidine biosynthesis
           pathway, contains glutamine amidotransferase,
           glutamine-dependent carbamylphosphate synthetase
           (CPSase), dihydroorotase-like (DHOase) domain, and
           aspartate carbamyltransferase (ATCase) [6645 bp, 2214
           aa]
          Length = 2214

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 65/329 (19%), Positives = 126/329 (38%), Gaps = 38/329 (11%)

Query: 19  EKNKILVANRGEIPI-----------RIFRSAHELSMRTVAIYSHEDRLSTHRLKADEAY 67
           E  K+LV   G + I           +  ++  E  + T+ I  +   + T +  AD+ Y
Sbjct: 437 EAKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVY 496

Query: 68  VIGKEGEYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKAGITWIGPP 127
            +    E+        + ++I   +   +     G   LS      D+ +  G+  +G P
Sbjct: 497 FVPVTAEF--------VRKVILHERPDAIYVTFGGQTALSVGIAMKDEFEALGVKVLGTP 548

Query: 128 PEVIESVGDKVSARNLAAKANVPTVPGTPGPIETVEEAQDFVNKYGYPVIIKAAYXXXXX 187
            + I +  D+    N   + N            +V+EA   V + G+PVI++AAY     
Sbjct: 549 IDTIITTEDRELFSNAIDEINEKCAKSQAA--NSVDEALAAVKEIGFPVIVRAAYALGGL 606

Query: 188 XXXXXXXXXXXADAFQRAKSEAITAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFE 247
                       D    A S +          VE+ +   K +E +++ D   N + +  
Sbjct: 607 GSGFANNEKELVDLCNVAFSSS------PQVLVEKSMKGWKEVEYEVVRDAFDNCITV-- 658

Query: 248 RDCSVQR------RHQKVVEVAPAKTLPREVRDSILTDAVRLAKEAGYRNAGTAEFLVDN 301
             C+++            + VAP++TL  E  + + T AV + +  G       ++ ++ 
Sbjct: 659 --CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNP 716

Query: 302 QNRHY-FIEINPRIQVEHTITEEITGIDL 329
            ++ Y  IE+N R+     +  + TG  L
Sbjct: 717 VSKDYCIIEVNARLSRSSALASKATGYPL 745

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/309 (16%), Positives = 119/309 (38%), Gaps = 24/309 (7%)

Query: 37   RSAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGKEGEYTPVGAYLAIDEIIDIAKKHGV 96
            R+    +++T+ +  + + +ST   +AD  Y              + ++ ++DI +    
Sbjct: 1007 RTLRANNIKTIMVNYNPETVSTDYDEADRLYF-----------ETINLERVLDIYEIENS 1055

Query: 97   DFIHPGYGFLSENAEFADKVQKAGITWIGPPPEVIESVGDKVSARNLAAKANVPTVPGTP 156
              +    G  + N   A  + +  +  +G  P++I+S  ++     +  +  V      P
Sbjct: 1056 SGVVVSMGGQTSN-NIAMTLHRENVKILGTSPDMIDSAENRYKFSRMLDQIGV----DQP 1110

Query: 157  G--PIETVEEAQDFVNKYGYPVIIKAAYXXXXXXXXXXXXXXXXADAFQRAKSEAITAFG 214
                + +++EA+ F  K GYPV+++ +Y                 +  +   ++A+    
Sbjct: 1111 AWKELTSMDEAESFAEKVGYPVLVRPSYVLSGAAMNTVYSK----NDLESYLNQAVEVSR 1166

Query: 215  NGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPREVR 273
            +    + ++++  K IE+  +A N   V+H+          H      + P + L  E  
Sbjct: 1167 DYPVVITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLIVPPQDLAPETV 1226

Query: 274  DSILTDAVRLAKEAGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITGIDLVSAQ 333
            D I+    ++ K          +F+  + N    IE N R         ++ G++L+   
Sbjct: 1227 DRIVVATAKIGKALKITGPYNIQFIAKD-NEIKVIECNVRASRSFPFISKVVGVNLIELA 1285

Query: 334  IQIAAGASL 342
             +   G  L
Sbjct: 1286 TKAIMGLPL 1294

>YJR109C (CPA2) [3001] chr10 complement(629500..632856)
           Carbamoylphosphate synthetase of arginine biosynthetic
           pathway, synthetase (large) subunit [3357 bp, 1118 aa]
          Length = 1118

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 53/239 (22%), Positives = 97/239 (40%), Gaps = 27/239 (11%)

Query: 118 KAGITWIGPPPEVIESVGDKVSARNLAAKA----NVPTVPGTPGPIETVEEAQDFVNKYG 173
           K  +  +G P + + +  D    R+L A A    N+P         ETV+EA +   +  
Sbjct: 131 KYNVKVLGTPIKTLITSED----RDLFASALKDINIPIAESFA--CETVDEALEAAERVK 184

Query: 174 YPVIIKAAYXXXXXXXXXXXXXXXXADAFQRAKSEAITAFGNGTCFVERFLDKPKHIEVQ 233
           YPVI+++AY                 +   ++ S A          VE+ L   K +E +
Sbjct: 185 YPVIVRSAYALGGLGSGFANNASEMKELAAQSLSLA------PQILVEKSLKGWKEVEYE 238

Query: 234 LLADNHGNVVHLFERDCSVQRRHQKVVEV------APAKTLPREVRDSILTDAVRLAKEA 287
           ++ D  GN + +    C+++      V        AP++TL  E    + + A+++ +  
Sbjct: 239 VVRDRVGNCITV----CNMENFDPLGVHTGDSMVFAPSQTLSDEEFHMLRSAAIKIIRHL 294

Query: 288 GYRNAGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEITGIDLVSAQIQIAAGASLPQL 345
           G       ++ +      Y  IE+N R+     +  + TG  L     +I  G +LP+L
Sbjct: 295 GVIGECNVQYALQPDGLDYRVIEVNARLSRSSALASKATGYPLAYTAAKIGLGYTLPEL 353

>CAGL0C04917g 457506..460847 highly similar to sp|P03965
           Saccharomyces cerevisiae YJR109c CPA2, hypothetical
           start
          Length = 1113

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/193 (21%), Positives = 79/193 (40%), Gaps = 17/193 (8%)

Query: 160 ETVEEAQDFVNKYGYPVIIKAAYXXXXXXXXXXXXXXXXADAFQRAKSEAITAFGNGTCF 219
           E +++     +  GYPVII++AY                 +   ++ S A          
Sbjct: 170 ENIDDVLSAASTIGYPVIIRSAYALGGLGSGFANNPEELKELASQSLSLA------PQVL 223

Query: 220 VERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQR------RHQKVVEVAPAKTLPREVR 273
           VE+ L   K +E +++ D   N + +    C+++            +  AP++TL  E  
Sbjct: 224 VEKSLRGWKEVEYEVVRDRENNCITV----CNMENFDPLGVHTGDSIVFAPSQTLSDEEF 279

Query: 274 DSILTDAVRLAKEAGYRNAGTAEF-LVDNQNRHYFIEINPRIQVEHTITEEITGIDLVSA 332
             + + A+++ +  G       ++ L  N   +  IE+N R+     +  + TG  L   
Sbjct: 280 HMLRSAAIKIIRHLGVVGECNVQYALSPNSLDYRVIEVNARLSRSSALASKATGYPLAYT 339

Query: 333 QIQIAAGASLPQL 345
             +IA G +LP+L
Sbjct: 340 AAKIALGYTLPEL 352

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 44/223 (19%), Positives = 83/223 (37%), Gaps = 11/223 (4%)

Query: 120 GITWIGPPPEVIESVGDKVSARNLAAKANVPTVPGTP--GPIETVEEAQDFVNKYGYPVI 177
           G   +G  P+ I++  ++    ++    NV    G P    + +VEEA+ F NK  YPV+
Sbjct: 677 GCKILGTSPKDIDNAENRHKFSSILDSINV----GQPEWKELTSVEEAKTFANKVSYPVL 732

Query: 178 IKAAYXXXXXXXXXXXXXXXXADAFQRAKSEAITAFGNGTCFVERFLDKPKHIEVQLLAD 237
           I+ +Y                 D    A   +     +    + +F+   + I+V  +A 
Sbjct: 733 IRPSYVLSGAAMSVVNNEHELEDKLTLASDVS----PDHPVVMSKFIQGAQEIDVDAVAC 788

Query: 238 NHGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPREVRDSILTDAVRLAKEAGYRNAGTAE 296
           N   +VH           H      + P + L   V+  + T A ++AK          +
Sbjct: 789 NGELLVHAISEHVEDAGVHSGDATLILPPQHLSENVKSQLKTIAKKVAKAWNITGPFNMQ 848

Query: 297 FLVDNQNRHYFIEINPRIQVEHTITEEITGIDLVSAQIQIAAG 339
            +   +N    IE N R         ++ G++ +   ++   G
Sbjct: 849 VIKAGENDLKVIECNIRASRSFPFVSKVLGVNFIEVAVKSYLG 891

>KLLA0E15444g 1370741..1377427 highly similar to sp|P07259
            Saccharomyces cerevisiae YJL130c URA2 multifunctional
            pyrimidine biosynthesis protein, start by similarity
          Length = 2228

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 51/306 (16%), Positives = 117/306 (38%), Gaps = 24/306 (7%)

Query: 37   RSAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGKEGEYTPVGAYLAIDEIIDIAKKHGV 96
            R+  + + +T+ +  + + +ST   +AD  Y              + ++ I+DI +    
Sbjct: 1005 RTLRKNNFKTIMVNYNPETVSTDYDEADRLYF-----------ETINLERIMDIYELESS 1053

Query: 97   DFIHPGYGFLSENAEFADKVQKAGITWIGPPPEVIESVGDKVSARNLAAKANVPTVPGTP 156
              +    G  + N   A  + +  +  +G  PE+I+S  ++     +  + +V      P
Sbjct: 1054 AGVVVSMGGQTSN-NIAMSLHRENVKILGTSPEMIDSAENRYKFSRMLDQIDV----DQP 1108

Query: 157  G--PIETVEEAQDFVNKYGYPVIIKAAYXXXXXXXXXXXXXXXXADAFQRAKSEAITAFG 214
                + +++EA+DF  K  YPV+++ +Y                 D  +   ++A+    
Sbjct: 1109 AWKELTSMDEAEDFAEKVSYPVLVRPSYVLSGAAMNTVYSK----DDLESYLNQAVEVSR 1164

Query: 215  NGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPREVR 273
                 + ++++  K IE+  +A +   ++H+          H      + P + L  E  
Sbjct: 1165 EYPVVITKYIENAKEIEMDAVALDGELIMHVVSEHVENAGVHSGDATLIVPPQDLDPETV 1224

Query: 274  DSILTDAVRLAKEAGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITGIDLVSAQ 333
              I+    ++ +          +F+  N N    IE N R         ++ G++L+   
Sbjct: 1225 RRIVEATAKIGRALQITGPYNIQFIAKN-NEIKVIECNVRASRSFPFISKVVGVNLIEMA 1283

Query: 334  IQIAAG 339
             +   G
Sbjct: 1284 TKAIMG 1289

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 61/301 (20%), Positives = 117/301 (38%), Gaps = 29/301 (9%)

Query: 37  RSAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGKEGEYTPVGAYLAIDEIIDIAKKHGV 96
           ++  E  + T+ I  +   + T +  AD+ Y +    E+        + ++I   +   +
Sbjct: 464 KALKEEGIYTILINPNIATIQTSKGLADKVYFLPVTAEF--------VRKVILHERPDAI 515

Query: 97  DFIHPGYGFLSENAEFADKVQKAGITWIGPPPEVIESVGDKVSARNLAAKANVPTVPGTP 156
                G   LS   E  D+ +  G+  +G P + + +  D+    N   + N        
Sbjct: 516 YVTFGGQTALSVGIEMKDEFETLGVKVLGTPIDTVITTEDRELFANAMDEINEKCAKSAA 575

Query: 157 GPIETVEEAQDFVNKYGYPVIIKAAYXXXXXXXXXXXXXXXXADAFQRAKSEAITAFGNG 216
               TV EA + V   G+PVI++AAY                 D           AF + 
Sbjct: 576 --AATVAEALEAVKDIGFPVIVRAAYALGGLGSGFASNEKELVDLCN-------VAFASS 626

Query: 217 -TCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQR------RHQKVVEVAPAKTLP 269
               VER +   K IE +++ D   N + +    C+++            + +AP++TL 
Sbjct: 627 PQVLVERSMKGWKEIEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVIAPSQTLS 682

Query: 270 REVRDSILTDAVRLAKEAGYRNAGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEITGID 328
            E  + + T AV + +  G       ++ ++  ++ Y  IE+N R+     +  + TG  
Sbjct: 683 DEDYNMLRTTAVNVIRHLGVVGECNIQYALNPTSKEYCIIEVNARLSRSSALASKATGYP 742

Query: 329 L 329
           L
Sbjct: 743 L 743

>Kwal_27.12090
          Length = 394

 Score = 37.7 bits (86), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 717 LDVTEKIVAMGTHILGIKDMAGTMKPAAAKLLIGAIRAKFPDLPIHVHSHDSAGTAVASM 776
           L++ + + A+G + +GI D  G   P     L+  ++       I  H HD  G A+ + 
Sbjct: 165 LNIYKTVSAIGVNRVGIADTVGCANPRQVYDLVRTLKGVVT-CDIECHFHDDTGCAIGNA 223

Query: 777 AACALAGADVVDVAI 791
            +   AGA ++DV++
Sbjct: 224 YSALEAGAKLIDVSV 238

>KLLA0E23782g complement(2105401..2106582) highly similar to
           sp|Q12122 Saccharomyces cerevisiae YDL131w LYS21
           homocitrate synthase, start by similarity
          Length = 393

 Score = 37.4 bits (85), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 46/98 (46%), Gaps = 10/98 (10%)

Query: 717 LDVTEKIVAMGTHILGIKDMAGTMKPAAAKLLIGAIRAKFPDLPIHVHSHDSAGTAVASM 776
           L++ + +  +G + +GI D  G   P     L+  +++      I  H HD  G A+ + 
Sbjct: 165 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHDDTGCAIGNS 223

Query: 777 AACALAGADVVDVA---------INSMSGLTSQASVNA 805
            +   AGA ++DV+         I S+ GL ++  V+A
Sbjct: 224 YSALEAGARLIDVSVLGIGERNGITSLGGLMARMIVSA 261

>Scas_701.35
          Length = 430

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 717 LDVTEKIVAMGTHILGIKDMAGTMKPAAAKLLIGAIRAKFPDLPIHVHSHDSAGTAVASM 776
           L++ + + ++G + +GI D  G   P     L+  +R+      I  H H+  G A+A+ 
Sbjct: 170 LNIYKTVNSIGVNRVGIADTVGCANPRQVYELVRTLRS-VVSCDIECHFHNDTGCAIANA 228

Query: 777 AACALAGADVVDVAI 791
                 GA ++DV++
Sbjct: 229 YTALEGGARLIDVSV 243

>Kwal_56.24401
          Length = 441

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query: 717 LDVTEKIVAMGTHILGIKDMAGTMKPAAAKLLIGAIRAKFPDLPIHVHSHDSAGTAVASM 776
           L++ + + A+G + +GI D  G   P     L+  ++       +  H H+  G A+A+ 
Sbjct: 179 LNIYKTVDAIGVNRVGIADTVGCANPRQVYELMRTLKT-VVSCDVECHFHNDTGCAIANA 237

Query: 777 AACALAGADVVDVAI 791
                 GA ++DVA+
Sbjct: 238 YTALEGGAKLIDVAV 252

>Kwal_47.19231
          Length = 795

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 2/68 (2%)

Query: 113 ADKVQKAGITWIGPPPEVIESVGDKVSARNLAAKANVPTVPGTPGPIETVEEAQDFVNKY 172
           AD   KAGI   GP  +     G K  +++  AK N+PT        +  E+A++++ K 
Sbjct: 87  ADVFTKAGIPVFGPSAKAAIFEGSKTFSKDFMAKHNIPTA--RYANFDDYEKAKEYLEKV 144

Query: 173 GYPVIIKA 180
            Y V++KA
Sbjct: 145 DYQVVLKA 152

>KLLA0F05489g 541146..542471 highly similar to sp|Q12122
           Saccharomyces cerevisiae YDL131w LYS21 homocitrate
           synthase, start by similarity
          Length = 441

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query: 717 LDVTEKIVAMGTHILGIKDMAGTMKPAAAKLLIGAIRAKFPDLPIHVHSHDSAGTAVASM 776
           L++ + +  +G + +GI D  G   P     L+  +++      I  H H+  G A+A+ 
Sbjct: 182 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHNDTGCAIANA 240

Query: 777 AACALAGADVVDVAI 791
                 GA ++DVA+
Sbjct: 241 YTALEGGARLIDVAV 255

>Sklu_2431.2 YDL131W, Contig c2431 3030-4214
          Length = 394

 Score = 34.3 bits (77), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 45/98 (45%), Gaps = 10/98 (10%)

Query: 717 LDVTEKIVAMGTHILGIKDMAGTMKPAAAKLLIGAIRAKFPDLPIHVHSHDSAGTAVASM 776
           L++ + +  +G   +GI D  G   P     L+  +++      I  H H+  G A+ + 
Sbjct: 165 LNIYKTVDKIGVDRVGIADTVGCANPRQVYELVRTLKSVIH-CDIECHFHNDTGCAIGNS 223

Query: 777 AACALAGADVVDVA---------INSMSGLTSQASVNA 805
            +   AGA ++DV+         I S+ GL ++  V+A
Sbjct: 224 YSALEAGARLIDVSVLGIGERNGITSLGGLMARMIVSA 261

>YDL131W (LYS21) [738] chr4 (227393..228715) Homocitrate synthase
           isoenzyme, involved in lysine metabolism [1323 bp, 440
           aa]
          Length = 440

 Score = 34.7 bits (78), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query: 717 LDVTEKIVAMGTHILGIKDMAGTMKPAAAKLLIGAIRAKFPDLPIHVHSHDSAGTAVASM 776
           L++ + +  +G + +GI D  G   P     LI  +++      I  H H+  G A+A+ 
Sbjct: 180 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRTLKS-VVSCDIECHFHNDTGCAIANA 238

Query: 777 AACALAGADVVDVAI 791
                 GA ++DV++
Sbjct: 239 YTALEGGARLIDVSV 253

>CAGL0J09240g 911669..912982 highly similar to sp|Q12122
           Saccharomyces cerevisiae YDL131w LYS21 or sp|P48570
           Saccharomyces cerevisiae YDL182w LYS20, start by
           similarity
          Length = 437

 Score = 34.3 bits (77), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query: 717 LDVTEKIVAMGTHILGIKDMAGTMKPAAAKLLIGAIRAKFPDLPIHVHSHDSAGTAVASM 776
           L++ + +  +G + +GI D  G   P     L+  +++      I  H H+  G A+A+ 
Sbjct: 177 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHNDTGCAIANA 235

Query: 777 AACALAGADVVDVAI 791
                 GA ++DV++
Sbjct: 236 YTALEGGAKLIDVSV 250

>Scas_704.3
          Length = 438

 Score = 34.3 bits (77), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query: 717 LDVTEKIVAMGTHILGIKDMAGTMKPAAAKLLIGAIRAKFPDLPIHVHSHDSAGTAVASM 776
           L++ + +  +G + +GI D  G   P     L+  +++      I  H H+  G A+A+ 
Sbjct: 179 LNIYKTVNKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHNDTGCAIANA 237

Query: 777 AACALAGADVVDVAI 791
                 GA ++DV++
Sbjct: 238 YTALEGGARLIDVSV 252

>CAGL0J06402g complement(608851..610146) highly similar to sp|Q12122
           Saccharomyces cerevisiae YDL131w LYS21 or sp|P48570
           Saccharomyces cerevisiae YDL182w LYS20, hypothetical
           start
          Length = 431

 Score = 34.3 bits (77), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query: 717 LDVTEKIVAMGTHILGIKDMAGTMKPAAAKLLIGAIRAKFPDLPIHVHSHDSAGTAVASM 776
           L++ + +  +G + +GI D  G   P     L+  +++      I  H H+  G A+A+ 
Sbjct: 165 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHNDTGCAIANA 223

Query: 777 AACALAGADVVDVAI 791
                 GA ++DV++
Sbjct: 224 YTALEGGAKLIDVSV 238

>ADR107W [1848] [Homologous to ScYDL131W (LYS21) - SH; ScYDL182W
           (LYS20) - SH] complement(897769..897784,897846..899158)
           [1329 bp, 442 aa]
          Length = 442

 Score = 33.9 bits (76), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query: 717 LDVTEKIVAMGTHILGIKDMAGTMKPAAAKLLIGAIRAKFPDLPIHVHSHDSAGTAVASM 776
           L++ + +  +G + +GI D  G   P     L+  +++      +  H H+  G A+A+ 
Sbjct: 182 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDVECHFHNDTGCAIANA 240

Query: 777 AACALAGADVVDVAI 791
                 GA +VDV++
Sbjct: 241 YTALDGGAKLVDVSV 255

>YDL182W (LYS20) [690] chr4 (133438..134724) Homocitrate synthase
           isoenzyme, involved in lysine biosynthesis [1287 bp, 428
           aa]
          Length = 428

 Score = 33.9 bits (76), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query: 717 LDVTEKIVAMGTHILGIKDMAGTMKPAAAKLLIGAIRAKFPDLPIHVHSHDSAGTAVASM 776
           L++ + +  +G + +GI D  G   P     LI  +++      I  H H+  G A+A+ 
Sbjct: 166 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRTLKS-VVSCDIECHFHNDTGCAIANA 224

Query: 777 AACALAGADVVDVAI 791
                 GA ++DV++
Sbjct: 225 YTALEGGARLIDVSV 239

>AGR127C [4438] [Homologous to ScYDR062W (LCB2) - SH]
           (992732..994420) [1689 bp, 562 aa]
          Length = 562

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 1/58 (1%)

Query: 699 CYSGDMLQPGKKYNLDYYLDVTEKIVAMGTHILGIKDMAGTMKPAAAKLLIGAIRAKF 756
           C    +++  KKY    Y+D    I AMG H  G+ D  G + P    +L+G +   F
Sbjct: 311 CNLPKLIELKKKYKCYLYVDEAHSIGAMGPHGRGVCDYFG-VDPTEVDILMGTLTKSF 367

>YLR432W (IMD3) [3807] chr12 (1002553..1004124) Protein highly
           similar to Imd2p and inosine-5'-monophosphate
           dehydrogenase of human and E. coli [1572 bp, 523 aa]
          Length = 523

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 57/131 (43%), Gaps = 12/131 (9%)

Query: 364 TTEDPAKNFQPDTGRLEVYRSAGGNGVRLDGGTAYAGAVISPHY---DSMLVKCSCSGST 420
           TTE P + F  D  RL+ YR  G        GT    A  S ++   DS+LV    SG+ 
Sbjct: 397 TTESPGEYFYQDGKRLKAYRGMGSIDAMQKTGTK-GNASTSRYFSESDSVLVAQGVSGA- 454

Query: 421 YEIVRRKMLRALIEFRIRGVKTNIPFL----LTLLTHPVFISGDYWTTFIDDTPQLFHMV 476
             +V +  ++  I +   G++ +   +    LTLL   V  SG     F   + QL   V
Sbjct: 455 --VVDKGSIKKFIPYLYNGLQHSCQDIGYKSLTLLKENV-QSGKVRFEFRTASAQLEGGV 511

Query: 477 SSRNRAQKLLH 487
            + +  +K LH
Sbjct: 512 HNLHSYEKRLH 522

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.137    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 34,366,348
Number of extensions: 1410005
Number of successful extensions: 3707
Number of sequences better than 10.0: 59
Number of HSP's gapped: 3670
Number of HSP's successfully gapped: 89
Length of query: 1157
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1044
Effective length of database: 12,684,275
Effective search space: 13242383100
Effective search space used: 13242383100
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)