Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0K06765g1811618411e-117
YBR217W (ATG12)1861473801e-46
Scas_686.181801523749e-46
Sklu_752.22001673454e-41
Kwal_14.18111961663115e-36
KLLA0C05720g1891593063e-35
AAR160W1891612951e-33
CAGL0L05654g135264670.81
CAGL0J08030g221758614.7
KLLA0F13552g1267138605.7
KLLA0D19877g99059605.7
Scas_606.249552606.4
CAGL0L05434g34666589.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0K06765g
         (179 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0K06765g 658479..659024 similar to sp|P38316 Saccharomyces c...   328   e-117
YBR217W (ATG12) [398] chr2 (657789..658349) Protein conjugated t...   150   1e-46
Scas_686.18                                                           148   9e-46
Sklu_752.2 YBR217W, Contig c752 791-1393                              137   4e-41
Kwal_14.1811                                                          124   5e-36
KLLA0C05720g 510735..511304 similar to sp|P38316 Saccharomyces c...   122   3e-35
AAR160W [348] [Homologous to ScYBR217W (APG12) - SH] complement(...   118   1e-33
CAGL0L05654g 613768..617826 some similarities with sp|P12685 Sac...    30   0.81 
CAGL0J08030g complement(782940..789593) highly similar to sp|P21...    28   4.7  
KLLA0F13552g complement(1252906..1256709) gi|33386566|emb|CAD877...    28   5.7  
KLLA0D19877g complement(1680043..1683015) similar to sp|P35688 S...    28   5.7  
Scas_606.2                                                             28   6.4  
CAGL0L05434g 597033..598073 similar to sp|P36135 Saccharomyces c...    27   9.5  

>CAGL0K06765g 658479..659024 similar to sp|P38316 Saccharomyces
           cerevisiae YBR217w APG12 Autophagy protein, start by
           similarity
          Length = 181

 Score =  328 bits (841), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%)

Query: 19  VSSGSIALSKHEEQKRELGVENRLEQYSRRLSQLALVDTNESSDSSEKEEVFVQGSLRSQ 78
           VSSGSIALSKHEEQKRELGVENRLEQYSRRLSQLALVDTNESSDSSEKEEVFVQGSLRSQ
Sbjct: 19  VSSGSIALSKHEEQKRELGVENRLEQYSRRLSQLALVDTNESSDSSEKEEVFVQGSLRSQ 78

Query: 79  QSLKASIQSSSHGHTGAPQKVMIKFQSIGSITSITPSVCQISTNKPFSVIISFLQRKLKM 138
           QSLKASIQSSSHGHTGAPQKVMIKFQSIGSITSITPSVCQISTNKPFSVIISFLQRKLKM
Sbjct: 79  QSLKASIQSSSHGHTGAPQKVMIKFQSIGSITSITPSVCQISTNKPFSVIISFLQRKLKM 138

Query: 139 ENIHCYINNSFAPVPSQNVGDLWNQFKVNDELIVSYCGSVA 179
           ENIHCYINNSFAPVPSQNVGDLWNQFKVNDELIVSYCGSVA
Sbjct: 139 ENIHCYINNSFAPVPSQNVGDLWNQFKVNDELIVSYCGSVA 179

>YBR217W (ATG12) [398] chr2 (657789..658349) Protein conjugated to
           Apg5p, involved in autophagy and cytoplasm-to-vacuole
           protein targeting pathway [561 bp, 186 aa]
          Length = 186

 Score =  150 bits (380), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 105/147 (71%), Gaps = 10/147 (6%)

Query: 38  VENRLEQYSRRLSQLALVDTNESSDSSEKEEV--FVQGSLRSQQSLKASIQSS---SHGH 92
           V+NRLE +SRRLSQL L     +SD S  ++V     G+   ++++K + Q+S   SH  
Sbjct: 43  VQNRLELFSRRLSQLGL-----ASDISVDQQVEDSSSGTYEQEETIKTNAQTSKQKSHKD 97

Query: 93  TGAPQKVMIKFQSIGSITSITPSVCQISTNKPFSVIISFLQRKLKMENIHCYINNSFAPV 152
               QK+ IKFQ IGSI  + PSVC+IS ++ F+++I FL+R+LKM++++CYINNSFAP 
Sbjct: 98  EKNIQKIQIKFQPIGSIGQLKPSVCKISMSQSFAMVILFLKRRLKMDHVYCYINNSFAPS 157

Query: 153 PSQNVGDLWNQFKVNDELIVSYCGSVA 179
           P QN+G+LW QFK NDELIVSYC SVA
Sbjct: 158 PQQNIGELWMQFKTNDELIVSYCASVA 184

>Scas_686.18
          Length = 180

 Score =  148 bits (374), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 77/152 (50%), Positives = 96/152 (63%), Gaps = 25/152 (16%)

Query: 36  LGVENRLEQYSRRLSQLALVDT--------NESSDSSEKEEVFVQGSLRSQQSLKASIQS 87
           L + NRLE YSRRLSQL L +T        N S   +EKE++                  
Sbjct: 44  LALRNRLELYSRRLSQLGLEETPQIPLETDNTSLSQAEKEKI-----------------K 86

Query: 88  SSHGHTGAPQKVMIKFQSIGSITSITPSVCQISTNKPFSVIISFLQRKLKMENIHCYINN 147
           +  G      KV IKFQ IGS+  I P VC+IS  + FS IISFL+++L+MEN++CY+N+
Sbjct: 87  NEEGPDVNSFKVKIKFQPIGSVPQIKPPVCKISATQSFSSIISFLRKRLRMENVYCYVNS 146

Query: 148 SFAPVPSQNVGDLWNQFKVNDELIVSYCGSVA 179
           SFAP P QNVGDLW QFKVNDELI+SYCG+VA
Sbjct: 147 SFAPTPQQNVGDLWTQFKVNDELIISYCGAVA 178

>Sklu_752.2 YBR217W, Contig c752 791-1393
          Length = 200

 Score =  137 bits (345), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 101/167 (60%), Gaps = 28/167 (16%)

Query: 38  VENRLEQYSRRLSQLALVDTNESSD------------------SSEKEEVFVQGSL---- 75
           V+++LE YS+RLSQL +   +E  D                     ++E+ +  SL    
Sbjct: 35  VQSKLELYSKRLSQLRMQSDDEEEDELSRPSQSDRSQGTIEDGPVPRQEIPLTTSLILNN 94

Query: 76  ---RSQQSLKASIQSSSHGHTGAPQKVMIKFQSIGSITSITPSVCQISTNKPFSVIISFL 132
              R+ + +K   Q      +  P+K+ IKFQ IGSI  I+P VC+IS  + FS++I+FL
Sbjct: 95  LPPRTDEVIKEVEQ---QEESQTPEKIQIKFQPIGSIRQISPQVCKISPTQSFSMVITFL 151

Query: 133 QRKLKMENIHCYINNSFAPVPSQNVGDLWNQFKVNDELIVSYCGSVA 179
           +RKLK+  ++CYINNSFAP P QNVGDLW QFK+ +EL+VSYC SVA
Sbjct: 152 RRKLKVSEVYCYINNSFAPTPQQNVGDLWTQFKIQEELVVSYCSSVA 198

>Kwal_14.1811
          Length = 196

 Score =  124 bits (311), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 99/166 (59%), Gaps = 25/166 (15%)

Query: 38  VENRLEQYSRRLSQLALVDTNESSDSSEKEEVFVQGS-------LRSQQSLKASIQSSS- 89
           V + LEQYS RL+ L L D+ E   SS +E   ++ S       + S ++  A + +S+ 
Sbjct: 30  VRDELEQYSTRLNLLGL-DSGEQITSSTQELRNLESSDDNDSSTVESNRAHTAPVSTSAI 88

Query: 90  HGHTGA----------------PQKVMIKFQSIGSITSITPSVCQISTNKPFSVIISFLQ 133
            GH                   P K+ I+F+ IGS+  + P + +IS ++PFSV+++FL 
Sbjct: 89  LGHLSVAGDQALKKMAEREQELPTKIPIRFKPIGSVPQVAPQLARISASQPFSVVVTFLT 148

Query: 134 RKLKMENIHCYINNSFAPVPSQNVGDLWNQFKVNDELIVSYCGSVA 179
           ++LK+ N++CYINNSF+P P Q+VGDLW  F++ DEL+VSYC  VA
Sbjct: 149 KRLKLNNVYCYINNSFSPAPQQSVGDLWGHFRIKDELVVSYCSGVA 194

>KLLA0C05720g 510735..511304 similar to sp|P38316 Saccharomyces
           cerevisiae YBR217w APG12 component of the autophagic
           system singleton, start by similarity
          Length = 189

 Score =  122 bits (306), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 71/159 (44%), Positives = 95/159 (59%), Gaps = 19/159 (11%)

Query: 38  VENRLEQYSRRLSQLALVDTNESSDSSEKEEVFVQG--SLRSQQS--------------L 81
           ++ +LE++S +L++L L D N  SD  ++EE       S R + S              L
Sbjct: 31  IKGKLEEFSAKLNELRLADGN--SDGGDEEESLSPDTKSQREESSENSENVSRSTSRPPL 88

Query: 82  KASIQSSSHGHTGAPQ-KVMIKFQSIGSITSITPSVCQISTNKPFSVIISFLQRKLKMEN 140
            +SI SS        Q KV I+ Q IG+I  I P VCQIS ++ F  +  FL ++LK ++
Sbjct: 89  TSSIVSSVEREQLKSQVKVKIRLQPIGAIPQIQPRVCQISAHQQFLALTRFLCKRLKRKH 148

Query: 141 IHCYINNSFAPVPSQNVGDLWNQFKVNDELIVSYCGSVA 179
           IHCYINN+FAP   QN+GDLW QFKVNDELIVSYC +VA
Sbjct: 149 IHCYINNAFAPSLDQNIGDLWTQFKVNDELIVSYCETVA 187

>AAR160W [348] [Homologous to ScYBR217W (APG12) - SH]
           complement(632807..633376) [570 bp, 189 aa]
          Length = 189

 Score =  118 bits (295), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 69/161 (42%), Positives = 99/161 (61%), Gaps = 17/161 (10%)

Query: 32  QKRELGVENRLEQYSRRLSQLALVDTNESSDSS-------------EKEEVFVQGSLRSQ 78
           Q  +  ++NRLE+Y  RLS+L L  +++S  S                  V++ G+ RS 
Sbjct: 31  QHTQESLQNRLEEYHERLSRLQLPSSSDSECSDIEQESLELEQEVPLSTSVYLAGA-RSA 89

Query: 79  QSLKASIQSSSHGHTGAPQKVMIKFQSIGSITSITPSVCQISTNKPFSVIISFLQRKLKM 138
             L +S   S    T  P KV I+FQ IGS+  + P VC+IS+ + F  ++ FL+R+L++
Sbjct: 90  GGLPSS---SELSETPEPPKVAIRFQPIGSVGQVMPQVCRISSAQSFGAVLVFLRRRLRL 146

Query: 139 ENIHCYINNSFAPVPSQNVGDLWNQFKVNDELIVSYCGSVA 179
           + +HCY++NSFAP P QNVG LW QFKVNDEL+VSYC +VA
Sbjct: 147 DTVHCYVSNSFAPTPQQNVGQLWEQFKVNDELVVSYCATVA 187

>CAGL0L05654g 613768..617826 some similarities with sp|P12685
           Saccharomyces cerevisiae YJL129c TRK1 or sp|P28584
           Saccharomyces cerevisiae YKR050w TRK2, hypothetical
           start
          Length = 1352

 Score = 30.4 bits (67), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 33/64 (51%), Gaps = 11/64 (17%)

Query: 42  LEQYSRRLSQ-----------LALVDTNESSDSSEKEEVFVQGSLRSQQSLKASIQSSSH 90
           +E++ RR S+           + L D + + D +E+    V GS + +Q++K ++QS S 
Sbjct: 282 VERFKRRRSRDISPQDMYRSIMMLQDKHSNIDDNEEGPALVIGSPQDRQNIKPTVQSQSM 341

Query: 91  GHTG 94
           GH  
Sbjct: 342 GHNA 345

>CAGL0J08030g complement(782940..789593) highly similar to sp|P21951
            Saccharomyces cerevisiae YNL262w POL2 DNA-directed DNA
            polymerase epsilon, catalytic subunit A, hypothetical
            start
          Length = 2217

 Score = 28.1 bits (61), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 3/58 (5%)

Query: 116  VCQISTNKPFSVIISFLQRKLKMENIHCYINNSFAPVPSQNVGDLWNQFKVNDELIVS 173
            +C I+  K   VI     R+LK++NI  + N   +P+P    G + N F  N   I++
Sbjct: 1657 ICNINLEKMDFVIDVIYARRLKLDNIILWWNEQ-SPLPDH--GGMENDFDQNTSWIMN 1711

>KLLA0F13552g complement(1252906..1256709) gi|33386566|emb|CAD87727.1
            Kluyveromyces lactis protein kinase, start by similarity
          Length = 1267

 Score = 27.7 bits (60), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 60/138 (43%), Gaps = 27/138 (19%)

Query: 30   EEQKRELGVENRLEQYSRRLSQLALVDTNESSDSSEKEEVFVQ-GSLRSQQSLKASIQSS 88
            EEQK + G  N  +  +RR++ L          SSE E+VF    + R Q +L A+  S+
Sbjct: 1053 EEQKNDDG--NHGQGQTRRVTLLF------DDGSSESEQVFKPVAAERRQPTLNAN--ST 1102

Query: 89   SHGHTGAPQK-------VMIKFQSIGSITSITPS---------VCQISTNKPFSVIISFL 132
            +  + G+ +K         IK   +  ITS+  S         + +I T+KP   +  + 
Sbjct: 1103 TTNNVGSKRKSNYINKLPKIKEDEVKPITSMKSSSPVNWFSKLLQRIKTSKPKRTVYEYR 1162

Query: 133  QRKLKMENIHCYINNSFA 150
               +  +NIH  +   F 
Sbjct: 1163 TSSIPFDNIHILLMTQFG 1180

>KLLA0D19877g complement(1680043..1683015) similar to sp|P35688
           Saccharomyces cerevisiae YDL240w LRG1 GTPase-activating
           protein of the rho/rac family singleton, hypothetical
           start
          Length = 990

 Score = 27.7 bits (60), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 26/59 (44%)

Query: 75  LRSQQSLKASIQSSSHGHTGAPQKVMIKFQSIGSITSITPSVCQISTNKPFSVIISFLQ 133
           LRS Q LK  I+  +        K+MI  Q +  ITS + S   +  N   SVI    Q
Sbjct: 322 LRSDQKLKTFIKMQTKIPNKLSTKIMIYLQLLRKITSSSNSENDVDVNSFISVITGIAQ 380

>Scas_606.2
          Length = 495

 Score = 27.7 bits (60), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 25/52 (48%)

Query: 70  FVQGSLRSQQSLKASIQSSSHGHTGAPQKVMIKFQSIGSITSITPSVCQIST 121
           F   S+ SQ S+  SI + S G T A       +  +GSI     +VC +S+
Sbjct: 391 FDVTSMDSQDSVNKSINNDSGGDTAATSIERNDYVDVGSILQRWGNVCNVSS 442

>CAGL0L05434g 597033..598073 similar to sp|P36135 Saccharomyces
           cerevisiae YKR042w UTH1 or sp|P46955 Saccharomyces
           cerevisiae YJL116c NCA3, hypothetical start
          Length = 346

 Score = 26.9 bits (58), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 33/66 (50%), Gaps = 2/66 (3%)

Query: 85  IQSSSHGHTGAPQKVMIKFQSIGSITSITPSVCQISTNKPFSVI--ISFLQRKLKMENIH 142
           IQS++  +T      + +    GS   + P+V    +++P SVI   S+ Q + K  +  
Sbjct: 187 IQSANAKNTLGKSVALCRTDYPGSENMVVPTVVDAGSSQPMSVIDSDSYYQWQGKKTSAQ 246

Query: 143 CYINNS 148
            Y+NN+
Sbjct: 247 YYVNNA 252

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.126    0.343 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,940,932
Number of extensions: 189642
Number of successful extensions: 721
Number of sequences better than 10.0: 40
Number of HSP's gapped: 714
Number of HSP's successfully gapped: 40
Length of query: 179
Length of database: 16,596,109
Length adjustment: 95
Effective length of query: 84
Effective length of database: 13,307,399
Effective search space: 1117821516
Effective search space used: 1117821516
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 58 (26.9 bits)