Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0K06743g65564530500.0
YBR216C (YBP1)6746649701e-122
Scas_686.196636338971e-111
Scas_563.106666248012e-97
Kwal_14.18126846427377e-88
KLLA0C05698g7026687116e-84
YGL060W (YBP2)6416216587e-77
AAR159C6136374013e-41
CAGL0F06985g6306082496e-22
KLLA0F19888g491556684.3
Kwal_33.1331748649658.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0K06743g
         (645 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0K06743g complement(656238..658205) similar to sp|P38315 Sac...  1179   0.0  
YBR216C (YBP1) [397] chr2 complement(655533..657557) Protein wit...   378   e-122
Scas_686.19                                                           350   e-111
Scas_563.10                                                           313   2e-97
Kwal_14.1812                                                          288   7e-88
KLLA0C05698g complement(508204..510312) weakly similar to sp|P38...   278   6e-84
YGL060W (YBP2) [1919] chr7 (390068..391993) Protein involved in ...   258   7e-77
AAR159C [347] [Homologous to ScYBR216C - SH; ScYGL060W - SH] (63...   159   3e-41
CAGL0F06985g 684832..686724 similar to sp|P53169 Saccharomyces c...   100   6e-22
KLLA0F19888g complement(1839682..1854429) similar to sp|Q12019 S...    31   4.3  
Kwal_33.13317                                                          30   8.5  

>CAGL0K06743g complement(656238..658205) similar to sp|P38315
           Saccharomyces cerevisiae YBR216c, hypothetical start
          Length = 655

 Score = 1179 bits (3050), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 585/645 (90%), Positives = 585/645 (90%)

Query: 1   MSDAFEEVCDALKASFTDDKEDSLTLVTMIDTLSEEVDEGFEVKXXXXXXXXXXXXXXXX 60
           MSDAFEEVCDALKASFTDDKEDSLTLVTMIDTLSEEVDEGFEVK                
Sbjct: 1   MSDAFEEVCDALKASFTDDKEDSLTLVTMIDTLSEEVDEGFEVKEKEQFLELLLNLLEAD 60

Query: 61  XXXVSAVGWDLPRTLLRFCNAKNIKNSDRLRKCKVVTICMAIFNLLALHAKPQECLVTTL 120
              VSAVGWDLPRTLLRFCNAKNIKNSDRLRKCKVVTICMAIFNLLALHAKPQECLVTTL
Sbjct: 61  TELVSAVGWDLPRTLLRFCNAKNIKNSDRLRKCKVVTICMAIFNLLALHAKPQECLVTTL 120

Query: 121 ELLSELNFKNIVEECHQLSEDGSDNNTAEEDNDAVEDYMKDRDQPEIIFGVKSYALFELA 180
           ELLSELNFKNIVEECHQLSEDGSDNNTAEEDNDAVEDYMKDRDQPEIIFGVKSYALFELA
Sbjct: 121 ELLSELNFKNIVEECHQLSEDGSDNNTAEEDNDAVEDYMKDRDQPEIIFGVKSYALFELA 180

Query: 181 GSLIRRVATLHPSKYLEEAVTAIRKYVTNNTEVVEDVKFILRRVFAFCRGYIPPEPPRQL 240
           GSLIRRVATLHPSKYLEEAVTAIRKYVTNNTEVVEDVKFILRRVFAFCRGYIPPEPPRQL
Sbjct: 181 GSLIRRVATLHPSKYLEEAVTAIRKYVTNNTEVVEDVKFILRRVFAFCRGYIPPEPPRQL 240

Query: 241 IVDLKMNHEEYDEIMNSEIELQVRLLRNLCTFSVAYCVKFLNDKTEVVYFHKLINKDLQL 300
           IVDLKMNHEEYDEIMNSEIELQVRLLRNLCTFSVAYCVKFLNDKTEVVYFHKLINKDLQL
Sbjct: 241 IVDLKMNHEEYDEIMNSEIELQVRLLRNLCTFSVAYCVKFLNDKTEVVYFHKLINKDLQL 300

Query: 301 PEFYRSVHDIISRYYQIAFSFDIDLNDEFNDILRETRGIYEDVIKRINETNNTDKNAKSD 360
           PEFYRSVHDIISRYYQIAFSFDIDLNDEFNDILRETRGIYEDVIKRINETNNTDKNAKSD
Sbjct: 301 PEFYRSVHDIISRYYQIAFSFDIDLNDEFNDILRETRGIYEDVIKRINETNNTDKNAKSD 360

Query: 361 ILLKAGYYYEVQKTAREKEINPDTKGIILLSGFNYIENGDHXXXXXXXXXXXXXXRFASE 420
           ILLKAGYYYEVQKTAREKEINPDTKGIILLSGFNYIENGDH              RFASE
Sbjct: 361 ILLKAGYYYEVQKTAREKEINPDTKGIILLSGFNYIENGDHLIDIDIADALYLYLRFASE 420

Query: 421 SLFSPTCHNVTIEGVARYWIWAALTTTDNNILKEKLAEXXXXXXXXXXXXXXXKNCHQVN 480
           SLFSPTCHNVTIEGVARYWIWAALTTTDNNILKEKLAE               KNCHQVN
Sbjct: 421 SLFSPTCHNVTIEGVARYWIWAALTTTDNNILKEKLAELSPLVLHSVLNLLLVKNCHQVN 480

Query: 481 EEIRMITFTLITRILCLLPENCSYEFLMDELDNCAVVFGKSCVLGILRDLVIKVDHSVSS 540
           EEIRMITFTLITRILCLLPENCSYEFLMDELDNCAVVFGKSCVLGILRDLVIKVDHSVSS
Sbjct: 481 EEIRMITFTLITRILCLLPENCSYEFLMDELDNCAVVFGKSCVLGILRDLVIKVDHSVSS 540

Query: 541 NNTDTEDLSESMAQLKINNEKRAKKTFITLDPKRAGEIEDLAIXXXXXXXXXXXXDYILL 600
           NNTDTEDLSESMAQLKINNEKRAKKTFITLDPKRAGEIEDLAI            DYILL
Sbjct: 541 NNTDTEDLSESMAQLKINNEKRAKKTFITLDPKRAGEIEDLAIKTLKETKKSMKKDYILL 600

Query: 601 VLNYIKFFSTFAHKWNKSKLNEFTTLVATNFSDSKMLPEINAIID 645
           VLNYIKFFSTFAHKWNKSKLNEFTTLVATNFSDSKMLPEINAIID
Sbjct: 601 VLNYIKFFSTFAHKWNKSKLNEFTTLVATNFSDSKMLPEINAIID 645

>YBR216C (YBP1) [397] chr2 complement(655533..657557) Protein with
           moderate similarity to S. cerevisiae Ygl060p, which is
           involved in stress resistance [2025 bp, 674 aa]
          Length = 674

 Score =  378 bits (970), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 218/664 (32%), Positives = 349/664 (52%), Gaps = 25/664 (3%)

Query: 1   MSDAFEEVCDALKASFTDDKEDSLTLVTMIDTLSEEVDEGFEVKXXXXXXXXXXXXXXXX 60
           + D   EV DA K      KED L LVT+ID   E+V++    +                
Sbjct: 4   IDDILFEVTDAFKTQ----KEDLLELVTLIDIYGEQVNQEGSYEEKTRFIETLNTLLEDN 59

Query: 61  XXXVSAVGWDLPRTLLRFCNAKNIKNSDRLRKCKVVTICMAIFNLLALHAKPQECLVTTL 120
                 +GWDLP+ LL+F +  N+  + RL    +V   M  F  +++  +P++CL+T L
Sbjct: 60  PSTTGEIGWDLPKGLLKFLSKDNVDVNGRLGTNMIVQGVMKCFYAISIQGEPKKCLITGL 119

Query: 121 ELLSELNFKNIVEECHQLSEDGSDN--NTAEEDNDAVEDYMKDRDQP---------EIIF 169
           ELLS L  K+  +   Q  ED  D   NT   +   +E+    +D P         E   
Sbjct: 120 ELLSSLCSKDFSKSDQQNKEDFVDKKANTLPPEG-VIENSSNRKDFPSYGESKSSNEFFL 178

Query: 170 GVKSYALFELAGSLIRRVATLHPSKYLEEAVTAIRKYVTNNTEVVEDVKFILRRVFAFCR 229
            +KSY LFE  G+ ++R++TL PSKYL  AV+ I K+V ++ +  ED  F+LRRV+ FCR
Sbjct: 179 KLKSYILFEFIGASLKRISTLFPSKYLGAAVSTIEKFVYSHADTFEDALFLLRRVYTFCR 238

Query: 230 GYIPPEPPRQLIVDLKMNHEEYDEIMNSEIELQVRLLRNLCTFSVAYCVKFLNDKTEVVY 289
            YIPP+PP+ + ++     E +D+++  E ELQVRLLR LCTF ++  +K +    +V Y
Sbjct: 239 NYIPPDPPKDIQLNEDFTREMFDKVVEEESELQVRLLRRLCTFGISTPIKTVTTNADVKY 298

Query: 290 FHKLINKDLQLPEFYRSVHDIISRYYQIAFSFDIDLNDEFNDILRETRGIYEDVIKRINE 349
           +  L  +  +L  +Y    ++  RYYQ+AFS D+D+  EF ++++E R IY+ V + I+ 
Sbjct: 299 YCALNQQKFELSAYYTEYLELFCRYYQMAFSLDVDIEGEFQNVIKECRIIYKSVPQEISA 358

Query: 350 TNNTDKNAKSDILLKAGYYYEVQKTAREKEINPDTKGIILLSGFNYIENGDHXXXXXXXX 409
            N+  K     ++ K  Y +EVQK A+EK +  D  G+IL SG +Y+E   H        
Sbjct: 359 VNDEAKLVLERMVYKLAYTFEVQKAAKEKNVGLDYNGVILFSGIHYLETNQHLVKEMNIT 418

Query: 410 -XXXXXXRFASESLFSPTCHNVTIEGVARYWIWAALTTTDNNILKEKLAEXXXXXXXXXX 468
                  RF + SL+S   +NV +E V+RYW+W A+TT     +K++L            
Sbjct: 419 DAIYLYLRFTTPSLYSKVYYNVAVESVSRYWLWYAITTEPLEDVKKELKNLSVFVTKTLL 478

Query: 469 XXXXXKNCHQVNEEIRMITFTLITRILCLLPENCSYEFLMDELDNCAVVFGKSCVLGILR 528
                KNC QVN+++RMITFTL+TR+LCL+PE  ++EF++D L    +   K+ VL + +
Sbjct: 479 HVLLQKNCIQVNQQLRMITFTLLTRLLCLIPEKVAFEFILDVLKTSPLPLAKTSVLCVFK 538

Query: 529 DLVIKVDHSVSSNNTDTEDLSESMAQLKINNEKRAKKT----FITLDPKRAGEIEDLAIX 584
           DL  +   S   N+++T+ + E +++LK+N+  +A+++    +I LD  +   + D  + 
Sbjct: 539 DLS-RRRISTKDNDSETDLIVEKLSKLKVNDSNKAQQSNIRHYIQLDSSKMKAVHDCCLQ 597

Query: 585 XXXXXXXXXXXDY-ILLVLNYIKFFSTFAHKWNKSKLNEFTTLVATNFS--DSKMLPEIN 641
                         ILL+L Y+  F      W++  L    + + +N    +   LP+  
Sbjct: 598 TIQDSFTADAKKSDILLLLTYLNIFIVLKKTWDEDLLKIVCSKIDSNLKSVEPDKLPKYK 657

Query: 642 AIID 645
            I+D
Sbjct: 658 EIVD 661

>Scas_686.19
          Length = 663

 Score =  350 bits (897), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 201/633 (31%), Positives = 340/633 (53%), Gaps = 16/633 (2%)

Query: 1   MSDAFEEVCDALKASFTDDKEDSLTLVTMIDTLSEEVDEGFEVKXXXXXXXXXXXXXXXX 60
           M++  + + D + A F +  +DS++L  +++   ++++   E+                 
Sbjct: 1   MANVNDIIADLVNA-FDEYSDDSVSLTAILEMYIDQINMDGEIDDKEQFLTALLGLMKDH 59

Query: 61  XXXVSAVGWDLPRTLLRFCNAKNIKNSDRLRKCKVVTICMAIFNLLALHAKPQECLVTTL 120
              V+ + WD P+ +L+F    N+  + RL    ++++ M  FN +A  A+P+ECL+T  
Sbjct: 60  PDVVARISWDFPKEILKFLTTANVDVTKRLGYSVIISLVMKCFNEIAFSAEPKECLLTGC 119

Query: 121 ELLSELNFKNIVEECHQLSEDGSDNNTAEEDNDA---VEDYMKDRDQPEIIFGVKSYALF 177
           ELLS L+ +N  E      E G   N+  + + +   +  Y  +R   +    VK Y LF
Sbjct: 120 ELLSNLSLEN--ENIELEMEQGDHTNSKGQTHYSSAEIGKYHAERTPADFFVSVKMYILF 177

Query: 178 ELAGSLIRRVATLHPSKYLEEAVTAIRKYVTNNTEVVEDVKFILRRVFAFCRGYIPPEPP 237
           EL G+ ++R+ TL+PSKYL  A +A+ +++  N + + DV+ ++RR+F+FCR Y+PP+  
Sbjct: 178 ELIGTTLQRIPTLNPSKYLGLATSAMIRFIKANCDGINDVRIVMRRIFSFCRNYVPPDTS 237

Query: 238 RQLIVDLKMNHEEYDEIMNSEIELQVRLLRNLCTFSVAYCVKFLNDKTEVVYFHKLINKD 297
             +I D  +  E+   I   E+  Q R+LRNLCT  +  C+K +N +T+V YF+ L N +
Sbjct: 238 LCVIKDRSLTKEDLIRIEERELASQRRILRNLCTIGLETCLKAINGRTDVKYFYFLSNTE 297

Query: 298 LQLPEFYRSVHDIISRYYQIAFSFDIDLNDEFNDILRETRGIYEDVIKRINETNNTDKNA 357
             L  FY+ + ++ SR++ +A SFDID+  EF + ++ +  IY+ + K  +  +   K  
Sbjct: 298 FTLAGFYKDISEVNSRFFNLALSFDIDIKKEFLECVKTSHDIYKGLPKDSSIGSEEAKKL 357

Query: 358 KSDILLKAGYYYEVQKTAREKEINPDTKGIILLSGFNYIENGDHXXXXXXXX-XXXXXXR 416
               + K  Y YE+Q+ A+ K +  D  GI++LSG  Y+E   H               R
Sbjct: 358 IQQTVYKLAYSYELQRIAKHKNVQLDPLGIVILSGVYYMETDKHLYPQITVKDAIYLYLR 417

Query: 417 FASESLFSPTCHNVTIEGVARYWIWAALTTTDNNILKEKLAEXXXXXXXXXXXXXXXKNC 476
             + SLFS    N ++E V RYW+W ++T   + +L+++L E               KNC
Sbjct: 418 CTTPSLFSKFYENFSVESVVRYWLWVSITNHSSAVLRKELEELPSYLLTTFLQTFLSKNC 477

Query: 477 HQVNEEIRMITFTLITRILCLLPENCSYEFLMDELDNCAVVFGKSCVLGILRDLVIKVD- 535
            Q NEEIRM++FTL TRILCL+PE  +++F+++ L   +    KS VLGIL+DL+ K   
Sbjct: 478 KQPNEEIRMVSFTLFTRILCLIPEAVTFKFILETLTASSYPHVKSSVLGILKDLMSKRRS 537

Query: 536 -HSVSSNNTDTEDLSESMAQLKINNEKR-----AKKTFITLDPKRAGEIEDLAIXXXXXX 589
              + +N+ D E LS S+A+LKIN++K        + ++ +  +R  EI  LA+      
Sbjct: 538 CQDLCANDND-EALSNSLAKLKINSKKNEGAGVESQVYVEVSEERMNEIHHLALRAINSL 596

Query: 590 XXXXXXDY-ILLVLNYIKFFSTFAHKWNKSKLN 621
                    I+L+LNY++FF+    +W+KS L 
Sbjct: 597 EEEKTTRANIILILNYLEFFNGLHSEWDKSLLQ 629

>Scas_563.10
          Length = 666

 Score =  313 bits (801), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 196/624 (31%), Positives = 322/624 (51%), Gaps = 24/624 (3%)

Query: 6   EEVCDALKASFTDDKEDSLTLVTMIDTLSEEVDEGFEVKXXXXXXXXXXXXXXXXXXXVS 65
           E +   L  +F + KED +TLVT+ID   +E++E   +                    + 
Sbjct: 10  ESIYAKLTRAFEEQKEDPVTLVTIIDMYGQEINEDGSIDEKNKYLEHLCSLLNDNPHILR 69

Query: 66  AVGWDLPRTLLRFCNAKNIKNSDRLRKCKVVTICMAIFNLLALHAKPQECLVTTLELLSE 125
            + WDLP+ LL F + +NI    RL    +V+  M  FN +A++  P+ECL+   ELLSE
Sbjct: 70  EISWDLPKGLLEFLSLENIDVHKRLADSSIVSNVMKCFNEIAINGNPKECLLAACELLSE 129

Query: 126 LNFKNIVEECHQLSEDGSDNNTAEEDNDAVE----DYMKDRDQPEIIFGVKSYALFELAG 181
           L  + ++E   +  E G DN   + D    +    DY+ +RD  E I  +K YA+F+L  
Sbjct: 130 LTVEPVMENETEEEEGGKDNKKTDGDETPTDLNSSDYI-ERDLTEFIPSLKVYAIFQLLN 188

Query: 182 SLIRRVATLHPSKYLEEAVTAIRKYVTNNTEVVEDVKFILRRVFAFCRGYIPPEPPRQLI 241
           S + R+ TL+PSK+L  A++AI K++  N   + DV F+LRR+  FC  Y    P R+LI
Sbjct: 189 STLGRIITLYPSKFLNMAISAIMKFMATNINDIADVTFLLRRIHEFCNNYDVHAPDRKLI 248

Query: 242 VDLKMNHEEYDEIMNSEIELQVRLLRNLCTFSVAYCVKFLNDKTEVVYFHKLINKDLQLP 301
               +N EE  ++ + E +LQ +L++ L   +++ C+K      +V YF  L ++  +  
Sbjct: 249 DGSDLNDEEIKKLTDDEFDLQNKLIKELFCSALSICLKNQPTTFDVKYFESLTHQKFEES 308

Query: 302 EFYRSVHDIISRYYQIAFSFDIDLNDEFNDILRETRGIYEDVIKRINETNNTDKNAKSDI 361
           E Y  +    ++Y  +   + ID+ +EF   L+E+R IYE +   I+E++   K+A + +
Sbjct: 309 EHYAVIR---TQYLGLVNKYKIDIKEEFLQCLQESRQIYESLPSDIDESDEKKKSALNQV 365

Query: 362 LLKAGYYYEVQKTAREKEINPDTKGIILLSGFNYIENGDHXXXXXXXX-XXXXXXRFASE 420
           + +  Y Y++QK + +  +  D   IILLSG  Y E G H               R ++ 
Sbjct: 366 IYQLSYRYQMQKISNQDTLEIDFNSIILLSGSYYAETGLHLLPQISIQDAVYLYLRCSTI 425

Query: 421 SLFSPTCHNVTIEGVARYWIWAALTTTDNNILKEKLAEXXXXXXXXXXXXXXXKNCHQVN 480
           SL+S T  N  ++GV RYW+W A+T +    +++ L +                NC++ +
Sbjct: 426 SLYSDTFSNEAVKGVTRYWLWVAITQSPIKEIEQNLLKIPSHFNTVFLQMLLLNNCNEKD 485

Query: 481 EEIRMITFTLITRILCLLPENCSYEFLMDELDNCAVVFGKSCVLGILRDLVIKVDHSVSS 540
            +IRM TFTL+TRILCL+PE+ S++F++D L  C     KS VL IL+DL++K       
Sbjct: 486 GKIRMATFTLLTRILCLMPEDLSFQFILDTLLTCPYNSAKSSVLAILKDLMLK------- 538

Query: 541 NNTDTEDLSESMAQLKINNEKRAKKT-----FITLDPKRAGEIEDLA---IXXXXXXXXX 592
           +N  ++ L E ++ L I++EK    T     +I ++  R   +  +A   I         
Sbjct: 539 DNQISKPLEEELSTLDISSEKNKGPTLPPRPYILINEDRMASLHSVASMCISNLKLLDNP 598

Query: 593 XXXDYILLVLNYIKFFSTFAHKWN 616
                + L+LNY+ FF +  +KWN
Sbjct: 599 NKRTELSLLLNYMNFFISLRYKWN 622

>Kwal_14.1812
          Length = 684

 Score =  288 bits (737), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 200/642 (31%), Positives = 317/642 (49%), Gaps = 38/642 (5%)

Query: 10  DALKASFTDDKEDSLTLVTMIDTLSEEVD--EGFEVKXXXXXXXXXXXXXXXXXXXVSAV 67
           D L  +F + KED L+L+T+ID  + EV+  EG E K                   +  V
Sbjct: 9   DKLNHAFDECKEDPLSLITIIDLYASEVNKKEGGEEKAQFLEILLKRIQDDHHL--IQQV 66

Query: 68  GWDLPRTLLRFCNAKNIKNSDRLRKCKVVTICMAIFNLLALHAKPQECLVTTLELLSELN 127
           GWDLP+ L+RF N +N+  + RL    VV   +  FN +ALH   +EC +T  ELL EL 
Sbjct: 67  GWDLPKVLIRFINTRNVDLNTRLLYNGVVATSLKCFNEIALHGNAKECFLTGCELLGELE 126

Query: 128 F--KNIVEECHQLSEDGSD---------NNTAEEDNDAVEDYMKD---------RDQPEI 167
                 V+E H+  ED ++          +T EE N    +             RD  E+
Sbjct: 127 LHPSEKVQEEHE--EDATEAVEVEAQAIKSTPEEANGPKMNAQTSSRTVVRPLSRDPEEL 184

Query: 168 IFGVKSYALFELAGSLIRRVATLHPSKYLEEAVTAIRKYVTNNTEVVEDVKFILRRVFAF 227
           +  VK + L EL  S +RR+ T +PS++L  AV++I  +V +N+  ++D  F+LRRV+ F
Sbjct: 185 VLEVKLHMLLELINSTLRRIRTCYPSRFLAMAVSSIFSFVRSNSIDIDDTTFVLRRVYTF 244

Query: 228 CRGYIPPEPPRQLIVDLKMNHEEYDEIMNSEIELQVRLLRNLCTFSVAYCVK--FLNDKT 285
            R +IPP+   +   D  M+ EE  ++ + E  LQ +LLR L TFS+   V+   LN  T
Sbjct: 245 ARNFIPPQSNAEAYKD--MSTEEILKVRDDEEALQRKLLRCLLTFSIGQLVRPRVLNIAT 302

Query: 286 EVVYFHKLINK---DLQLPEFYRSVHDIISRYYQIAFSFDIDLNDEF-NDILRETRGIYE 341
           E  YF +L NK   D +  E   ++  I+SRYYQ+A+SFDID+ +EF    ++++  IY+
Sbjct: 303 E--YFFRLKNKYTTDFEY-EMRVNLKHILSRYYQLAYSFDIDVKEEFLKQCVKDSSAIYQ 359

Query: 342 DVIKRINETNNTDKNAKSDILLKAGYYYEVQKTAREKEINPDTKGIILLSGFNYIENGDH 401
            +       N+  +N  + ++ +  Y Y +Q++  EK ++ D  G+++L+  +Y+E G  
Sbjct: 360 SLPNDSELINDAARNGITQLVYQLSYSYGLQRSINEKNLSLDPAGLLVLATQHYLETGQI 419

Query: 402 XXXXXXXX-XXXXXXRFASESLFSPTCHNVTIEGVARYWIWAALTTTDNNILKEKLAEXX 460
                          RF +  +++P   N        +W+W A+T +     KE L    
Sbjct: 420 LDSTIRADCAIYMYLRFVTPEMYNPAMKNTYACDCCNFWLWVAVTKSSCKDSKEALQNIP 479

Query: 461 XXXXXXXXXXXXXKNCHQVNEEIRMITFTLITRILCLLPENCSYEFLMDELDNCAVVFGK 520
                        K+ ++  E  RM++FTL+TR+LCL+PE  ++EF  D L +C  +  K
Sbjct: 480 SYLSLTFLQILLLKSFNETLEHARMVSFTLLTRLLCLMPEETTFEFAKDTLLSCPFIDLK 539

Query: 521 SCVLGILRDLVIKVDHSVSSNNTDTEDLSESMAQLKINNEKRAKKTFITLDPKRAGEIED 580
            C+LGIL+DL++     VS+  T+  +L  S  +   +      + FI ++  R   I  
Sbjct: 540 CCMLGILKDLMLNSKIPVSNLATELSELKLSEDEKSHSKPPLPSRPFIMINEDRMATIHS 599

Query: 581 LAIXXXXXXXXXXXXDYILLVLNYIKFFSTFAHKWNKSKLNE 622
           LA+              + L L YI FF     KW+K  L E
Sbjct: 600 LALLSFEDTIENADKGNLRLSLTYINFFVGLRLKWDKHLLAE 641

>KLLA0C05698g complement(508204..510312) weakly similar to sp|P38315
           Saccharomyces cerevisiae YBR216c, start by similarity
          Length = 702

 Score =  278 bits (711), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 199/668 (29%), Positives = 315/668 (47%), Gaps = 60/668 (8%)

Query: 5   FEEVCDALKASFTDDKEDSLTLVTMIDTLSEEVDEGFEVKXXXXXXXXXXXXXXXXXXXV 64
           F+E+ + L  +F ++K D +TLVT++D  SEEV+    ++                   V
Sbjct: 8   FKEIEEKLLTAFVEEKSDIITLVTILDLYSEEVNFKGSLEQKYEYLSEVLSLLQQNKDVV 67

Query: 65  SAVGWDLPRTLLRFCNAKNIKNSDRLRKCKVVTICMAIFNLLALHAKPQECLVTTLELLS 124
             +GWDLP+ L++F +  N  +    R  K +T+ M  FN +AL   P+EC     EL+S
Sbjct: 68  YEIGWDLPKILIKFIHWGNNNHLGADRSKKFLTVIMKCFNEVALFGNPKECFFAGCELMS 127

Query: 125 ELNFKN------IVEE--------------CHQLSEDGSDNNTAEEDNDAVED------- 157
            L   +      IVEE               +   E  SD    EE+ +AV+D       
Sbjct: 128 SLRINDESLVRFIVEEEPVMDPENEDSGDETYTEDEGSSDKTEEEEEKNAVKDSPTPKSA 187

Query: 158 -----------YMKDRDQPEIIFGVKSYALFELAGSLIRRVATLHPSKYLEEAVTAIRKY 206
                          R   E+I  ++ Y++ EL GS ++R+ TLHPSK+L EAV A  ++
Sbjct: 188 NESIPDLKEGYAFYGRLPQEVITELRFYSIIELMGSTLKRIVTLHPSKFLSEAVEAFSRF 247

Query: 207 VTNNTEVVEDVKFILRRVFAFCRGYIPPEPPRQLIVDLKMNHEEYDEIMNSEIELQVRLL 266
              N E V+D  FILRR+++F RGYIPP PP     D +++ EE +EI  SE  LQ +LL
Sbjct: 248 NLQNNEDVDDCLFILRRLYSFIRGYIPPSPPPD--ADKQVSAEELEEIKVSEEVLQRKLL 305

Query: 267 RNLCT------FSVAYCVKFLNDKTEVVYFHKLINKDLQLPEFYRSVHDIISRYYQIAFS 320
            N+ T           C+  LN  + +     L        E+   + DI+SRYYQ+A S
Sbjct: 306 CNILTSALHQLLKARTCISLLNYHSHLQGIPTLSTSS----EYLGQLTDILSRYYQLATS 361

Query: 321 FDIDLNDEFNDI-LRETRGIYEDVIKRINETNNTDKNAKSDILLKAGYYYEVQKTAREKE 379
           FDID++ EF  + + E+  IY  + K     ++ +    ++ + +  Y YEV+K A  KE
Sbjct: 362 FDIDVSAEFKRLCVDESVRIYRSLPKDSEIKSDEELKEITNFVYQLAYTYEVEKIANVKE 421

Query: 380 INPDTKGIILLSGF---NYIENGDHXXXXXXXXXXXXXXRFASESLFSPTCHNVTIEGVA 436
           I  D  GI++L  F   +++   D               RF + S+FS    N +   +A
Sbjct: 422 ILLDPAGILILRSFSNEDFLPPSD--AKITLQEAIYMYLRFVTPSMFSALFENRSSHDLA 479

Query: 437 RYWIWAALTTTDNNILKEKLAEXXXXXXXXXXXXXXXKNCHQVNEEIRMITFTLITRILC 496
           R WI  ALT    + L + L +               + C Q+N+ +R   F+++TRILC
Sbjct: 480 RTWILFALTNNSTHDLMDSLKDLPSYIITVYLQTELIRACLQINDNLRRTQFSILTRILC 539

Query: 497 LLPENCSYEFLMDELDNCAVVFGKSCVLGILRDLVIKVDHSVSSNNTDTEDLSESMAQLK 556
           LLPE+ ++ F+ D L +C     K C L IL+D+ ++ +  V    +D +DL++ M +LK
Sbjct: 540 LLPEDFAFNFIRDTLLSCPYEQAKCCALAILKDM-MQHERKV-PQKSDEDDLAKDMEKLK 597

Query: 557 INNEKR--AKKTFITLDPKRAGEIEDLAIXXXXXXXXXXXXDYILLVLNYIKFFSTFAHK 614
           I N       + ++ L+  R   +  + +              +  +L Y+ F + F  K
Sbjct: 598 IKNSPPPLPSRAYMLLNDDRIATLHSITLLAIDSCAADPESKKVKTLLTYLNFLNAFLTK 657

Query: 615 WNKSKLNE 622
           W+   L E
Sbjct: 658 WDSVFLKE 665

>YGL060W (YBP2) [1919] chr7 (390068..391993) Protein involved in
           stress resistance [1926 bp, 641 aa]
          Length = 641

 Score =  258 bits (658), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 183/621 (29%), Positives = 291/621 (46%), Gaps = 32/621 (5%)

Query: 34  SEEVDEGFEVKXXXXXXXXXXXXXXXXXXXVSAVGWDLPRTLLRFCNAKNIKNSDRLRKC 93
           +E+V+ G  +K                   +  +GWDLP+ LL+F + KNI  +  L   
Sbjct: 3   NEQVNSGKSIKEKERYLDALLKILKDNPVTLKEIGWDLPKGLLQFFSRKNINVNIHLVFS 62

Query: 94  KVVTICMAIFNLLALHAKPQECLVTTLELLSELNFKNIVEECHQLSEDGSDNNTAEEDND 153
            +V+  M  FN LA++  P+ECL+T  EL+S L+   ++ E     E+  D N +   ND
Sbjct: 63  PLVSSVMECFNELAINGNPKECLLTACELVSTLHI--VLTETGDSDEENEDLNDSNR-ND 119

Query: 154 A-------------VEDYMKDRDQPEIIFGVKSYALFELAGSLIRRVATLHPSKYLEEAV 200
           A             +  YM  ++  E I  +K Y LFE    L++RV TL+PSK+L    
Sbjct: 120 ASNITDELSVITPEIGHYMA-KNTVEFIPNLKIYVLFEFMSLLLKRVDTLYPSKFLAMVT 178

Query: 201 TAIRKYVTNNTEVVEDVKFILRRVFAFCRGYIPPEPPRQLIVDLKMNHEEYDEIMNSEIE 260
           +AI KYVT N + ++D  FILR V+ FC  Y P +P   L   +  N  + ++I + E  
Sbjct: 179 SAIIKYVTTNVQAMDDPHFILRIVYNFCTNYSPAQPSASLTDGISTN--DLEKIHDDESA 236

Query: 261 LQVRLLRNLCTFSVAYCVKFLNDKTEVVYFHKLINKDLQLPEFYRSVHDIISRYYQIAFS 320
           LQ +LL NL  F ++ C+K      + +YF  L++K     E   SV  I  +YY+   S
Sbjct: 237 LQKKLLANLSVFVISNCLKNHPGNIDKIYFKTLMHKKTDENEIDASVLQICHQYYEYVTS 296

Query: 321 FDIDLNDEFNDILRETRGIYEDVIKRINETNNTDKNAKSDILLKAGYYYEVQKTAREKEI 380
            D+ + +     L E+R IY  ++     +    K   + ++ +  Y Y+++K A EK +
Sbjct: 297 LDVHMKELLEKCLVESRSIYNSLLMNPAASTPEFKEEINQLVYEVSYAYQIKKLADEKNL 356

Query: 381 NPDTKGIILLSGFNYIENGDHXXXXX-XXXXXXXXXRFASESLFSPTCHNVTIEGVARYW 439
             D  G+++LS  +Y +NG H               R  + SLFS    N  +E   RYW
Sbjct: 357 ELDQYGVVILSAIHYSKNGTHLLPQIDIQSAIYLYLRCTTASLFSEIYENKFLESSVRYW 416

Query: 440 IWAALTTTDNNILKEKLAEXXXXXXXXXXXXXXXKNCHQVNEEIRMITFTLITRILCLLP 499
           +W + T T    +K  L E               K C++ N + ++   TL+ R+L L+P
Sbjct: 417 LWVSTTETSTEKIKCALQELPGHITTAFLQMLLMKTCNESNNDTKLTEITLLRRLLYLMP 476

Query: 500 ENCSYEFLMDELDNCAVVFGKSCVLGILRDLVIKVDHSVSSNNTDTEDLSESMAQLKINN 559
           E+ S+ F+ + L +C  +  K  VL ILRD++I+     ++N  +T  L E        N
Sbjct: 477 ESTSFTFIFETLLHCPYITAKIAVLDILRDMMIRSPE--AANRDETVGLIEQQNPGNTAN 534

Query: 560 E-----KRAKKTFITLDPKRAGEIEDLA-IXXXXXXXXXXXXDYILLVLNYIKFFSTFAH 613
                     + +IT++  R   I  +A I              +LLVL Y+KFF +  +
Sbjct: 535 SVPIMPTLPPRPYITINEDRMASIHSIALICFSAAKQKKRTQGDLLLVLTYMKFFVSLRN 594

Query: 614 KWNKSKLNEFTTLVATNFSDS 634
           KW+   L    TL+    S+S
Sbjct: 595 KWDLGLL----TLINKEISES 611

>AAR159C [347] [Homologous to ScYBR216C - SH; ScYGL060W - SH]
           (630860..632701) [1842 bp, 613 aa]
          Length = 613

 Score =  159 bits (401), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 136/637 (21%), Positives = 264/637 (41%), Gaps = 52/637 (8%)

Query: 10  DALKASFTDDKEDSLTLVTMIDTLSEEVDEGFEVKXXXXXXXXXXXXXXXXXXXVSAVGW 69
           ++L   F +   D ++L   I+  +E+                           V  +GW
Sbjct: 10  ESLGVLFAEQAGDVISLAAGIELCAEQALASGNAGRVASFLEALWEQLREHPALVGDLGW 69

Query: 70  DLPRTLLRFCNAKNIKNSDRLRKCKVVTICMAIFNLLALHAKPQECLVTTLELLSELNFK 129
           D+P+ L+R   A N   ++ L    V  + +  F  +      +EC +T  + L+EL+  
Sbjct: 70  DIPKVLVRCIRADNFNLNEGLGDDMVWRLLVGCFREVGREGNARECFLTGCQQLAELSV- 128

Query: 130 NIVEECHQLSEDGSDNNTAEEDNDAVEDYMKDRDQPEIIFGVKSYALFELAGSLIRRVAT 189
                             AEE+ DA        D  E +F +K + L E   + + R  T
Sbjct: 129 -----------------AAEEEEDA--------DLREEMFALKFHMLMEFVTTTLGRTTT 163

Query: 190 LHPSKYLEEAVTAIRKYVTNNTEVVEDVKFILRRVFAFCRGYIPPEPPRQLIVDLKMNHE 249
            +PS++L E +  + K V  N + + DV  +LRR++ FCR Y  P           ++  
Sbjct: 164 AYPSRFLGEIIGVLVKLVERNADELCDVHLLLRRLYTFCRDYTAP-----------VSSS 212

Query: 250 EYDEIMNSEIELQVRLLRNLCTFSVAYCVKFLNDKTEVVYFHKLINKDLQLPEFYRSVHD 309
           E +E+   E  LQ  L R+   +++A  ++  + +    YF K    + +L + +  + +
Sbjct: 213 EDEELRAQEDYLQRTLFRSFLAYALAQLLRRQSVRWAPEYFAKSHGLEFKLHDDHVELRE 272

Query: 310 IISRYYQIAFSFDIDLNDEFN-DILRETRGIYEDVIKRINETNNTDKNAKSDILLKAGYY 368
            + RY+Q+A SFDID+   F    + E+R +Y  V      + + DK   ++++ +  Y 
Sbjct: 273 TLGRYFQLAHSFDIDIEGAFQKQCILESRDVYACV------SADADKADGAEVIYQLAYT 326

Query: 369 YEVQKTAREKEINPDTKGIILLSGFNYIENGDHX-XXXXXXXXXXXXXRFASESLFSPTC 427
           YE++K A  + +  D +GI +L+  ++ E G                 RF +  ++S + 
Sbjct: 327 YELKKIAELQSMPIDARGIFVLAVLHHFETGKPICLSLRLDDAIYMFLRFNTPEIYSKSF 386

Query: 428 HNVTIEGVARYWIWAALTTTDNNILKEKLAEXXXXXXXXXXXXXXXKNCHQVNEEIRMIT 487
            N+ +   + Y++  AL    +    + + E                 C   + EI  +T
Sbjct: 387 GNIAVTDASLYFVLLALEGNSHEENHKLVREFPQTVFAVFIQVLLLNMCRLPSREIGRMT 446

Query: 488 FTLITRILCLLPENCSYEFLMDELDNCAVVFGKSCVLGILRDLVIKVDHSVSSNNTDTED 547
            +++ R+L L  E  +++F++D L  C     K  +L I + +++   +++ + +  +  
Sbjct: 447 HSILARVLFLASETTAFDFVIDTLLQCPYETAKQIILEIAKIMMVSDQYTICTRDVPSHT 506

Query: 548 LSESMAQLKINNEKRAKKTFITLDPKRAGEIEDLAIXXXXXXXXXXXXDYILLVLNYIKF 607
            +++ A           + FI L+  R      LA+              +  +L+Y+  
Sbjct: 507 RTDTKA------PPLPPRPFIKLNDDRMAAFHTLAMMSAKFCTETEDPKQLTTLLSYLNL 560

Query: 608 FSTFAHKWNKSKLNEFTTLVATNFSDSKM-LPEINAI 643
            +    KW++  L E T  V+      K  +PEI  I
Sbjct: 561 ITVLRKKWDQVLLRELTVAVSNCIEPRKEDIPEIGFI 597

>CAGL0F06985g 684832..686724 similar to sp|P53169 Saccharomyces
           cerevisiae YGL060w, hypothetical start
          Length = 630

 Score =  100 bits (249), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 137/608 (22%), Positives = 252/608 (41%), Gaps = 93/608 (15%)

Query: 69  WDLPRTLLRFCNAKNIKNSDRLRKCKVVTICMAIFNLLALHAKPQECLVTTLELLSELNF 128
           W LP+ L++  ++KN+++     K  V  IC    N + L A+     V T     + NF
Sbjct: 67  WGLPKALIKNISSKNVED-----KALVKAIC----NCMKLVAR-----VGT----DDYNF 108

Query: 129 ---KNIVEECHQLSEDGSDNNTAEEDNDAVEDYMKDRDQPEIIFGVKSYALFE-LAGSLI 184
                ++ EC        D N  ++ ND    Y+ +       F V+   L E      +
Sbjct: 109 LFGTELLRECR-----AEDTNIYDDSNDT---YILEA------FKVRVELLLEEFILPAL 154

Query: 185 RRVATLHPSKYLEEAVTAIRKYVTNNTEVVEDVKF---ILRRVFAFCRGYIPPEPPRQLI 241
           + +   +PSK+L   V+A+ + ++NN +  E+++    +L  +  F   Y  P   +   
Sbjct: 155 KTLGQTNPSKFLSVIVSALVELISNNMQCGEEIEMSNILLDVIIRFYDSYELPSA-KVTT 213

Query: 242 VDLKMNHEEYDEIMNSEIELQVRLLRNLCTFSVAYCVKFLNDKTEVVYFHKL-----INK 296
            D  M +++ ++I+        ++L +  +FS+  C+K  +   E +   ++     + +
Sbjct: 214 PDGAMANKDEEDIVQ-------KILESFWSFSIGRCIKNQSCFPEYILLSQIPRMDFVKQ 266

Query: 297 DLQLPEFY----RSVHDIISRYYQIAFSFDIDLNDEFNDILRETRGIYEDVIKRINETNN 352
           ++ +P+ +    R++  I +   Q+      DL         ETR IYE  +   N T  
Sbjct: 267 EIDVPDDFIIKSRNIIRITNEKLQL------DLQKMMEACFEETRKIYE--LLPPNPTVQ 318

Query: 353 TDKNAKSDILLKAGYYYEVQKTAREK-EINPDTKGIILLSGFNYIENGDHXXXXXXXX-X 410
            D N  ++ + +  Y   V     +K +++ DT G++ LSG  YI N +           
Sbjct: 319 -DGNDLTEEIYQMSYVNGVTTLEEQKGKLSLDTAGVLTLSGLYYIANDNKLNVKINLYDA 377

Query: 411 XXXXXRFASESLFSPTCHNVTIEGVARYWIWAALT--TTDNNILKEKLAEXXXXXXXXXX 468
                RF+S SL+SP   N  +EG+ R+W+W+       D N L+ +L            
Sbjct: 378 VLLYLRFSSASLYSPIFDNTFVEGICRFWLWSYTLGENRDKNTLQSELMSVPDYVLKVFF 437

Query: 469 XXXXXKNCHQVNEEIRMITFTLITRILCLLPENCSYEFLMDELDNCAVVFGKSCVLGILR 528
                K C++ +   + I F L+T++L       +++F++D + +C  +  K  + GIL+
Sbjct: 438 QLLLLKTCNEASTLQKRINFNLLTQLLAFSNAEVAFDFIVDTILSCPYLDAKIAIAGILK 497

Query: 529 DLVIKVDHSVSSNNTDTEDLSESMAQLKINNE--------KRAKKTFITLDPKRAGEIED 580
           DL+ K         +D   L E+    ++ NE        K   +  IT+D  R   I  
Sbjct: 498 DLMAK--------KSDDIHLKEAR---QVKNEPNNHNCPPKLPDRPPITVDEHRIASIHS 546

Query: 581 LA---IXXXXXXXXXXXXDYILLVLNYIKFFSTFAHKWNKSKLNEFTTLVATNFS--DSK 635
           L    I              ++L+  YI    T   +W+   L E    +   FS    +
Sbjct: 547 LVKLCIEDCLKPLNNKTQGNLILLQYYINILITLYKQWDGFLLKEINDEIKKLFSQRQEQ 606

Query: 636 MLPEINAI 643
             PE+  I
Sbjct: 607 EFPELEFI 614

>KLLA0F19888g complement(1839682..1854429) similar to sp|Q12019
           Saccharomyces cerevisiae YLR106c, start by similarity
          Length = 4915

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 34/56 (60%), Gaps = 4/56 (7%)

Query: 320 SFDIDLNDEFNDILRETRGIYEDVIKRINETNNTDKNAKSDILLKAGYYYEVQKTA 375
           SF+ID+N E + ++ E  G++   I RI+E  + +++ KSD++   G    +QK A
Sbjct: 253 SFNIDIN-ELSSLIVEVCGVF---IARISEAPSNEEHLKSDLVYTDGAKLALQKLA 304

>Kwal_33.13317
          Length = 486

 Score = 29.6 bits (65), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 2/49 (4%)

Query: 150 EDNDAVEDYMKDRDQPEIIFGVKSYALFELAGSLIRRVATLHPSKYLEE 198
           E N+ +E  +K+ +QP +I G+KS  LF    S    +A   P+ YLE+
Sbjct: 377 EYNEDIEQVLKNIEQPSLIIGIKSDGLFTY--SEQEYLAANIPNAYLEK 423

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.136    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,103,383
Number of extensions: 855895
Number of successful extensions: 3562
Number of sequences better than 10.0: 27
Number of HSP's gapped: 3615
Number of HSP's successfully gapped: 27
Length of query: 645
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 537
Effective length of database: 12,857,365
Effective search space: 6904405005
Effective search space used: 6904405005
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)