Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0K03443g61560529200.0
Scas_717.7162560010391e-134
YMR106C (YKU80)62963510191e-130
Sklu_2430.36266028341e-103
ABL030W6025947592e-92
Kwal_26.76246025757497e-91
KLLA0B12672g6096026003e-69
Scas_667.1617347691.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0K03443g
         (605 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0K03443g complement(316368..318215) similar to sp|Q04437 Sac...  1129   0.0  
Scas_717.71                                                           404   e-134
YMR106C (YKU80) [4063] chr13 complement(478300..480189) Componen...   397   e-130
Sklu_2430.3 YMR106C, Contig c2430 3786-5666                           325   e-103
ABL030W [562] [Homologous to ScYMR106C (YKU80) - SH] complement(...   296   2e-92
Kwal_26.7624                                                          293   7e-91
KLLA0B12672g 1105330..1107159 weakly similar to sp|Q04437 Saccha...   235   3e-69
Scas_667.16                                                            31   1.3  

>CAGL0K03443g complement(316368..318215) similar to sp|Q04437
           Saccharomyces cerevisiae YMR106c, start by similarity
          Length = 615

 Score = 1129 bits (2920), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 557/605 (92%), Positives = 557/605 (92%)

Query: 1   MSEATSVLIDVDVEPLIIAKVTAYLEYMLLDKARRGRKTDYVSAYLVNHTETQNSQDVPH 60
           MSEATSVLIDVDVEPLIIAKVTAYLEYMLLDKARRGRKTDYVSAYLVNHTETQNSQDVPH
Sbjct: 1   MSEATSVLIDVDVEPLIIAKVTAYLEYMLLDKARRGRKTDYVSAYLVNHTETQNSQDVPH 60

Query: 61  VVRLCDFLAPTTEGAIALLRQLALVRREYRGDNILQALLLASIDGRDYFGKRKVAKQLMI 120
           VVRLCDFLAPTTEGAIALLRQLALVRREYRGDNILQALLLASIDGRDYFGKRKVAKQLMI
Sbjct: 61  VVRLCDFLAPTTEGAIALLRQLALVRREYRGDNILQALLLASIDGRDYFGKRKVAKQLMI 120

Query: 121 FTDKVSELDLSAEELQTLHEELDSRIILVDCSTHPHQNAQGSQWDALVRTVKGSMSFHID 180
           FTDKVSELDLSAEELQTLHEELDSRIILVDCSTHPHQNAQGSQWDALVRTVKGSMSFHID
Sbjct: 121 FTDKVSELDLSAEELQTLHEELDSRIILVDCSTHPHQNAQGSQWDALVRTVKGSMSFHID 180

Query: 181 ELLLRITQXXXXXXXXXXXFSGQLRLGASLENIVDLEPHRRDEAAAADNPKKRQFPFGFR 240
           ELLLRITQ           FSGQLRLGASLENIVDLEPHRRDEAAAADNPKKRQFPFGFR
Sbjct: 181 ELLLRITQTVPKVVKPVTVFSGQLRLGASLENIVDLEPHRRDEAAAADNPKKRQFPFGFR 240

Query: 241 TEANYADDHCLCIGVQGYPATKKTGSLQKKTVVKDASKPGFVPVKSVIDYELRDNEVXXX 300
           TEANYADDHCLCIGVQGYPATKKTGSLQKKTVVKDASKPGFVPVKSVIDYELRDNEV   
Sbjct: 241 TEANYADDHCLCIGVQGYPATKKTGSLQKKTVVKDASKPGFVPVKSVIDYELRDNEVEGE 300

Query: 301 XXXXXXXDAPPITVARESITKAYRYGTDYVVLPSSLEDQLVYQTYAGLDIRGFMNMSDMH 360
                  DAPPITVARESITKAYRYGTDYVVLPSSLEDQLVYQTYAGLDIRGFMNMSDMH
Sbjct: 301 GKGKGEGDAPPITVARESITKAYRYGTDYVVLPSSLEDQLVYQTYAGLDIRGFMNMSDMH 360

Query: 361 RHFLTXXXXXXXXXXXXADQITFSALIDAMIQIDKIAIGRYVPKNNSDVQMCMLYPMILE 420
           RHFLT            ADQITFSALIDAMIQIDKIAIGRYVPKNNSDVQMCMLYPMILE
Sbjct: 361 RHFLTSESVFVVSSSSSADQITFSALIDAMIQIDKIAIGRYVPKNNSDVQMCMLYPMILE 420

Query: 421 KENGTHVRTLILNRLPFTEDERIAIFPRLTREDDKKSEKDETIDQLMAGFVESRSMDDLP 480
           KENGTHVRTLILNRLPFTEDERIAIFPRLTREDDKKSEKDETIDQLMAGFVESRSMDDLP
Sbjct: 421 KENGTHVRTLILNRLPFTEDERIAIFPRLTREDDKKSEKDETIDQLMAGFVESRSMDDLP 480

Query: 481 RVEEKKYYEFYEDSVRDTTLVLPMKSKDETRERDPLMVPAMGLHRQLQVMLEYLHQVVIN 540
           RVEEKKYYEFYEDSVRDTTLVLPMKSKDETRERDPLMVPAMGLHRQLQVMLEYLHQVVIN
Sbjct: 481 RVEEKKYYEFYEDSVRDTTLVLPMKSKDETRERDPLMVPAMGLHRQLQVMLEYLHQVVIN 540

Query: 541 KSEKFDPPELQDHLKAKITPHIVSDFPXXXXXXXXXXXXXXXPKSKEFKPPAPAEPVPSL 600
           KSEKFDPPELQDHLKAKITPHIVSDFP               PKSKEFKPPAPAEPVPSL
Sbjct: 541 KSEKFDPPELQDHLKAKITPHIVSDFPELEELVNLLELKKVEPKSKEFKPPAPAEPVPSL 600

Query: 601 EELLK 605
           EELLK
Sbjct: 601 EELLK 605

>Scas_717.71
          Length = 625

 Score =  404 bits (1039), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 237/600 (39%), Positives = 348/600 (58%), Gaps = 68/600 (11%)

Query: 2   SEATSVLIDVD---VEPLIIAKVTAYLEYMLLDKARRGRKTDYVSAYLVNHTETQNSQDV 58
           +E+T+ ++DV    +    ++K  AY+E+ LL+K ++ RKTD+ S Y  N  ET NSQ+V
Sbjct: 3   AESTTFIVDVSKNMINNDNVSKAMAYIEFTLLEKCKKKRKTDWTSLYAANSIETSNSQEV 62

Query: 59  PHVVRLCDFLAPTTEGAIAL----LRQLALVRREYRG--DNILQALLLASIDGRDYFGKR 112
           P+V +L  F+AP T   +A     L++   V+ E      +++Q LL+AS+D R+ FG +
Sbjct: 63  PNVSQLSPFIAPVTSDDVAATMRRLQKQCEVKNEADDMESSMVQCLLVASLDIREQFGAK 122

Query: 113 KVAKQLMIFTDKVSELDLSAEELQTLHEELDSRIILVDCSTHPHQNAQGSQ------WDA 166
           K+ +Q+M+FTD ++ L+ + EE+  L  E+DSRIILVDC        +  +      W  
Sbjct: 123 KMLRQIMVFTDDLNGLNFNDEEIDVLVGEIDSRIILVDCQEDSEDGEEEGKKNVDKAWLK 182

Query: 167 LVRTVKGSMSFHIDELLLRITQXXXXXXXXXXXFSGQLRLGASLENIVDLEPHRRDEAAA 226
           L++ + GSM   +D+LLL IT            F+G+LRLGA++++              
Sbjct: 183 LIKKLPGSMILPMDDLLLEITSPKPAVVKPVRVFNGELRLGANIDS-------------- 228

Query: 227 ADNPKKRQFPFGFRTEANYADDHCLCIGVQGYPATKKTGSLQK----KTVVKDASKPGFV 282
                          E+N  D +CL + V+GYPATK   SL +    KTV  +     ++
Sbjct: 229 -------------NAESNADDMNCLSMKVEGYPATKSLQSLNRRNTIKTVTGENHSTKYI 275

Query: 283 PVKSVIDYELRDNEVXXXXXXXXXXDAPPITVARESITKAYRYGTDYVVLPSSLEDQLVY 342
           PVKSVI+YE+  N            DA P+TV+R+SITKAYRYG DYVVLPS+L+ QLVY
Sbjct: 276 PVKSVIEYEVI-NPKESSQDADDKNDARPVTVSRDSITKAYRYGADYVVLPSTLQSQLVY 334

Query: 343 QTYAGLDIRGFMNMSDMHRHFLTXXXX---XXXXXXXXADQITFSALIDAMIQIDKIAIG 399
           +T+ GLDIRGFM+M  + R++L                AD +TF  L+D ++   K+A+ 
Sbjct: 335 ETFPGLDIRGFMDMELLPRYYLNSESTFIIADTRLGGLADSVTFGVLVDVLLNNRKVAVA 394

Query: 400 RYVPKNNSDVQMCMLYPMILEKENGT--------HVRTLILNRLPFTEDERIAIFPRLTR 451
           RYVPK NS+VQMC+L P+ +   + +         VRTL+LNRLPF EDER++ FPRLT 
Sbjct: 395 RYVPKANSEVQMCVLVPLFVAHHDQSFSGEGEENFVRTLVLNRLPFAEDERVSDFPRLTN 454

Query: 452 ED--------DKKSEKDETIDQLMAGFVESRSMDDLPRVEEKKYYEFYEDSVRDTTLVLP 503
                     + K+E DE +D LM  FV+S   D+L  V + +YY+      +DTTL LP
Sbjct: 455 RRSTSGRTLPEDKNEIDE-LDVLMEEFVDSMDTDNLLNVPDPEYYKPISQVTQDTTLRLP 513

Query: 504 MKS-KDETRERDPLMVPAMGLHRQLQVMLEYLHQVVINKSEKFDPPELQDHLKAKITPHI 562
            K  K+   E+DPL +PA+G+HRQ QV+LE++HQ VI  S+ FD P++ D L+ +I PH+
Sbjct: 514 TKEVKELENEQDPLRIPAIGVHRQQQVLLEWIHQKVIMGSDAFDIPDIPDKLREQIAPHV 573

>YMR106C (YKU80) [4063] chr13 complement(478300..480189) Component
           of DNA end-joining repair pathway, involved in
           protecting telomeres from homologous recombination, acts
           in a complex with Yku70p [1890 bp, 629 aa]
          Length = 629

 Score =  397 bits (1019), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 234/635 (36%), Positives = 352/635 (55%), Gaps = 54/635 (8%)

Query: 2   SEATSVLIDVD---VEPLIIAKVTAYLEYMLLDKARRGRKTDYVSAYLVNHTETQNSQDV 58
           SE+T+ ++DV    ++   ++K  AYLEY LL+K+++ RKTD++S YL N   ++NSQ++
Sbjct: 3   SESTTFIVDVSPSMMKNNNVSKSMAYLEYTLLNKSKKSRKTDWISCYLANCPVSENSQEI 62

Query: 59  PHVVRLCDFLAP-TTEGAIALLRQLALVRREYRGDN-------ILQALLLASIDGRDYFG 110
           P+V ++  FLAP TT   I  +++L     ++  D+       ++Q LL+ S+D +  F 
Sbjct: 63  PNVFQIQSFLAPVTTTATIGFIKRLKQYCDQHSHDSSNEGLQSMIQCLLVVSLDIKQQFQ 122

Query: 111 KRKVAKQLMIFTDKVSELDLSAEELQTLHEELDSRIILVDCSTHPHQNAQGSQWDALVRT 170
            RK+ KQ+++FTD + +LD++ EE+  L EEL +RIIL+DC     +  + S W  LV  
Sbjct: 123 ARKILKQIVVFTDNLDDLDITDEEIDLLTEELSTRIILIDCGKDTQEERKKSNWLKLVEA 182

Query: 171 VKGSMSFHIDELLLRITQXXXXXXXXXXXFSGQLRLGASLENIVDLEPHRRDEAAAADNP 230
           +  S  ++++ELL+ IT            FSG+LRLGA +             +    NP
Sbjct: 183 IPNSRIYNMNELLVEITSPATSVVKPVRVFSGELRLGADI------------LSTQTSNP 230

Query: 231 KKRQFPFGFRTEANYADDHCLCIGVQGYPATKKTGSLQKKTVVK---DASKPGFVPVKSV 287
                        +  D++CLCI V+ +PATK    L +KT V+      K  +V VKS+
Sbjct: 231 S-----------GSMQDENCLCIKVEAFPATKAVSGLNRKTAVEVEDSQKKERYVGVKSI 279

Query: 288 IDYELRD--NEVXXXXXXXXXXDAPPITVARESITKAYRYGTDYVVLPSSLEDQLVYQTY 345
           I+YE+ +  N+              P+T++++S+TKAYRYG DYVVLPS L DQ VY+++
Sbjct: 280 IEYEIHNEGNKKNVSEDDQSGSSYIPVTISKDSVTKAYRYGADYVVLPSVLVDQTVYESF 339

Query: 346 AGLDIRGFMNMSDMHRHFLTXXXXXXXXXX---XXADQITFSALIDAMIQIDKIAIGRYV 402
            GLD+RGF+N   + R+FLT               +D + FSAL+D M++  KIA+ RYV
Sbjct: 340 PGLDLRGFLNREALPRYFLTSESSFITADTRLGCQSDLMAFSALVDVMLENRKIAVARYV 399

Query: 403 PKNNSDVQMCMLYPMILEKEN----GTHVRTLILNRLPFTEDERIAIFPRLTREDD---- 454
            K +S+V MC L P+++E  N       V++L L RLPF EDER+  FP+L         
Sbjct: 400 SKKDSEVNMCALCPVLIEHSNINSEKKFVKSLTLCRLPFAEDERVTDFPKLLDRTTTSGV 459

Query: 455 --KKSEKDETIDQLMAGFVESRSMDDLPRVEEKKYYEFYEDSVRDTTLVLPMKSKD-ETR 511
             KK      ID+LM  FV+S   D+LP +    YY+   +   DTTL LP  +KD E  
Sbjct: 460 PLKKETDGHQIDELMEQFVDSMDTDELPEIPLGNYYQPIGEVTTDTTLPLPSLNKDQEEN 519

Query: 512 ERDPLMVPAMGLHRQLQVMLEYLHQVVINKSEKFDPPELQDHLKAKITPHIVSDFPXXXX 571
           ++DPL +P + ++RQ QV+LE++HQ++IN S +F+ PEL D LK KI+P+    F     
Sbjct: 520 KKDPLRIPTVFVYRQQQVLLEWIHQLMINDSREFEIPELPDSLKNKISPYTHKKFDSTKL 579

Query: 572 XXXXXXXXXXXPK-SKEFKPPAPAEPVPSLEELLK 605
                       K   E K     E +P LE LLK
Sbjct: 580 VEVLGIKKVDKLKLDSELKTELEREKIPDLETLLK 614

>Sklu_2430.3 YMR106C, Contig c2430 3786-5666
          Length = 626

 Score =  325 bits (834), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 217/602 (36%), Positives = 316/602 (52%), Gaps = 78/602 (12%)

Query: 2   SEATSVLIDVD---VEPLIIAKVTAYLEYMLLDKARRGRKTDYVSAYLVNHTETQNSQDV 58
           SEAT+ LIDV    V    + K  AYLEY L  K ++GRKTDYVS  LVN   T+N+QD 
Sbjct: 3   SEATTFLIDVSHSMVAGGHVDKALAYLEYTLFQKVKKGRKTDYVSCILVNCPLTKNNQDT 62

Query: 59  PHVVRLCDFLAPTTE-GAIALLRQLALV--------RREYRGDNILQALLLASIDGRDYF 109
            ++    +  AP T    + LL+ +  V        +      +++Q++L++S+  RD+F
Sbjct: 63  DYIYEALEVTAPVTSVTTVKLLKDIRTVLQYIETTDKDHSECLSMIQSVLVSSVILRDFF 122

Query: 110 GKRKVAKQLMIFTDKVSELDLSAEELQTLHEELDSRIILVDCSTHPHQNAQG-SQWDALV 168
            KRK+ K L++FTD +  LD   +ELQ +  ELD RIILV C         G + W   V
Sbjct: 123 KKRKITKNLVVFTDDMDGLDCDDDELQIMSNELDCRIILVHCEDEKKLKDNGDTIWGKCV 182

Query: 169 RTVKGSMSFHIDELLLRITQXXXXXXXXXXXFSGQLRLGASLENIVDLEPHRRDEAAAAD 228
           R+V GS+ + I ELL  IT            F G+LRLGAS+E          D  ++ D
Sbjct: 183 RSVPGSVKYTILELLRTITIPKPPVVKPVRIFQGELRLGASME----------DAGSSMD 232

Query: 229 NPKKRQFPFGFRTEANYADDHCLCIGVQGYPATKKTGSLQKKTVVKDASKPGFVPVKSVI 288
           + K                   +CI V+G+PATK   +L +K VVK+     + PVKS+I
Sbjct: 233 DFKS------------------ICIQVEGFPATKAVSNLNRKVVVKNGEN-DYSPVKSII 273

Query: 289 DYELRDNEVXXXXXXXXXXDAPPITVARESITKAYRYGTDYVVLPSSLEDQLVYQTYAGL 348
           +YE+ +             DA  + V++ SITKAYRYG+DYVVLP +LE + +Y+T  GL
Sbjct: 274 EYEIHNR----VNGETSEFDA--VAVSKSSITKAYRYGSDYVVLPPTLESERIYETEPGL 327

Query: 349 DIRGFMNMSDMHRHFLTXXXX---XXXXXXXXADQITFSALIDAMIQIDKIAIGRYVPKN 405
           DIRGF++  D  R++L                AD +  SAL+D++I+++K AI RYV + 
Sbjct: 328 DIRGFLDRKDFPRYYLNSESTFIVTDTRQGSRADYMALSALVDSLIKLEKFAIARYVQRK 387

Query: 406 NSDVQMCMLYPMILEKENGT---------HVRTLILNRLPFTEDERIAIFPRLT--REDD 454
           NS+VQMC+L P++++  NG          H R LIL+RLPF EDER   FP+L+  R   
Sbjct: 388 NSEVQMCLLCPILIDDTNGMKRKLGREEQHTRALILSRLPFAEDERSPDFPKLSYQRTTS 447

Query: 455 KKS--EKDETIDQLMAGFVESRSMDDLPRVEEKKYYE----FYEDSVRDTTLVLPMKS-- 506
            K+  E    +D  M+ F++S  +DD     E  +Y        D     +  +P+ S  
Sbjct: 448 GKTLVEDTTNLDSQMSMFIDSMDLDDNTGSSESSWYRNPCFVTADPTNALSTTIPLPSIE 507

Query: 507 ---KDETRERDPLMVPAMGLHRQLQVMLEYLHQVVINKSEK-----FDPPELQDHLKAKI 558
              K+     +PL +PA+  HRQ Q +LEY+HQ  + +++K     F  P + D L +K 
Sbjct: 508 QDGKEPKANGNPLCMPAISAHRQQQALLEYMHQKYVMETKKDDKFEFQVPSMPDLLLSKT 567

Query: 559 TP 560
            P
Sbjct: 568 RP 569

>ABL030W [562] [Homologous to ScYMR106C (YKU80) - SH]
           complement(341669..343477) [1809 bp, 602 aa]
          Length = 602

 Score =  296 bits (759), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 201/594 (33%), Positives = 291/594 (48%), Gaps = 79/594 (13%)

Query: 3   EATSVLIDVDVEPL-IIAKVTAYLEYMLLDKARRGRKTDYVSAYLVNHTETQNSQDVPHV 61
           E T+ LID     L   AK  AYLEY L DKA+R RKTDY    L N    +N  +V ++
Sbjct: 4   ECTTFLIDYSASMLESTAKFEAYLEYALFDKAQRSRKTDYTHVVLANCAMEKNPNNVKNM 63

Query: 62  VRLCDFLAPTTEGAIALLRQLALVRREY-----RGDNILQALLLASIDGRDYFGKRKVAK 116
             +    AP T  ++  + +     RE      +  N+ +ALL   +   D F KRK+ K
Sbjct: 64  FEVFAPSAPITLSSVVKICERLKAMRELDPLDTKQSNVFEALLAIGMQVNDKFNKRKMLK 123

Query: 117 QLMIFTDKVSELDLSAEELQTLHEELDSRIILVDCSTHPHQNAQGSQWDALVRTVKGSMS 176
           Q+M+ TD +  L++ +E+L+ +   LD R+ILV C+     N   ++W  L+    GS  
Sbjct: 124 QVMVVTDDLDGLNVDSEDLEVVQANLDLRLILVYCAEQFPDNFSKTKWGQLLALKDGSRM 183

Query: 177 FHIDELLLRITQXXXXXXXXXXXFSGQLRLGASLENIVDLEPHRRDEAAAADNPKKRQFP 236
           F + E+L  I +           F GQLRLGA + N+   +                   
Sbjct: 184 FTLYEVLGTIERITHQPVKPVRVFHGQLRLGADMRNLAGCQ------------------- 224

Query: 237 FGFRTEANYADDHCLCIGVQGYPATKKTGSLQKKTVVKDASKPGFVPVKSVIDYELR--- 293
                     D HCLCI V+GYPATK   S+ +K V K      ++P++SVI+YE+    
Sbjct: 225 ---------QDPHCLCINVEGYPATKAVVSMSRKQVQK-TEDGKYLPLQSVIEYEIHEPT 274

Query: 294 --DNEVXXXXXXXXXXDAPPITVARESITKAYRYGTDYVVLPSSLEDQLVYQTYAGLDIR 351
             DNE               + V +E +TKAYRYG DYVVLP  LE + +Y T  GLDIR
Sbjct: 275 EEDNEEYHV-----------VPVPKEHVTKAYRYGADYVVLPELLEHERLYTTTPGLDIR 323

Query: 352 GFMNMSDMHRHFLTXXX---XXXXXXXXXADQITFSALIDAMIQIDKIAIGRYVPKNNSD 408
           GF++   + RH L                AD +TF+AL+DAMI  +K AI RYV K +S+
Sbjct: 324 GFIDTGKVLRHHLCSESVYIMADSREGTAADYVTFAALVDAMIAAEKFAIARYVQKKDSE 383

Query: 409 VQMCMLYPMILE---------KENGTHVRTLILNRLPFTEDERIAIFPRLTREDDKKSEK 459
           VQMC+L P+++E          +     R L+L RLPF EDER + FP L     K+   
Sbjct: 384 VQMCLLCPLLVEPSTKKRPADDDAAEAKRALVLCRLPFAEDERSSDFPPLV----KQEPA 439

Query: 460 DETIDQLMAGFVESRSMDDL---PRVEEKKYYEFYEDSVRDTTLVLPMKSKDETRERDPL 516
           D  +D  MA F++S  MD                ++  ++D+TL LP    D+    +P 
Sbjct: 440 DVMLDTTMAAFIDSMDMDAAAPPASWCSSSNVRSFDSFMKDSTLPLP----DDPSLAEPC 495

Query: 517 ----MVPAMGLHRQLQVMLEYLHQ-VVINKSEKFDPPELQDHLKAKITPHIVSD 565
                +PA+ LH Q  V+LEY  Q  ++  S  F   +L+D L++K++P   ++
Sbjct: 496 SAAACIPAVALHHQKHVLLEYFRQRFILRLSGGFSVADLRDSLRSKVSPWATAE 549

>Kwal_26.7624
          Length = 602

 Score =  293 bits (749), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 197/575 (34%), Positives = 311/575 (54%), Gaps = 66/575 (11%)

Query: 2   SEATSVLIDVD---VEPLIIAKVTAYLEYMLLDKARRGRKTDYVSAYLVNHTETQNSQDV 58
           SEAT+ +IDV    +E     + +AYLEY L  K+++ RKTD+V+ YL N   T+NS + 
Sbjct: 3   SEATTFIIDVSPSMIELGYAEQASAYLEYTLFLKSKKQRKTDWVNCYLANCPLTRNSYET 62

Query: 59  PHVVRLCDFLAP-TTEGAIALLRQLALVRREY-----RGDNILQALLLASIDGRDYFGKR 112
            +V  L  F AP + +  I  LR+L  V ++      R + ++Q LL+ S++ RD F KR
Sbjct: 63  DNVFELMPFTAPISADRVIETLRELQSVSQKSIASKERINTMIQCLLVTSMNMRDEFKKR 122

Query: 113 KVAKQLMIFTDKVSELDLSAEELQTLHEELDSRIILVDCS--THPHQNAQGSQWDALVRT 170
           K+ KQ+M+FTD ++ LDL+ EEL TL +EL   +ILV C       ++ + + W+  ++ 
Sbjct: 123 KIRKQIMVFTDDLNGLDLTEEELTTLEQELGCSLILVKCGPKKDSSEDMKLTIWEKCIQV 182

Query: 171 VKGSMSFHIDELLLRITQXXXXXXXXXXXFSGQLRLGASLENIVDLEPHRRDEAAAADNP 230
           + GS    + ELL  I+            F   LRLGA +                    
Sbjct: 183 IPGSRQTTMTELLKEISSHRPAVVKPIRIFQANLRLGAQI-------------------- 222

Query: 231 KKRQFPFGFRTEANYADDHCLCIGVQGYPATKKTGSLQKKTVVKDASKPGFVPVKSVIDY 290
                   F+ E    +   L + V+GYPATK   SL ++ V K   +  +  VKS+I+Y
Sbjct: 223 --------FQEEGQETNYDSLDVKVEGYPATKAVSSLNRRVVAKIGEQE-YEQVKSIIEY 273

Query: 291 ELRDNEVXXXXXXXXXXDAPPITVARESITKAYRYGTDYVVLPSSLEDQLVYQTYAGLDI 350
              + +            A   +V+++ +TKAYRYG+DYVVLP ++E + +Y+T  GLD+
Sbjct: 274 SALEED--------DSDSAEAASVSKDFVTKAYRYGSDYVVLPQTIESERIYKTTPGLDL 325

Query: 351 RGFMNMSDMHRHFLTXXXX---XXXXXXXXADQITFSALIDAMIQIDKIAIGRYVPKNNS 407
           RGF++  D+ RH+L                AD + F+AL+D+MI+++K A+ RYV K NS
Sbjct: 326 RGFLDKEDIPRHYLNSESTFIVASTKDGSRADFLAFAALVDSMIKLNKFAVARYVQKTNS 385

Query: 408 DVQMCMLYPMILEK------ENGTHVRTLILNRLPFTEDERIAIFPRLTREDDKKSEKDE 461
           +VQMC+L P++++K      ++  + R L+LNRLPF EDER++ +P+L+R       K  
Sbjct: 386 EVQMCVLCPLLVKKKRRELEDSEPYYRALVLNRLPFAEDERVSDYPKLSRSSGMPEAKIV 445

Query: 462 TIDQLMAGFVESRSMDDLPRVEEKKY-----YEFYEDSVRDTTLVLPMKSKDETRER-DP 515
             D LM  F++S    DL    +  +     Y   + +  D +L LP        E+ DP
Sbjct: 446 ETDALMDDFIDSM---DLGGGGDSSWCYTSRYRPIDSATTDPSLPLPASDSPRDDEKPDP 502

Query: 516 LMVPAMGLHRQLQVMLEYLHQVVINKSEKFDPPEL 550
           + +PA+G++RQ Q+++EY+HQ V+  S+ F+ PEL
Sbjct: 503 MQLPAIGVYRQQQLLVEYMHQRVVMGSDTFEVPEL 537

>KLLA0B12672g 1105330..1107159 weakly similar to sp|Q04437
           Saccharomyces cerevisiae YMR106c HDF2 component of DNA
           end-joining repair pathway singleton, start by
           similarity
          Length = 609

 Score =  235 bits (600), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 175/602 (29%), Positives = 292/602 (48%), Gaps = 79/602 (13%)

Query: 1   MSEATSVLIDV-DVEPLIIAKVTAYLEYMLLDKARRGRKTDYVSAYLVNHTETQNSQDVP 59
           MSE T  ++DV  +      K   Y+EY+LL+K +  RKTDYV   LVN + +  S  V 
Sbjct: 1   MSELTCFVVDVGSLSGDQWLKAFTYVEYVLLNKVQSQRKTDYVQLNLVNVSSSDESLPVN 60

Query: 60  HVVRLCDF-LAPTTEGAI-ALLRQLALVRREYRG-------DNILQALLLASIDGRDYFG 110
           ++  L     AP +   + + L Q    R    G       D +   LL++ +  +++ G
Sbjct: 61  NMAMLPVLPRAPISISDVRSWLGQWYDERNNTTGNGEDDDDDMLFNGLLISVLKLKEFVG 120

Query: 111 KRKVAKQLMIFTDKVSELDLSAEELQTLHEELDSRIILVDCS-THPHQNAQGSQWDALVR 169
           KRK+  ++++F+ +  + +++ EEL T  ++    +++ DC+    HQ ++   W  L  
Sbjct: 121 KRKMKVKIVVFSSQDLQ-NVTDEELSTFADQCPFDLVIADCNDKQGHQESKHGNWLKL-- 177

Query: 170 TVKGSMSFHIDELLLRITQXXXXXXXXXXXFSGQLRLGASLENIVDLEPHRRDEAAAADN 229
                + + IDEL+  +             F GQLRLG               +  A+D 
Sbjct: 178 --GTPLVYGIDELIQSVADPKLKLTRPIRTFQGQLRLG---------------DVNASD- 219

Query: 230 PKKRQFPFGFRTEANYADDHCLCIGVQGYPATKKTGSLQKKTVVKDAS---KPGFVPVKS 286
                   G  +         LCI ++G P TK   S+ +K + K+ S   +P +  VKS
Sbjct: 220 -------LGIPS---------LCINLEGVPGTKSVSSISRKVMRKEGSSEGQPTYRAVKS 263

Query: 287 VIDYELRDNEVXXXXXXXXXX-----------DAPP--ITVARESITKAYRYGTDYVVLP 333
           VI+Y++ D                        +  P  I V+++ I KAYRYG DYV LP
Sbjct: 264 VIEYQIEDQSASTSASPKKETTRKDDDGDSGNNTGPRMINVSKDFIKKAYRYGADYVDLP 323

Query: 334 SSLEDQLVYQTYAGLDIRGFMNMSDMHRHFLTXXXXXX---XXXXXXADQITFSALIDAM 390
             L+++       GLDIRGFM++  + RH+L                 D + F  L+D++
Sbjct: 324 MPLDEERKLSEKPGLDIRGFMDIDKLPRHYLCSESMYLVPDSKNGSKGDFLGFVTLVDSL 383

Query: 391 IQIDKIAIGRYVPKNNSDVQMCMLYPMILEKENGTHVRTLILNRLPFTEDERIAIFPRLT 450
           I++ ++ I R+VPK  ++VQMC L+P+ +  ++   VR L+LNRLP +EDER + FP++ 
Sbjct: 384 IKMKRLIIARFVPKFGNEVQMCSLFPVRVHDKDRNEVRLLVLNRLPMSEDERNSAFPKMC 443

Query: 451 REDDKKSEKDETIDQLMAGFVESRSMD----DLPRVEEKKYYEFYEDSVRDTTLVLPMKS 506
              + + E     D+ M  FV+S ++D    DLP  E  +  ++ + ++  ++L LP + 
Sbjct: 444 ESTELEPE-----DEAMGQFVDSMNLDNDAQDLPWYESDQIQKYTDVALEQSSLPLPQRE 498

Query: 507 KDETRERDPLMVPAMGLHRQLQVMLEYLHQ-VVINKSEKFD--PPELQDHLKAKITPHIV 563
                 R+P  +PA+ LHRQ QV+LE +HQ  ++ K ++ D   P +   +  KITP   
Sbjct: 499 MFRATARNPSAIPAISLHRQQQVILECVHQKFIVGKRDQQDLNIPPMSKMILKKITPKYN 558

Query: 564 SD 565
           +D
Sbjct: 559 AD 560

>Scas_667.16
          Length = 173

 Score = 31.2 bits (69), Expect = 1.3,   Method: Composition-based stats.
 Identities = 15/47 (31%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query: 318 SITKAYRYGTDYVVLPSSLEDQLVYQTYAGLDIRGFMNMSDMHRHFL 364
           +I K    G D ++L + +E+++  Q Y G+   GF+ M  M R++L
Sbjct: 104 AINKMIDDGCDEIMLEAEVENKVALQLYEGM---GFIRMKRMFRYYL 147

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.135    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,884,223
Number of extensions: 731326
Number of successful extensions: 2038
Number of sequences better than 10.0: 13
Number of HSP's gapped: 2052
Number of HSP's successfully gapped: 16
Length of query: 605
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 498
Effective length of database: 12,891,983
Effective search space: 6420207534
Effective search space used: 6420207534
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)