Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0K03421g56855929810.0
YMR105C (PGM2)56955725150.0
CAGL0K07480g56755724320.0
Scas_717.7056955724290.0
Scas_721.12356955723640.0
YKL127W (PGM1)57055723440.0
Sklu_2430.457155922900.0
KLLA0B12694g56855222830.0
Kwal_26.762857055122670.0
ABL029W56855621660.0
CAGL0M02981g6175541014e-04
YMR278W622296860.022
Sklu_1994.2624578860.027
Scas_696.42625375850.034
Kwal_27.10258620421800.13
AEL034W671197721.1
Sklu_2244.2352122648.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0K03421g
         (559 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0K03421g complement(313851..315557) highly similar to sp|P37...  1152   0.0  
YMR105C (PGM2) [4062] chr13 complement(475896..477605) Phosphogl...   973   0.0  
CAGL0K07480g complement(739633..741336) highly similar to sp|P37...   941   0.0  
Scas_717.70                                                           940   0.0  
Scas_721.123                                                          915   0.0  
YKL127W (PGM1) [3139] chr11 (203187..204899) Phosphoglucomutase,...   907   0.0  
Sklu_2430.4 YMR105C, Contig c2430 6115-7830                           886   0.0  
KLLA0B12694g 1107696..1109402 highly similar to sp|P37012 Saccha...   884   0.0  
Kwal_26.7628                                                          877   0.0  
ABL029W [563] [Homologous to ScYKL127W (PGM1) - SH; ScYMR105C (P...   838   0.0  
CAGL0M02981g 335863..337716 similar to sp|Q03262 Saccharomyces c...    44   4e-04
YMR278W (YMR278W) [4232] chr13 (822762..824630) Protein containi...    38   0.022
Sklu_1994.2 YMR278W, Contig c1994 3654-5528                            38   0.027
Scas_696.42                                                            37   0.034
Kwal_27.10258                                                          35   0.13 
AEL034W [2472] [Homologous to ScYOL023W (IFM1) - SH] complement(...    32   1.1  
Sklu_2244.2 YOL151W, Contig c2244 1821-2879 reverse complement         29   8.8  

>CAGL0K03421g complement(313851..315557) highly similar to sp|P37012
           Saccharomyces cerevisiae YMR105c Phosphoglucomutase 2,
           start by similarity
          Length = 568

 Score = 1152 bits (2981), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 559/559 (100%), Positives = 559/559 (100%)

Query: 1   MSQIESVPTKPYQDQKPGTSGLRKKTKVFEDQPNYVENFIQSVMEAIPEGAKGAVLVVGG 60
           MSQIESVPTKPYQDQKPGTSGLRKKTKVFEDQPNYVENFIQSVMEAIPEGAKGAVLVVGG
Sbjct: 1   MSQIESVPTKPYQDQKPGTSGLRKKTKVFEDQPNYVENFIQSVMEAIPEGAKGAVLVVGG 60

Query: 61  DGRYYNDVILQKIAAIGAANGVKKLVIGQNGLLSTPAASHIMRTYKEKCTGGIILTASHN 120
           DGRYYNDVILQKIAAIGAANGVKKLVIGQNGLLSTPAASHIMRTYKEKCTGGIILTASHN
Sbjct: 61  DGRYYNDVILQKIAAIGAANGVKKLVIGQNGLLSTPAASHIMRTYKEKCTGGIILTASHN 120

Query: 121 PGGPENDMGIKYNLSNGGPAPEPVTNKIWEISKKLTHYKIVKDFPELDLTKLVENKKYGP 180
           PGGPENDMGIKYNLSNGGPAPEPVTNKIWEISKKLTHYKIVKDFPELDLTKLVENKKYGP
Sbjct: 121 PGGPENDMGIKYNLSNGGPAPEPVTNKIWEISKKLTHYKIVKDFPELDLTKLVENKKYGP 180

Query: 181 LLVDVIDTTDAYIQLLKEIFDFELIHKFIAKQRKEKGWKLLVDSMNGVTGPYAKAIFVDE 240
           LLVDVIDTTDAYIQLLKEIFDFELIHKFIAKQRKEKGWKLLVDSMNGVTGPYAKAIFVDE
Sbjct: 181 LLVDVIDTTDAYIQLLKEIFDFELIHKFIAKQRKEKGWKLLVDSMNGVTGPYAKAIFVDE 240

Query: 241 FGLDSKEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVNKEKIEFGAASDGDGDRNMIYGY 300
           FGLDSKEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVNKEKIEFGAASDGDGDRNMIYGY
Sbjct: 241 FGLDSKEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVNKEKIEFGAASDGDGDRNMIYGY 300

Query: 301 GPAFVSPGDSVAIIAEYANEIPYFKKQGIYGLARSFPTASAIDRVAKKHGLNCYEVPTGW 360
           GPAFVSPGDSVAIIAEYANEIPYFKKQGIYGLARSFPTASAIDRVAKKHGLNCYEVPTGW
Sbjct: 301 GPAFVSPGDSVAIIAEYANEIPYFKKQGIYGLARSFPTASAIDRVAKKHGLNCYEVPTGW 360

Query: 361 KFFCALFDAKKLSICGEESFGTGSNHVREKDGIWAIMAWLNILAIFNQRHPDKEASIKTI 420
           KFFCALFDAKKLSICGEESFGTGSNHVREKDGIWAIMAWLNILAIFNQRHPDKEASIKTI
Sbjct: 361 KFFCALFDAKKLSICGEESFGTGSNHVREKDGIWAIMAWLNILAIFNQRHPDKEASIKTI 420

Query: 421 QNEFWDTYGRTFFTRYDYEKVETDKANKVIENLRQYVADSGTKGSKFPTDSALTVVDAGD 480
           QNEFWDTYGRTFFTRYDYEKVETDKANKVIENLRQYVADSGTKGSKFPTDSALTVVDAGD
Sbjct: 421 QNEFWDTYGRTFFTRYDYEKVETDKANKVIENLRQYVADSGTKGSKFPTDSALTVVDAGD 480

Query: 481 FSYTDLDGTISSHQGLYVILSNGARFVVRLSGTGSSGATIRLYIERYTDDKSKYSLDAQE 540
           FSYTDLDGTISSHQGLYVILSNGARFVVRLSGTGSSGATIRLYIERYTDDKSKYSLDAQE
Sbjct: 481 FSYTDLDGTISSHQGLYVILSNGARFVVRLSGTGSSGATIRLYIERYTDDKSKYSLDAQE 540

Query: 541 YLKPIIKSIVQFLDLKTIL 559
           YLKPIIKSIVQFLDLKTIL
Sbjct: 541 YLKPIIKSIVQFLDLKTIL 559

>YMR105C (PGM2) [4062] chr13 complement(475896..477605)
           Phosphoglucomutase, major isozyme, interconverts Glc-1-P
           and Glc-6-P [1710 bp, 569 aa]
          Length = 569

 Score =  973 bits (2515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/557 (82%), Positives = 501/557 (89%)

Query: 3   QIESVPTKPYQDQKPGTSGLRKKTKVFEDQPNYVENFIQSVMEAIPEGAKGAVLVVGGDG 62
           QIE+VPTKPY+DQKPGTSGLRKKTKVF+D+PNY ENFIQS+MEAIPEG+KGA LVVGGDG
Sbjct: 4   QIETVPTKPYEDQKPGTSGLRKKTKVFKDEPNYTENFIQSIMEAIPEGSKGATLVVGGDG 63

Query: 63  RYYNDVILQKIAAIGAANGVKKLVIGQNGLLSTPAASHIMRTYKEKCTGGIILTASHNPG 122
           RYYNDVIL KIAAIGAANG+KKLVIGQ+GLLSTPAASHIMRTY+EKCTGGIILTASHNPG
Sbjct: 64  RYYNDVILHKIAAIGAANGIKKLVIGQHGLLSTPAASHIMRTYEEKCTGGIILTASHNPG 123

Query: 123 GPENDMGIKYNLSNGGPAPEPVTNKIWEISKKLTHYKIVKDFPELDLTKLVENKKYGPLL 182
           GPENDMGIKYNLSNGGPAPE VTN IWEISKKLT YKI+KDFPELDL  + +NKKYGPLL
Sbjct: 124 GPENDMGIKYNLSNGGPAPESVTNAIWEISKKLTSYKIIKDFPELDLGTIGKNKKYGPLL 183

Query: 183 VDVIDTTDAYIQLLKEIFDFELIHKFIAKQRKEKGWKLLVDSMNGVTGPYAKAIFVDEFG 242
           VD+ID T  Y+  LKEIFDF+LI KFI  QR  K WKLL DSMNGVTGPY KAIFVDEFG
Sbjct: 184 VDIIDITKDYVNFLKEIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVDEFG 243

Query: 243 LDSKEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVNKEKIEFGAASDGDGDRNMIYGYGP 302
           L + EVLQNWHP PDFGG+HPDPNLTYA +LV+RV++EKIEFGAASDGDGDRNMIYGYGP
Sbjct: 244 LPADEVLQNWHPSPDFGGMHPDPNLTYASSLVKRVDREKIEFGAASDGDGDRNMIYGYGP 303

Query: 303 AFVSPGDSVAIIAEYANEIPYFKKQGIYGLARSFPTASAIDRVAKKHGLNCYEVPTGWKF 362
           +FVSPGDSVAIIAEYA EIPYF KQGIYGLARSFPT+ AIDRVAK HGLNCYEVPTGWKF
Sbjct: 304 SFVSPGDSVAIIAEYAAEIPYFAKQGIYGLARSFPTSGAIDRVAKAHGLNCYEVPTGWKF 363

Query: 363 FCALFDAKKLSICGEESFGTGSNHVREKDGIWAIMAWLNILAIFNQRHPDKEASIKTIQN 422
           FCALFDAKKLSICGEESFGTGSNHVREKDG+WAIMAWLNILAI+N+ HP+ EASIKTIQN
Sbjct: 364 FCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNKHHPENEASIKTIQN 423

Query: 423 EFWDTYGRTFFTRYDYEKVETDKANKVIENLRQYVADSGTKGSKFPTDSALTVVDAGDFS 482
           EFW  YGRTFFTRYD+EKVET+KANK+++ LR YV  SG   S FP D +L V D GDFS
Sbjct: 424 EFWAKYGRTFFTRYDFEKVETEKANKIVDQLRAYVTKSGVVNSAFPADESLKVTDCGDFS 483

Query: 483 YTDLDGTISSHQGLYVILSNGARFVVRLSGTGSSGATIRLYIERYTDDKSKYSLDAQEYL 542
           YTDLDG++S HQGLYV LSNGARFV+RLSGTGSSGATIRLYIE+Y DDKS+Y   A+EYL
Sbjct: 484 YTDLDGSVSDHQGLYVKLSNGARFVLRLSGTGSSGATIRLYIEKYCDDKSQYQKTAEEYL 543

Query: 543 KPIIKSIVQFLDLKTIL 559
           KPII S+++FL+ K +L
Sbjct: 544 KPIINSVIKFLNFKQVL 560

>CAGL0K07480g complement(739633..741336) highly similar to sp|P37012
           Saccharomyces cerevisiae YMR105c PGM2
           phosphoglucomutase, hypothetical start
          Length = 567

 Score =  941 bits (2432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/557 (77%), Positives = 505/557 (90%)

Query: 3   QIESVPTKPYQDQKPGTSGLRKKTKVFEDQPNYVENFIQSVMEAIPEGAKGAVLVVGGDG 62
           Q+E+VPTKPYQDQKPGTSGLRKKTKVF ++PNY ENFIQ++M+AIPEGAK AVLVVGGDG
Sbjct: 2   QVETVPTKPYQDQKPGTSGLRKKTKVFMEEPNYTENFIQAIMDAIPEGAKDAVLVVGGDG 61

Query: 63  RYYNDVILQKIAAIGAANGVKKLVIGQNGLLSTPAASHIMRTYKEKCTGGIILTASHNPG 122
           R+YNDVI+QKIAAIGAANGV+KL+IGQNGLLSTPAASH++R+Y EKCTGGIILTASHNPG
Sbjct: 62  RFYNDVIMQKIAAIGAANGVRKLIIGQNGLLSTPAASHVIRSYAEKCTGGIILTASHNPG 121

Query: 123 GPENDMGIKYNLSNGGPAPEPVTNKIWEISKKLTHYKIVKDFPELDLTKLVENKKYGPLL 182
           GPEND+GIKYNL+NGGPAPEPVTNK+WE+SK+LTHYKI+KDFP++D +K+ ++++YGPLL
Sbjct: 122 GPENDLGIKYNLANGGPAPEPVTNKMWEVSKQLTHYKIIKDFPQVDFSKIGKDQQYGPLL 181

Query: 183 VDVIDTTDAYIQLLKEIFDFELIHKFIAKQRKEKGWKLLVDSMNGVTGPYAKAIFVDEFG 242
           VD+IDTT+ Y++ +KEIFDF+LI +FI KQR+ K WKLL DS+NG+TGPY KAIFVDEF 
Sbjct: 182 VDIIDTTEDYVKFMKEIFDFKLIKEFIHKQREAKNWKLLFDSLNGITGPYGKAIFVDEFD 241

Query: 243 LDSKEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVNKEKIEFGAASDGDGDRNMIYGYGP 302
           L + EVLQNWHPQPDFGGLHPDPNLTYAHTLVERV++EKIEFGAASDGDGDRNMIYG GP
Sbjct: 242 LPADEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVDREKIEFGAASDGDGDRNMIYGAGP 301

Query: 303 AFVSPGDSVAIIAEYANEIPYFKKQGIYGLARSFPTASAIDRVAKKHGLNCYEVPTGWKF 362
           AFVSPGDSVAIIAEYA EIPYF+KQGIYGLARSFPT+ AIDRVAK  GLNCYEVPTGWKF
Sbjct: 302 AFVSPGDSVAIIAEYAKEIPYFQKQGIYGLARSFPTSGAIDRVAKAQGLNCYEVPTGWKF 361

Query: 363 FCALFDAKKLSICGEESFGTGSNHVREKDGIWAIMAWLNILAIFNQRHPDKEASIKTIQN 422
           FCALFDAKKLSICGEESFGTGSNH+REKDG+WAI AWLNILA++N+ +P+KEASIKTIQ 
Sbjct: 362 FCALFDAKKLSICGEESFGTGSNHIREKDGVWAICAWLNILALYNKHNPEKEASIKTIQE 421

Query: 423 EFWDTYGRTFFTRYDYEKVETDKANKVIENLRQYVADSGTKGSKFPTDSALTVVDAGDFS 482
           EFW  YGRTFFTRYDYE + T+KANKV++ L ++V D  +K + FP D +LTV D GDFS
Sbjct: 422 EFWAKYGRTFFTRYDYEGITTEKANKVVDLLDKFVNDPKSKNAPFPGDESLTVSDCGDFS 481

Query: 483 YTDLDGTISSHQGLYVILSNGARFVVRLSGTGSSGATIRLYIERYTDDKSKYSLDAQEYL 542
           YTDLDG++S HQGL+V LSNGARFV+RLSGTGS+GATIRLYIE Y+DDKS Y+  A +YL
Sbjct: 482 YTDLDGSVSDHQGLFVKLSNGARFVLRLSGTGSAGATIRLYIEEYSDDKSTYTQSADQYL 541

Query: 543 KPIIKSIVQFLDLKTIL 559
           + +IKS+  FL+ K ++
Sbjct: 542 QKMIKSVTSFLNFKELI 558

>Scas_717.70
          Length = 569

 Score =  940 bits (2429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/557 (79%), Positives = 497/557 (89%)

Query: 3   QIESVPTKPYQDQKPGTSGLRKKTKVFEDQPNYVENFIQSVMEAIPEGAKGAVLVVGGDG 62
           QI++VPTKPYQDQKPGTSGLRKKTK+F+D PNY ENFIQ++M+AIPEG+KGA LVVGGDG
Sbjct: 4   QIQTVPTKPYQDQKPGTSGLRKKTKIFKDTPNYTENFIQAIMDAIPEGSKGATLVVGGDG 63

Query: 63  RYYNDVILQKIAAIGAANGVKKLVIGQNGLLSTPAASHIMRTYKEKCTGGIILTASHNPG 122
           RYYNDVIL KIAAIGAANGVKKLVIGQ GLLSTPAASHIMRTY+EK  GGIILTASHNPG
Sbjct: 64  RYYNDVILHKIAAIGAANGVKKLVIGQRGLLSTPAASHIMRTYEEKTQGGIILTASHNPG 123

Query: 123 GPENDMGIKYNLSNGGPAPEPVTNKIWEISKKLTHYKIVKDFPELDLTKLVENKKYGPLL 182
           G +NDMGIK+NLSNGGPAPEPVTNKIWEISKK+T +KI+KDFPEL+L  L +NKKYGPLL
Sbjct: 124 GIKNDMGIKFNLSNGGPAPEPVTNKIWEISKKMTSFKIIKDFPELELETLGKNKKYGPLL 183

Query: 183 VDVIDTTDAYIQLLKEIFDFELIHKFIAKQRKEKGWKLLVDSMNGVTGPYAKAIFVDEFG 242
           VDVIDTT AY++ +K+IFDF+LI KF+ KQR  K WKLL D MNGVTGPY KAIFVDE G
Sbjct: 184 VDVIDTTKAYVEFVKQIFDFDLIKKFVHKQRDTKHWKLLFDGMNGVTGPYGKAIFVDELG 243

Query: 243 LDSKEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVNKEKIEFGAASDGDGDRNMIYGYGP 302
           L + EVLQ WHP PDFGG+HPDPNLTYA  LV+RV++E IEFGAASDGDGDRNMIYG GP
Sbjct: 244 LPADEVLQQWHPSPDFGGVHPDPNLTYAKALVDRVDRENIEFGAASDGDGDRNMIYGAGP 303

Query: 303 AFVSPGDSVAIIAEYANEIPYFKKQGIYGLARSFPTASAIDRVAKKHGLNCYEVPTGWKF 362
           AFVSPGDSVAIIAEYA EIPYF KQGIYGLARSFPT+SAIDRVAK HGLNCYEVPTGWKF
Sbjct: 304 AFVSPGDSVAIIAEYAAEIPYFAKQGIYGLARSFPTSSAIDRVAKAHGLNCYEVPTGWKF 363

Query: 363 FCALFDAKKLSICGEESFGTGSNHVREKDGIWAIMAWLNILAIFNQRHPDKEASIKTIQN 422
           FCALFDAKKLSICGEESFGTGSNHVREKDGIWAI+AWLN+LAI+N+ HPD++ SIK IQ+
Sbjct: 364 FCALFDAKKLSICGEESFGTGSNHVREKDGIWAILAWLNLLAIYNKHHPDRDVSIKIIQD 423

Query: 423 EFWDTYGRTFFTRYDYEKVETDKANKVIENLRQYVADSGTKGSKFPTDSALTVVDAGDFS 482
           EFW+ YGRTFFTRYDYEKV T+ A KVI+NLR++V        KFPTD +LTVV+AGDFS
Sbjct: 424 EFWNKYGRTFFTRYDYEKVATEDAAKVIDNLRKHVESKTFVNHKFPTDESLTVVEAGDFS 483

Query: 483 YTDLDGTISSHQGLYVILSNGARFVVRLSGTGSSGATIRLYIERYTDDKSKYSLDAQEYL 542
           YTDLDG++S+HQGL+  LSNGAR VVRLSGTGSSGATIRLY+E+YTDDKS Y  +AQ YL
Sbjct: 484 YTDLDGSVSAHQGLFFKLSNGARVVVRLSGTGSSGATIRLYVEKYTDDKSVYGQNAQVYL 543

Query: 543 KPIIKSIVQFLDLKTIL 559
           KP+I+S+V+FL+ K  +
Sbjct: 544 KPVIQSVVKFLNFKEFI 560

>Scas_721.123
          Length = 569

 Score =  915 bits (2364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/557 (75%), Positives = 494/557 (88%)

Query: 3   QIESVPTKPYQDQKPGTSGLRKKTKVFEDQPNYVENFIQSVMEAIPEGAKGAVLVVGGDG 62
           QIE++ TKPYQDQKPGTSGLRKKT +F ++PNY ENFIQ++++AIPEG++ A LVVGGDG
Sbjct: 4   QIETIETKPYQDQKPGTSGLRKKTAIFMNEPNYTENFIQAMLDAIPEGSQDATLVVGGDG 63

Query: 63  RYYNDVILQKIAAIGAANGVKKLVIGQNGLLSTPAASHIMRTYKEKCTGGIILTASHNPG 122
           R+YNDVI+ KIAAI AANGVKKL+IGQNGLLSTPAASHI+R+Y+EK TGGIILTASHNPG
Sbjct: 64  RFYNDVIMNKIAAISAANGVKKLIIGQNGLLSTPAASHIIRSYEEKVTGGIILTASHNPG 123

Query: 123 GPENDMGIKYNLSNGGPAPEPVTNKIWEISKKLTHYKIVKDFPELDLTKLVENKKYGPLL 182
           GPEND+GIKYNL+NGGPAPE VTN IWE+SKKLTHYKI+K+FP LDL+K+ +++KYGPLL
Sbjct: 124 GPENDLGIKYNLANGGPAPESVTNAIWEVSKKLTHYKIIKNFPPLDLSKMGKDQKYGPLL 183

Query: 183 VDVIDTTDAYIQLLKEIFDFELIHKFIAKQRKEKGWKLLVDSMNGVTGPYAKAIFVDEFG 242
           VD+ID T  Y+  LKEIFDFELI KFI KQR+ K WKLL DS+NG+TGPY KAIFVDEF 
Sbjct: 184 VDIIDVTKDYVDFLKEIFDFELIKKFIHKQRETKNWKLLFDSLNGITGPYGKAIFVDEFD 243

Query: 243 LDSKEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVNKEKIEFGAASDGDGDRNMIYGYGP 302
           L + EVLQNWHP+PDFGGLHPDPNLTYA TLVERV++EKIEFGAASDGDGDRNMIYG GP
Sbjct: 244 LPANEVLQNWHPKPDFGGLHPDPNLTYAKTLVERVDREKIEFGAASDGDGDRNMIYGAGP 303

Query: 303 AFVSPGDSVAIIAEYANEIPYFKKQGIYGLARSFPTASAIDRVAKKHGLNCYEVPTGWKF 362
           AFVSPGDSVAIIAEYA+EIPYF KQGIYGLARSFPT++AIDRVAK HGL+CYEVPTGWKF
Sbjct: 304 AFVSPGDSVAIIAEYASEIPYFVKQGIYGLARSFPTSAAIDRVAKAHGLSCYEVPTGWKF 363

Query: 363 FCALFDAKKLSICGEESFGTGSNHVREKDGIWAIMAWLNILAIFNQRHPDKEASIKTIQN 422
           FCALFDAKKLSICGEESFGTGSNH+REKDG+WAI+AWLN+LAI+N+ +P+K+ASIKTIQ 
Sbjct: 364 FCALFDAKKLSICGEESFGTGSNHIREKDGLWAIVAWLNVLAIYNKHNPEKDASIKTIQE 423

Query: 423 EFWDTYGRTFFTRYDYEKVETDKANKVIENLRQYVADSGTKGSKFPTDSALTVVDAGDFS 482
           EFW+ YGRTFFTRYDYE +  + A+KV++ L  +V+     GS FP D +LTVVDAGDFS
Sbjct: 424 EFWNKYGRTFFTRYDYEHISNEDASKVVDLLNNFVSKPNVIGSAFPGDESLTVVDAGDFS 483

Query: 483 YTDLDGTISSHQGLYVILSNGARFVVRLSGTGSSGATIRLYIERYTDDKSKYSLDAQEYL 542
           YTDLDG++S HQGL+  LSNGAR V+RLSGTGSSGATIR+Y+E YTDDK+KY   AQ++L
Sbjct: 484 YTDLDGSVSDHQGLFFKLSNGARIVLRLSGTGSSGATIRIYVENYTDDKTKYEESAQDFL 543

Query: 543 KPIIKSIVQFLDLKTIL 559
            P IK++V+FL  K  +
Sbjct: 544 APTIKTVVKFLKFKEFI 560

>YKL127W (PGM1) [3139] chr11 (203187..204899) Phosphoglucomutase,
           minor isoform, interconverts Glc-1-P and Glc-6-P [1713
           bp, 570 aa]
          Length = 570

 Score =  907 bits (2344), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/557 (76%), Positives = 490/557 (87%), Gaps = 1/557 (0%)

Query: 4   IESVPTKPYQDQKPGTSGLRKKTKVFEDQPNYVENFIQSVMEAIPEGAKGAVLVVGGDGR 63
           I+SVPT  Y+DQKPGTSGLRKKTKVF D+P+Y ENFIQ+ M++IP G++G  LVVGGDGR
Sbjct: 5   IDSVPTVAYKDQKPGTSGLRKKTKVFMDEPHYTENFIQATMQSIPNGSEGTTLVVGGDGR 64

Query: 64  YYNDVILQKIAAIGAANGVKKLVIGQNGLLSTPAASHIMRTYKEKCTGG-IILTASHNPG 122
           +YNDVI+ KIAA+GAANGV+KLVIGQ GLLSTPAASHI+RTY+EKCTGG IILTASHNPG
Sbjct: 65  FYNDVIMNKIAAVGAANGVRKLVIGQGGLLSTPAASHIIRTYEEKCTGGGIILTASHNPG 124

Query: 123 GPENDMGIKYNLSNGGPAPEPVTNKIWEISKKLTHYKIVKDFPELDLTKLVENKKYGPLL 182
           GPEND+GIKYNL NGGPAPE VTN IWE SKKLTHYKI+K+FP+L+L KL +N+KYGPLL
Sbjct: 125 GPENDLGIKYNLPNGGPAPESVTNAIWEASKKLTHYKIIKNFPKLNLNKLGKNQKYGPLL 184

Query: 183 VDVIDTTDAYIQLLKEIFDFELIHKFIAKQRKEKGWKLLVDSMNGVTGPYAKAIFVDEFG 242
           VD+ID   AY+Q LKEIFDF+LI  F+AKQRK+KGWKLL DS+NG+TGPY KAIFVDEFG
Sbjct: 185 VDIIDPAKAYVQFLKEIFDFDLIKSFLAKQRKDKGWKLLFDSLNGITGPYGKAIFVDEFG 244

Query: 243 LDSKEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVNKEKIEFGAASDGDGDRNMIYGYGP 302
           L ++EVLQNWHP PDFGGLHPDPNLTYA TLV+RV++EKI FGAASDGDGDRNMIYGYGP
Sbjct: 245 LPAEEVLQNWHPLPDFGGLHPDPNLTYARTLVDRVDREKIAFGAASDGDGDRNMIYGYGP 304

Query: 303 AFVSPGDSVAIIAEYANEIPYFKKQGIYGLARSFPTASAIDRVAKKHGLNCYEVPTGWKF 362
           AFVSPGDSVAIIAEYA EIPYF KQGIYGLARSFPT+SAIDRVA K GL CYEVPTGWKF
Sbjct: 305 AFVSPGDSVAIIAEYAPEIPYFAKQGIYGLARSFPTSSAIDRVAAKKGLRCYEVPTGWKF 364

Query: 363 FCALFDAKKLSICGEESFGTGSNHVREKDGIWAIMAWLNILAIFNQRHPDKEASIKTIQN 422
           FCALFDAKKLSICGEESFGTGSNH+REKDG+WAI+AWLNILAI+++R+P+KEASIKTIQ+
Sbjct: 365 FCALFDAKKLSICGEESFGTGSNHIREKDGLWAIIAWLNILAIYHRRNPEKEASIKTIQD 424

Query: 423 EFWDTYGRTFFTRYDYEKVETDKANKVIENLRQYVADSGTKGSKFPTDSALTVVDAGDFS 482
           EFW+ YGRTFFTRYDYE +E ++A KV+  L ++V+     GS FP D +LTV+D GDFS
Sbjct: 425 EFWNEYGRTFFTRYDYEHIECEQAEKVVALLSEFVSRPNVCGSHFPADESLTVIDCGDFS 484

Query: 483 YTDLDGTISSHQGLYVILSNGARFVVRLSGTGSSGATIRLYIERYTDDKSKYSLDAQEYL 542
           Y DLDG+IS +QGL+V  SNG +FV+RLSGTGSSGATIRLY+E+YTD K  Y   A  +L
Sbjct: 485 YRDLDGSISENQGLFVKFSNGTKFVLRLSGTGSSGATIRLYVEKYTDKKENYGQTADVFL 544

Query: 543 KPIIKSIVQFLDLKTIL 559
           KP+I SIV+FL  K IL
Sbjct: 545 KPVINSIVKFLRFKEIL 561

>Sklu_2430.4 YMR105C, Contig c2430 6115-7830
          Length = 571

 Score =  886 bits (2290), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/559 (75%), Positives = 494/559 (88%), Gaps = 2/559 (0%)

Query: 3   QIESVPTKPYQDQKPGTSGLRKKTKVFEDQPNYVENFIQSVMEAIPEGAKGAVLVVGGDG 62
           +IE++PT PY DQKPGTSGLRKKTKVF ++PNY ENFIQ+VM+AIPEG++ A LVVGGDG
Sbjct: 4   KIETIPTTPYTDQKPGTSGLRKKTKVFMEEPNYTENFIQAVMDAIPEGSQDATLVVGGDG 63

Query: 63  RYYNDVILQKIAAIGAANGVKKLVIGQNGLLSTPAASHIMRTYKE-KCTGGIILTASHNP 121
           R+YNDV++QKIAAIGAANGV KLVIGQNG+LSTPAASHI+RTY   K TGGIILTASHNP
Sbjct: 64  RFYNDVVVQKIAAIGAANGVHKLVIGQNGILSTPAASHIIRTYPHAKITGGIILTASHNP 123

Query: 122 GGPENDMGIKYNLSNGGPAPEPVTNKIWEISKKLTHYKIVKDFPELDLTKLVENKKYGPL 181
           GG +ND GIKYNLSNGGPAPE VTNKI+E SK+LT YKIV +FP+LDL+K   +++YGPL
Sbjct: 124 GGAKNDFGIKYNLSNGGPAPESVTNKIFEKSKQLTSYKIVANFPQLDLSKKGTDQRYGPL 183

Query: 182 LVDVIDTTDAYIQLLKEIFDFELIHKFIAKQRKEKGWKLLVDSMNGVTGPYAKAIFVDEF 241
           LVD+ID+T+AY++L+K IFDF+LI KFI  Q++  G+KLL DS+NGVTGPY KA+FVDE 
Sbjct: 184 LVDIIDSTEAYVKLMKSIFDFDLIKKFIKTQKETVGFKLLFDSLNGVTGPYGKALFVDEL 243

Query: 242 GLDSKEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVNKEKIEFGAASDGDGDRNMIYGYG 301
           GL ++E LQN+ P+PDFGGLHPDPNLTYAHTLVERV+K+KI FGAASDGDGDRNMIYGYG
Sbjct: 244 GLSAEESLQNYVPKPDFGGLHPDPNLTYAHTLVERVDKDKIAFGAASDGDGDRNMIYGYG 303

Query: 302 PAFVSPGDSVAIIAEYANEIPYFKKQGIYGLARSFPTASAIDRVAKKHGLNCYEVPTGWK 361
           PAFVSPGDSVAIIAEYA+EIPYF KQGIYGLARSFPT++AIDRVAK HGLNCYEVPTGWK
Sbjct: 304 PAFVSPGDSVAIIAEYASEIPYFAKQGIYGLARSFPTSAAIDRVAKAHGLNCYEVPTGWK 363

Query: 362 FFCALFDAKKLSICGEESFGTGSNHVREKDGIWAIMAWLNILAIFNQRHPDKEASIKTIQ 421
           FFCALFDAKKLSICGEESFGTGSNHVREKDG+WAIMAWLNILAI+N+++P KEASIKTIQ
Sbjct: 364 FFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNRKNPTKEASIKTIQ 423

Query: 422 NEFWDTYGRTFFTRYDYEKVETDKANKVIENLRQYVADSGTKGSK-FPTDSALTVVDAGD 480
            EFW+ YGRTFFTRYD+E++ ++ A+KVI+ L  +V+   +  +K FP  + LTVVDAGD
Sbjct: 424 EEFWNKYGRTFFTRYDFEQIASENADKVIQLLHNFVSKKDSVVNKAFPAATDLTVVDAGD 483

Query: 481 FSYTDLDGTISSHQGLYVILSNGARFVVRLSGTGSSGATIRLYIERYTDDKSKYSLDAQE 540
           FSYTDLDG++SS+QGL+V LSNG +FVVRLSGTGSSGATIRLY+ERY+D+KS YSL A +
Sbjct: 484 FSYTDLDGSVSSNQGLFVKLSNGCKFVVRLSGTGSSGATIRLYVERYSDNKSDYSLTADQ 543

Query: 541 YLKPIIKSIVQFLDLKTIL 559
           +L   IK ++QFL  K  L
Sbjct: 544 FLGNDIKHVLQFLKFKEFL 562

>KLLA0B12694g 1107696..1109402 highly similar to sp|P37012
           Saccharomyces cerevisiae YMR105c PGM2
           phosphoglucomutase, major isoform, start by similarity
          Length = 568

 Score =  884 bits (2283), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/552 (75%), Positives = 482/552 (87%), Gaps = 3/552 (0%)

Query: 6   SVPTKPYQDQKPGTSGLRKKTKVFEDQPNYVENFIQSVMEAIPEGAKGAVLVVGGDGRYY 65
           SV T PY DQKPGTSGLRKKTKVFE+ PNY ENFIQ++MEAIPEG++GA LV+GGDGRYY
Sbjct: 7   SVATNPYPDQKPGTSGLRKKTKVFEETPNYTENFIQAIMEAIPEGSQGATLVIGGDGRYY 66

Query: 66  NDVILQKIAAIGAANGVKKLVIGQNGLLSTPAASHIMRTYKEKCTGGIILTASHNPGGPE 125
           NDV++QKIAAIG+ANGV+K+VIG NG+LSTPAASHI+R Y EKCTGGIILTASHNPGGP 
Sbjct: 67  NDVVIQKIAAIGSANGVRKIVIGHNGILSTPAASHIIRAYHEKCTGGIILTASHNPGGPT 126

Query: 126 NDMGIKYNLSNGGPAPEPVTNKIWEISKKLTHYKIVKDFPELDLTKLVENKKYGPLLVDV 185
           ND GIKYNL+NGGPAPE VTN IW  S++LTHYKIV+ FP +DLTK+ +++KYG LLVD+
Sbjct: 127 NDFGIKYNLANGGPAPESVTNSIWHKSRELTHYKIVESFPAIDLTKIGQDQKYGDLLVDI 186

Query: 186 IDTTDAYIQLLKEIFDFELIHKFIAKQRKEKGWKLLVDSMNGVTGPYAKAIFVDEFGLDS 245
           +D+T AY++L+KEIFDF LI  FI  Q K  G+K+L D+MNGVTGPY +A+FV E GL  
Sbjct: 187 VDSTAAYVELMKEIFDFPLIKSFIDTQAK-NGFKILFDAMNGVTGPYGEALFVKELGL-P 244

Query: 246 KEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVNKEKIEFGAASDGDGDRNMIYGYGPAFV 305
           +  LQN+HP+PDFGGLHPDPNLTYAHTLVERV+K  I+FGAASDGDGDRNMIYG GPAFV
Sbjct: 245 ESSLQNYHPKPDFGGLHPDPNLTYAHTLVERVDKYGIQFGAASDGDGDRNMIYGAGPAFV 304

Query: 306 SPGDSVAIIAEYANEIPYFKKQGIYGLARSFPTASAIDRVAKKHGLNCYEVPTGWKFFCA 365
           SPGDSVAIIAEYA+ IPYFKKQGIYGLARSFPT+SAIDRVAK+ GLNCYEVPTGWKFFCA
Sbjct: 305 SPGDSVAIIAEYASAIPYFKKQGIYGLARSFPTSSAIDRVAKEQGLNCYEVPTGWKFFCA 364

Query: 366 LFDAKKLSICGEESFGTGSNHVREKDGIWAIMAWLNILAIFNQRHPDKEASIKTIQNEFW 425
           LFDAKKLSICGEESFGTGSNHVREKDG+WAIMAWLNILAI+NQR P+KEASIK+IQ +FW
Sbjct: 365 LFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNQRFPNKEASIKSIQTDFW 424

Query: 426 DTYGRTFFTRYDYEKVETDKANKVIENLRQYVAD-SGTKGSKFPTDSALTVVDAGDFSYT 484
             YGRTFFTRYD+E + ++ A KVI  L+ YVAD    KG+KFP D +LTVV+ GDFSYT
Sbjct: 425 QKYGRTFFTRYDFENLSSEDAGKVILLLQNYVADPESIKGTKFPADDSLTVVEGGDFSYT 484

Query: 485 DLDGTISSHQGLYVILSNGARFVVRLSGTGSSGATIRLYIERYTDDKSKYSLDAQEYLKP 544
           DLDG++SSHQGLYV LSNG RFVVRLSGTGSSGATIRLY+ERYT+D SKY   A+E+L  
Sbjct: 485 DLDGSVSSHQGLYVRLSNGVRFVVRLSGTGSSGATIRLYVERYTNDGSKYEQTAEEFLGK 544

Query: 545 IIKSIVQFLDLK 556
            IK+I++FL  K
Sbjct: 545 DIKTILKFLKFK 556

>Kwal_26.7628
          Length = 570

 Score =  877 bits (2267), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/551 (74%), Positives = 483/551 (87%), Gaps = 1/551 (0%)

Query: 4   IESVPTKPYQDQKPGTSGLRKKTKVFEDQPNYVENFIQSVMEAIPEGAKGAVLVVGGDGR 63
           IESVPTKP+ DQKPGTSGLRKKTKVF+D+P+Y ENFIQ+++EAIPEG++ A LVVGGDGR
Sbjct: 5   IESVPTKPFDDQKPGTSGLRKKTKVFKDEPHYTENFIQAILEAIPEGSENATLVVGGDGR 64

Query: 64  YYNDVILQKIAAIGAANGVKKLVIGQNGLLSTPAASHIMRTYKEKCTGGIILTASHNPGG 123
           YYN+ ++Q I AI AANGV+K+++GQNG+LSTPAASHI+R+Y EKCTGGIILTASHNPGG
Sbjct: 65  YYNNEVMQIIGAIAAANGVRKMILGQNGILSTPAASHIIRSYPEKCTGGIILTASHNPGG 124

Query: 124 PENDMGIKYNLSNGGPAPEPVTNKIWEISKKLTHYKIVKDFPELDLTKLVENKKYGPLLV 183
           PEND GIKYNLSNGGPAPE VTN I+E SK+LTHYKIVK+FP++D +K+ +++KYGPLLV
Sbjct: 125 PENDFGIKYNLSNGGPAPESVTNAIFEKSKQLTHYKIVKNFPKIDFSKIGKDQKYGPLLV 184

Query: 184 DVIDTTDAYIQLLKEIFDFELIHKFIAKQRKEKGWKLLVDSMNGVTGPYAKAIFVDEFGL 243
           DV+D+T  Y+ L+KEIFDF+LI KFI  QR  KG+K+L DS+NGVTGPY +AIFV E GL
Sbjct: 185 DVVDSTADYVALMKEIFDFDLIKKFIDNQRSTKGFKILFDSLNGVTGPYGEAIFVKELGL 244

Query: 244 DSKEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVNKEKIEFGAASDGDGDRNMIYGYGPA 303
            ++EVLQN+ P+PDFGGLHPDPNLTYAHTLVERV+KE+I FGAASDGDGDRNMIYG GPA
Sbjct: 245 PAEEVLQNYVPKPDFGGLHPDPNLTYAHTLVERVDKEQIAFGAASDGDGDRNMIYGCGPA 304

Query: 304 FVSPGDSVAIIAEYANEIPYFKKQGIYGLARSFPTASAIDRVAKKHGLNCYEVPTGWKFF 363
           FVSPGDSVAIIAEYA+EIPYFKKQGIYGLARSFPT++AIDRVAK+ GL CYEVPTGWKFF
Sbjct: 305 FVSPGDSVAIIAEYASEIPYFKKQGIYGLARSFPTSAAIDRVAKEQGLACYEVPTGWKFF 364

Query: 364 CALFDAKKLSICGEESFGTGSNHVREKDGIWAIMAWLNILAIFNQRHPDKEASIKTIQNE 423
           CALFDAKKLSICGEESFGTGSNHVREKDG+WAI+AWLNILAI+N+ HPD + SIK IQ +
Sbjct: 365 CALFDAKKLSICGEESFGTGSNHVREKDGVWAIVAWLNILAIYNRDHPDSDVSIKVIQEK 424

Query: 424 FWDTYGRTFFTRYDYEKVETDKANKVIENLRQYVADSGTK-GSKFPTDSALTVVDAGDFS 482
           FW  YGRTFFTRYD+E+V ++ A +V++ L   VA   +  G  F  + ALTV D GDFS
Sbjct: 425 FWAKYGRTFFTRYDFEQVSSESAAQVLQVLEDLVAAKDSSVGKPFAGNPALTVADCGDFS 484

Query: 483 YTDLDGTISSHQGLYVILSNGARFVVRLSGTGSSGATIRLYIERYTDDKSKYSLDAQEYL 542
           YTDLDG++S HQGLY  LSNG RFVVRLSGTGSSGATIRLY+E+YTDD SKYSLD +++L
Sbjct: 485 YTDLDGSVSEHQGLYAKLSNGCRFVVRLSGTGSSGATIRLYVEKYTDDASKYSLDVEQFL 544

Query: 543 KPIIKSIVQFL 553
              IKSI++FL
Sbjct: 545 GDDIKSILKFL 555

>ABL029W [563] [Homologous to ScYKL127W (PGM1) - SH; ScYMR105C
           (PGM2) - SH] complement(343852..345558) [1707 bp, 568
           aa]
          Length = 568

 Score =  838 bits (2166), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/556 (70%), Positives = 473/556 (85%), Gaps = 1/556 (0%)

Query: 4   IESVPTKPYQDQKPGTSGLRKKTKVFEDQPNYVENFIQSVMEAIPEGAKGAVLVVGGDGR 63
           IESVPTK + DQKPGTSGLRKKTKVFE   +Y ENFIQ++ME+IPEG++ AVLV+GGDGR
Sbjct: 5   IESVPTKAFADQKPGTSGLRKKTKVFEQTEHYTENFIQAIMESIPEGSENAVLVIGGDGR 64

Query: 64  YYNDVILQKIAAIGAANGVKKLVIGQNGLLSTPAASHIMRTYKEKCTGGIILTASHNPGG 123
           YYND ++QKIA +G+ANGV+KL+IGQNGLLSTPAASHI+RTY +K TGGIILTASHNPGG
Sbjct: 65  YYNDAVMQKIAEVGSANGVRKLIIGQNGLLSTPAASHIIRTYHDKVTGGIILTASHNPGG 124

Query: 124 PENDMGIKYNLSNGGPAPEPVTNKIWEISKKLTHYKIVKDFPELDLTKLVENKKYGPLLV 183
           P+ND GIKYNL+NG PAPE VTN ++E S+ LTHYKI +  P+LDL K+ EN++YG LLV
Sbjct: 125 PDNDFGIKYNLANGAPAPEKVTNSMFERSRNLTHYKITRGMPKLDLGKIGENQQYGNLLV 184

Query: 184 DVIDTTDAYIQLLKEIFDFELIHKFIAKQRKEKGWKLLVDSMNGVTGPYAKAIFVDEFGL 243
           DVID T+AY++L+KEIFDF LI KF+   +KE G K+L D++NG+TGPY KAIFVDE GL
Sbjct: 185 DVIDPTEAYVRLMKEIFDFPLIKKFLEHAQKEYGLKVLFDALNGITGPYGKAIFVDELGL 244

Query: 244 DSKEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVNKEKIEFGAASDGDGDRNMIYGYGPA 303
            S++ LQN+ P+PDFGGLHPDPNLTYAHTLV RV++E I FGAASDGDGDRNMIYG GPA
Sbjct: 245 -SEDSLQNFVPKPDFGGLHPDPNLTYAHTLVSRVDRENIAFGAASDGDGDRNMIYGAGPA 303

Query: 304 FVSPGDSVAIIAEYANEIPYFKKQGIYGLARSFPTASAIDRVAKKHGLNCYEVPTGWKFF 363
           FVSPGDSVAIIAEYA+EIPYF K GI+GLARSFPT+ AID VAK+  L+CYEVPTGWKFF
Sbjct: 304 FVSPGDSVAIIAEYASEIPYFIKNGIHGLARSFPTSGAIDLVAKEKNLDCYEVPTGWKFF 363

Query: 364 CALFDAKKLSICGEESFGTGSNHVREKDGIWAIMAWLNILAIFNQRHPDKEASIKTIQNE 423
           C LFD+KKLSICGEESFGTGS+HVREKDG+WAI+AWLN+LAI+++RHPD+E SIKTIQ E
Sbjct: 364 CNLFDSKKLSICGEESFGTGSDHVREKDGLWAIVAWLNVLAIYHRRHPDREPSIKTIQEE 423

Query: 424 FWDTYGRTFFTRYDYEKVETDKANKVIENLRQYVADSGTKGSKFPTDSALTVVDAGDFSY 483
           FW  YGRTFFTRYD+E+ +T+ ANKVIE LR +  +    G  FP    ++V  AGDFSY
Sbjct: 424 FWAKYGRTFFTRYDFEECDTEDANKVIELLRTFAENPAVVGQPFPAWHEVSVSAAGDFSY 483

Query: 484 TDLDGTISSHQGLYVILSNGARFVVRLSGTGSSGATIRLYIERYTDDKSKYSLDAQEYLK 543
           TDLDG++S HQGLY+ LSNG R+VVRLSGTGSSGATIRLY+ERYT+D + Y+  A ++L 
Sbjct: 484 TDLDGSVSEHQGLYIKLSNGTRYVVRLSGTGSSGATIRLYVERYTNDPAYYAQTADQFLA 543

Query: 544 PIIKSIVQFLDLKTIL 559
           P IK++++FL  K ++
Sbjct: 544 PDIKAVLKFLRFKDLI 559

>CAGL0M02981g 335863..337716 similar to sp|Q03262 Saccharomyces
           cerevisiae YMR278w, hypothetical start
          Length = 617

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 124/554 (22%), Positives = 218/554 (39%), Gaps = 86/554 (15%)

Query: 18  GTSGLRKKTKVFEDQPNYV------ENFIQSVMEAIPEGAKGAVLVVGGDGRYYNDVILQ 71
           GT+GLR + +   ++ N +      +     + +  P+       VVG D RY++    Q
Sbjct: 53  GTAGLRARMEAGTNRLNKLVILQASQGLATYIKDKFPQNLTA---VVGHDHRYHSQEFAQ 109

Query: 72  KIAAIGAANGVKKLVIG-QNGLLSTPAASHIMRTYKEKCTGGIILTASHNPGGPENDMGI 130
             AA     G K   +   +  + TP   + +       + G+++TASHN   P+ D G 
Sbjct: 110 VTAATFIRAGFKVYYLNPHDEFVHTPMVPYSVDHLN--ASVGVMITASHN---PKMDNGY 164

Query: 131 KYNLSNGGPAPEPVTNKIWE-ISKKLTHYKIVKDFPELDLTKLVENKKYGPLLVDVIDTT 189
           K   +NG     P  + I E I+  L  +       + + TK++ N +           T
Sbjct: 165 KVYYTNGCQIIPPHDHGIAETINNNLEPWST-----DWNFTKILSNAE-----------T 208

Query: 190 DAYIQLLKEIFDFELIHKFIAK--QR-----KEKGWKLLVDSMNGVTGPYAKAIFVDEFG 242
           D  I+ +++      ++  + +  QR      EK W  +   M+GV       I  +   
Sbjct: 209 DGKIEYVRKRMLTSYLNSVVNQLIQRDFAAPDEKPW-FVYTPMHGVGHQIFSTILNESLN 267

Query: 243 L----DSKEVLQNWHPQPDFGGLH-PDPN----LTYAHTLVERVNKEKIEFGAASDGDGD 293
           L    D   V +   P P F  +  P+P     L  A TL E      I+   A+D + D
Sbjct: 268 LKDNIDYITVPEQKDPDPSFRTVSFPNPEEKGALNLAITLAE---ANGIKLVLANDPNAD 324

Query: 294 RNMIYGYGPAFVS----PGDSVAIIAEYANEIPYFKK---QGI----YGLARSFPTASAI 342
           R  +     +        G+ + ++  +  E   ++K   +GI      +  S  +A  I
Sbjct: 325 RFSVAVRDDSKNEWKQLTGNEIGLLFAFY-EFKMYQKAADKGIKNKPLAMLNSTVSAQVI 383

Query: 343 DRVAKKHGLNCYEVPTGWKFFCALFDAKKLSICG-------EESFGTGSNHV-REKDGIW 394
            R+A+K G    +  TG+K+     +A KL   G       EE+ G     +  +KDG+ 
Sbjct: 384 KRMAEKEGFLYKDTLTGFKWIGN--EAAKLEEKGYFVPFGYEEAIGYMFPAMEHDKDGVS 441

Query: 395 AIMAWLNILAIFNQRHPDKEASIKTIQNEFWDTYGRTFFTRYDYEKVETDKANKVIENLR 454
           A + +L   A + Q      ++   I +E +D YG +      Y   +  K +KV E++R
Sbjct: 442 AAIVFLQAYANWLQ----SSSNPIDIIHECYDKYGVSAEYNGYYIVSDPSKTDKVFESIR 497

Query: 455 QYVADSGTKGSKFPTD--SALTVVDAGDFSYTDLDGTISSHQGLYVILSNGARFVVRL-- 510
              +   + G  FP        V +  D +    D T +  + L  +  N     +    
Sbjct: 498 ---SSYTSMGLSFPESIGEHFRVTEFRDLT-IGFDSTTADKKPLLPVDKNSQMITITAVP 553

Query: 511 SGTGSSGATIRLYI 524
           SG  ++G ++R  I
Sbjct: 554 SGASNTGESVRFTI 567

>YMR278W (YMR278W) [4232] chr13 (822762..824630) Protein containing
           a phosphoglucomutase or phosphomannomutase
           alpha-beta-alpha domain I, has high similarity to
           uncharacterized C. albicans Orf6.8892p [1869 bp, 622 aa]
          Length = 622

 Score = 37.7 bits (86), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 75/296 (25%), Positives = 121/296 (40%), Gaps = 40/296 (13%)

Query: 18  GTSGLRKKTKVFEDQPNYV------ENFIQSVMEAIPEGAKGAVLVVGGDGRYYNDVILQ 71
           GT+GLR + +    + N +      +     V +  P+     V VVG D R+++    +
Sbjct: 56  GTAGLRSQMQAGFSRMNTLVVIQASQGLATYVRQQFPDNL---VAVVGHDHRFHSKEFAR 112

Query: 72  KIAAIGAANGVKKLVIG-QNGLLSTPAASHIMRTYKEKCTGGIILTASHNPGGPENDMGI 130
             AA     G K   +   +  + TP     +   K K + G+++TASHN   P+ D G 
Sbjct: 113 ATAAAFLLKGFKVHYLNPDHEFVHTPLVPFAVD--KLKASVGVMITASHN---PKMDNGY 167

Query: 131 KYNLSNGGPAPEPVTNKIWE-ISKKLTHYKIVKDFPELDLTKLVENKKYGPLLVDVIDTT 189
           K   SNG     P  + I + I   L  +  V DF ++    L +  K G L+    +  
Sbjct: 168 KVYYSNGCQIIPPHDHAISDSIDANLEPWANVWDFDDV----LNKALKQGKLMYSREEML 223

Query: 190 DAYIQL----LKEIFDFELIHKFIAKQRKEKGWKLLVDSMNGV-----TGPYAKAIFVDE 240
             Y++     L EI   +L       + K K W  +   M+GV     +    K + + E
Sbjct: 224 KLYLEEVSKNLVEINPLKL-------EVKAKPW-FVYTPMHGVGFDIFSTIVKKTLCLVE 275

Query: 241 FGLDSKEVLQNWHPQPDFGGL-HPDPNLTYAHTL-VERVNKEKIEFGAASDGDGDR 294
            G D   V +  +P P F  +  P+P    A  + +    K  I+   A+D D DR
Sbjct: 276 -GKDYLCVPEQQNPDPSFPTVGFPNPEEKGALDIGINLAEKHDIDLLVANDPDADR 330

>Sklu_1994.2 YMR278W, Contig c1994 3654-5528
          Length = 624

 Score = 37.7 bits (86), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 130/578 (22%), Positives = 221/578 (38%), Gaps = 84/578 (14%)

Query: 18  GTSGLRKKTKVFEDQPNYV------ENFIQSVMEAIPEGAKGAVLVVGGDGRYYNDVILQ 71
           GT+GLR + +    + N +      +     +    PE      ++VG D RY+++   +
Sbjct: 55  GTAGLRSRMEAGFSRMNTLTVLQASQGLASYIKSQFPENLS---VIVGHDHRYHSNEFAR 111

Query: 72  KIAAIGAANGVKKLVIGQNGLLSTPAASHI----MRTYKEKCTGGIILTASHNPGGPEND 127
                    G K   +  +   ST    H         +   + GI++TASHN   P+ D
Sbjct: 112 VTVTAFLQLGFKVYYLNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHN---PKMD 168

Query: 128 MGIKYNLSNGGPAPEPVTNKIWE-ISKKLTHYKIVKDFPELDLTKLVENKKYGPLLVDVI 186
            G K   SNG     P    I E I + L  +    D  E+  T +         L DV 
Sbjct: 169 NGYKVYYSNGCQIIPPHDRLISETIDQNLVPWNKAWDCDEVIKTAIESG-----FLFDVK 223

Query: 187 D-TTDAYIQLLKEIFDFELIHKFIAKQRKEKGWKLLVDSMNGVTGPYAKAIFVDEFGLDS 245
           +  T  YI+ + +    EL+   +     +K W  +   M+GV     + I +   GL  
Sbjct: 224 EKVTSKYIKTVSD----ELVR--VPMLDCDKPW-FVYTPMHGVGFEIFEQIALLALGLKE 276

Query: 246 KE----VLQNWHPQPDFGGLH-PDPNLTYAHTL-VERVNKEKIEFGAASDGDGDR-NMIY 298
            +    V +   P P F  +  P+P    A  L +    ++ I    A+D D DR ++  
Sbjct: 277 GKHYVCVPEQRCPDPAFPTVSFPNPEEKGALDLSIALAEEQDIRLVIANDPDADRFSVAV 336

Query: 299 GYGPAFVS-PGDSVAIIAEYANEIPY------FKKQGIYGLARSFPTASAIDRVAKKHGL 351
             G  +    G+ +  +  Y     Y      FKKQ    +  S  ++  I  +A+    
Sbjct: 337 KNGDRWSQLTGNEIGFLFAYYQWQDYQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKF 396

Query: 352 NCYEVPTGWKF-----FCALFDAKKLSICGEESFGTGSNHV-REKDGIWAIMAWLNILAI 405
           +  +  TG+K+     F        +    EE+ G     V  +KDGI A + +L +   
Sbjct: 397 HYEDTLTGFKWLGNRAFELETQGYYVPFAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCE 456

Query: 406 FNQRHPDKEASIKTIQNEFWDTYGRTFFTRYD--YEKVETDKANKVIENLRQYVADSGTK 463
           +  +  D+   ++ + +E +  YG   F  Y+  Y         +V + +R+   D    
Sbjct: 457 WLSK--DRMTPLQVL-DEGFGKYG--VFKEYNGYYIVPRLSLTKEVFDYIRE---DYTPS 508

Query: 464 GSKFP--TDSALTVVDAGDFSYTDLDGTI---------SSHQGLYVIL--SNG------- 503
           G  +P    S  +V+   D +      TI         +S Q +   L  SNG       
Sbjct: 509 GHAYPPAIGSEFSVISFRDLTTGYQSDTIDNVPNLPVDASSQMITATLRPSNGKESTSGE 568

Query: 504 -ARFVVRLSGTGSSGATIRLYIERYTDDKSKYSLDAQE 540
             RF +R SGT      +++YIE  + D+ +    A+E
Sbjct: 569 QVRFTIRGSGTEPK---LKVYIEAKSTDEKRAQHLARE 603

>Scas_696.42
          Length = 625

 Score = 37.4 bits (85), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 84/375 (22%), Positives = 142/375 (37%), Gaps = 52/375 (13%)

Query: 18  GTSGLRKKTKVFEDQPNYV------ENFIQSVMEAIPEGAKGAVLVVGGDGRYYNDVILQ 71
           GT+GLR + +    + N +      +     + E  P        VVG D R+++     
Sbjct: 58  GTAGLRSRMEAGFSRMNSLIILQSTQGLANYIKEQFPNNLTA---VVGHDHRFHSKEFAI 114

Query: 72  KIAAIGAANGVKKLVIG-QNGLLSTPAASHIMRTYKEKCTGGIILTASHNPGGPENDMGI 130
             A+I    G K   +   +  + TP           K + G+++TASHN   P+ D G 
Sbjct: 115 VTASIFLRAGFKVFYLTPDDQFVHTPLVP--FSVLNLKASVGVMITASHN---PKMDNGY 169

Query: 131 KYNLSNGGPAPEPVTNKIWE-ISKKLTHYKIVKDFPELDLTKLVENKKYGPLLVDVID-T 188
           K    N      P    I E I K L  +    D+ +    K +E  K    LV + D  
Sbjct: 170 KVYYDNACQIIPPHDKNIAEMIQKNLEPWSTSWDW-DATFKKGLETNK----LVFIKDLM 224

Query: 189 TDAYIQLLKEIFDFELIHKFIAKQRKEKGWKLLVDSMNGVTGPYAKAIFVDEFGL----D 244
           T+ Y+  +K +    LIH      +  K    +   M+GV       +  +   L    D
Sbjct: 225 TEKYLMQMKRV----LIHSSHLSLKDVKTPFFVYTPMHGVGAEIFAKVSSELLNLHENVD 280

Query: 245 SKEVLQNWHPQPDFGGLH-PDPNLTYAHTLVERVNKEK-IEFGAASDGDGDRNMIYGYGP 302
              V +   P P F  +  P+P    A +L  ++ +E  +    A+D D DR     +  
Sbjct: 281 YLVVSEQRLPDPSFPTVSFPNPEEKGALSLAIKLAQENGLSLVIANDPDADR-----FSA 335

Query: 303 AFVS---------PGDSVAIIAEYANEIPY------FKKQGIYGLARSFPTASAIDRVAK 347
           A ++          G+ +  +  Y     Y      F+K     +  S  ++  I R+A 
Sbjct: 336 AVLNKKTGKWRQLTGNEIGFLLGYYEFQLYEQQDVAFRKTHPLAMINSTVSSQMIKRMAD 395

Query: 348 KHGLNCYEVPTGWKF 362
            +G +  +  TG+K+
Sbjct: 396 MNGFHYEDTLTGFKW 410

>Kwal_27.10258
          Length = 620

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 97/421 (23%), Positives = 164/421 (38%), Gaps = 56/421 (13%)

Query: 18  GTSGLRKKTKVFEDQPNYV------ENFIQSVMEAIPEGAKGAVLVVGGDGRYYNDVILQ 71
           GT+GLR K +    + N +      +   + + E  PE      + VG D R+ +    +
Sbjct: 55  GTAGLRSKMEAGFSRMNTLTVLQASQGLAKYIAEKFPENK---TVAVGHDHRFNSRDFAE 111

Query: 72  KIAAIGAANGVKKLVIGQNG------LLSTPAASHIMRTYKEKCTGGIILTASHNPGGPE 125
             +        K   +G N        + TP     +   +   + G+++TASHN   P+
Sbjct: 112 VTSVAFLQLRFKVYSLGFNADPKKDAFVHTPMVPFAID--RLGASAGVMITASHN---PK 166

Query: 126 NDMGIKYNLSNGGPAPEPVTNKIWE-ISKKLTHYKIVKDFPELDLTKLVENKKYGPLLVD 184
            D G K   SNG     P    I + I   L  ++   D   +    + E  + G  +  
Sbjct: 167 MDNGYKVYYSNGCQIIPPHDRLIAQSILDNLNPWERAWDCKAV----IAEATEKGYFVDM 222

Query: 185 VIDTTDAYIQLLKEIFDFELIHKFIAKQRKEKGWKLLVDSMNGVTGPYAKAIFVDEFGL- 243
                D Y+   KEI D +L+   I    + K W  +   ++GV     + I  +  GL 
Sbjct: 223 KKPMVDHYV---KEISD-KLVSSDIGD--RSKPW-FVYTPLHGVGFEIFERIASEVLGLV 275

Query: 244 ---DSKEVLQNWHPQPDFGGLH-PDPNLTYAHTL-VERVNKEKIEFGAASDGDGDR--NM 296
              D   V ++  P P F  +  P+P    A  L +   +K  I F   +D D DR    
Sbjct: 276 EGRDYWCVSEHKQPDPAFPTVSFPNPEEAGALDLAIALADKNGISFVLGNDPDADRFSAA 335

Query: 297 IYGYGPAFVSPGDSVAII------AEYANEIPYFKKQGIYGLARSFPTASAIDRVAKKHG 350
           +   G      G+ +  +       +Y  E   FK +    L  S  ++  I ++A    
Sbjct: 336 VKHQGKWRQLTGNEIGFLFAQFVWEKYQKESSEFKLENPLALINSTVSSQMIKKLAGVEK 395

Query: 351 LNCYEVPTGWKFFCALFDAKKLSICG-------EESFG-TGSNHVREKDGIWAIMAWLNI 402
            +  +  TG+K+      A++L   G       EE+ G   S+ V +KDG+ A + +L +
Sbjct: 396 FHYEDTLTGFKWLGN--RARQLESSGYYVPFAYEEAIGFMFSDIVHDKDGVSAAVVFLQM 453

Query: 403 L 403
           L
Sbjct: 454 L 454

>AEL034W [2472] [Homologous to ScYOL023W (IFM1) - SH]
           complement(568246..570261) [2016 bp, 671 aa]
          Length = 671

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 55/197 (27%), Positives = 82/197 (41%), Gaps = 40/197 (20%)

Query: 46  AIPEGAKGAVLVVGGDGRYYNDVILQKIAAIGAANGVKKLVIGQNGLLSTPAASHIMRTY 105
            +PEG +    +V  D     + I + I+ +G    + K+V    G+   P  + +    
Sbjct: 459 VVPEGPRSVNFIVKADFYGSLEAITESISHLGNDEVICKVVEASVGI---PTINDLSLA- 514

Query: 106 KEKCTGGIILTASHNPGGPENDMGIKYNLSNGGPAPEPVTN--KIWEISKKLTHYKIVKD 163
             + T  +IL                +NL N    P  V N  +  EI +    YK+++D
Sbjct: 515 --RITDSVILC---------------FNLGN---LPGDVLNNKEKIEIRQYTVIYKLIED 554

Query: 164 FPELDLTKLVENKKYGPLLVD-VIDTTDAYIQLLKEIFDFELIHKFI-AKQRKEKGWKLL 221
             E    +L EN    P+  D VI T D     +KEIF F+L HK I     K    KL 
Sbjct: 555 VTE----RLTEN--LEPIYEDKVIATAD-----IKEIFMFDLKHKVIRIAGCKVNNGKLT 603

Query: 222 VDSMNGVT-GPYAKAIF 237
            +S+  +T GP  K IF
Sbjct: 604 RNSLVKITRGPEEKVIF 620

>Sklu_2244.2 YOL151W, Contig c2244 1821-2879 reverse complement
          Length = 352

 Score = 29.3 bits (64), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 50/122 (40%), Gaps = 15/122 (12%)

Query: 292 GDRNMIYGYGPAFVSPGDSVAIIAEYANEI--------PYFKKQGIYGLARSFPTA---S 340
            + N+     P    P     I A+YA +I        P+F +   +      P     S
Sbjct: 55  SNSNLSMEIVPNIAEPDAFDHIFAKYAKDIKVVLHTASPFFFESKDFDKDLLIPAVNGTS 114

Query: 341 AIDRVAKKHGLNCYE---VPTGWKFFCALF-DAKKLSICGEESFGTGSNHVREKDGIWAI 396
           +I +  KK+  N  E   + + +   C    D++K ++  EES+ T S    +KDGI A 
Sbjct: 115 SILKAVKKYAANTVERVVITSSYAAVCTFNEDSQKGNVINEESWNTMSWEEAKKDGIAAY 174

Query: 397 MA 398
            A
Sbjct: 175 CA 176

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.137    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,046,396
Number of extensions: 942239
Number of successful extensions: 2323
Number of sequences better than 10.0: 23
Number of HSP's gapped: 2368
Number of HSP's successfully gapped: 23
Length of query: 559
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 452
Effective length of database: 12,891,983
Effective search space: 5827176316
Effective search space used: 5827176316
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)