Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0K03399g70369232090.0
Scas_721.12468457924730.0
Scas_717.6967455323820.0
ABL028W72255123140.0
KLLA0B12716g71655122340.0
Kwal_26.763569155122170.0
CAGL0K07458g70455319920.0
Kwal_47.167617444519071e-111
ADL389W7114558981e-110
Scas_703.57494658821e-108
YHR205W (SCH9)8243698861e-107
CAGL0F09075g7463918761e-107
KLLA0B03586g7343528621e-105
KLLA0B07205g4552927114e-86
CAGL0M08404g4623047063e-85
Scas_689.25*4092957005e-85
Kwal_33.138463752956966e-85
Scas_651.183712956957e-85
CAGL0G09020g3612956922e-84
Kwal_56.240593533286884e-84
AFL090W3462956674e-81
Scas_690.133542956598e-80
KLLA0E06413g11613287022e-79
ACR191C11493346987e-79
KLLA0D03190g3722956547e-79
CAGL0M09361g11443356988e-79
Kwal_27.1058111543346934e-78
Scas_715.3411503356916e-78
YBL105C (PKC1)11513356821e-76
AEL115C3862956401e-76
CAGL0J06072g7733865872e-65
Kwal_23.64588683055851e-64
Kwal_56.227885153865662e-64
CAGL0C03509g8953055833e-64
KLLA0F24618g5563585612e-63
ADR167W8733045702e-62
YBR028C5253705532e-62
YCR091W (KIN82)7203005642e-62
Scas_629.169183025703e-62
KLLA0C18568g7743025601e-61
AEL083W5363525428e-61
CAGL0B04301g5423685359e-60
Scas_720.1038043585471e-59
Scas_593.14d4952965073e-56
CAGL0E05720g3582684534e-50
AFL101C3672684482e-49
Scas_705.235533964427e-47
KLLA0B02332g3612714211e-45
YGR092W (DBF2)5723534289e-45
Kwal_56.240913812694151e-44
CAGL0B04147g5663504242e-44
CAGL0G03047g5393764181e-43
Kwal_23.39925713504201e-43
Kwal_56.226939842734253e-43
YDR490C (PKH1)7662814205e-43
KLLA0C12485g9252744227e-43
KLLA0E03487g6472774141e-42
ADR033W5773514093e-42
Scas_627.73492683946e-42
KLLA0D14905g5673533987e-41
Scas_716.335733543933e-40
AFR335C10332764004e-40
AFR377C7262783974e-40
CAGL0G04609g9653074004e-40
Scas_660.209572823987e-40
CAGL0I07513g10762773971e-39
YDR466W (PKH3)8982973862e-38
KLLA0D07810g7181583823e-38
AFR035W7191943781e-37
Kwal_33.145547141563762e-37
KLLA0F13552g12672673773e-37
Scas_654.127371563735e-37
Kwal_47.183076212713671e-36
ABL034W14252733676e-36
Scas_502.211162683668e-36
Kwal_26.778812672703623e-35
YDL101C (DUN1)5133013533e-35
CAGL0K06479g9913083604e-35
KLLA0F11319g8432613542e-34
AAR009W4532513398e-34
KLLA0E01584g4152973378e-34
Scas_616.1014613173482e-33
CAGL0J11638g7462783442e-33
CAGL0L07326g5063023365e-33
Kwal_47.182335983183378e-33
CAGL0K08514g14892123429e-33
Kwal_0.964272593291e-32
KLLA0A03806g6022473351e-32
KLLA0C06138g7082463362e-32
CAGL0M08910g6122483333e-32
Scas_660.286232473333e-32
ACL006W7082463344e-32
AEL230W6082783306e-32
YDR477W (SNF1)6332483309e-32
CAGL0L11550g10723093293e-31
Scas_564.712103373293e-31
CAGL0J03872g6612873254e-31
AFR696C11422773275e-31
Scas_693.1710492893275e-31
Kwal_56.224766972693237e-31
KLLA0F23155g4272523158e-31
ACR133C8512613248e-31
Scas_618.84272523158e-31
Scas_613.55172993198e-31
CAGL0K05709g11032803251e-30
Kwal_26.87098292743231e-30
Kwal_26.87967962693212e-30
CAGL0M02233g7673183202e-30
Scas_644.157262463167e-30
Scas_700.348643333151e-29
ACR142W8372843141e-29
Kwal_23.35904992963082e-29
CAGL0B01925g9443063142e-29
CAGL0F04741g4422473062e-29
AGR058W10713253132e-29
CAGL0K10604g4462613043e-29
AFR724C4402653025e-29
CAGL0M02519g7563143086e-29
Kwal_33.131125052673029e-29
YDR507C (GIN4)11422833099e-29
Scas_700.546982863051e-28
YFR014C (CMK1)4462472981e-28
ACL104C9472453062e-28
KLLA0C01650g11122783072e-28
Scas_493.211172813062e-28
KLLA0F11143g8132683024e-28
KLLA0F19536g11042793025e-28
CAGL0M11396g11922903009e-28
CAGL0M02299g8932612999e-28
YHR102W (KIC1)10802463001e-27
Kwal_26.87518482832991e-27
Kwal_47.172528723072991e-27
KLLA0F09020g9281792981e-27
AFL188C4722722921e-27
Scas_580.610152602982e-27
CAGL0K12562g16821632982e-27
YFL033C (RIM15)17701552982e-27
Scas_700.288962612962e-27
Scas_640.14*7282942953e-27
CAGL0I09504g5282852913e-27
YCL024W (KCC4)10372822945e-27
ACR119W9312662902e-26
ACR218W15691552902e-26
KLLA0D07348g9092642892e-26
Scas_201.1*2742302723e-26
YDR523C (SPS1)4902622823e-26
YDR122W (KIN1)10642732865e-26
Scas_707.315981612841e-25
Kwal_55.215458652452821e-25
KLLA0E21780g10162452812e-25
Scas_713.79832692802e-25
Kwal_26.735514462812812e-25
CAGL0C05005g10762412803e-25
Kwal_14.115915211552785e-25
Scas_573.105693142746e-25
Scas_711.2515152862776e-25
Kwal_56.237178582362758e-25
CAGL0L06006g9422902759e-25
KLLA0C00979g4833452691e-24
YGL158W (RCK1)5123082692e-24
ACL054W9723062732e-24
Kwal_0.1555873022702e-24
KLLA0C17160g8312992703e-24
KLLA0F09031g6331492684e-24
AER223C9022462694e-24
YGL180W (ATG1)8973102694e-24
CAGL0L05632g6773212684e-24
KLLA0C04191g7972592695e-24
YAR019C (CDC15)9742542671e-23
Kwal_27.97638682592661e-23
Scas_582.16383072613e-23
Scas_673.20*7582522605e-23
Kwal_23.632515422742591e-22
Scas_675.25272792551e-22
KLLA0C08525g15512712581e-22
Scas_707.369153272552e-22
CAGL0K02167g11623352544e-22
CAGL0K02673g9152662525e-22
AER264C14832522536e-22
CAGL0J00539g4883192477e-22
Kwal_47.1726311273302518e-22
CAGL0F00649g5143242478e-22
Scas_685.245152232461e-21
CAGL0B03509g5972222471e-21
KLLA0F14190g13383112473e-21
Kwal_33.140815803202443e-21
CAGL0M10153g8672762463e-21
AFR092W14232862473e-21
KLLA0E15378g7243222444e-21
Scas_707.349053132445e-21
CAGL0H01639g5212542415e-21
KLLA0D07304g4652072396e-21
Scas_618.156203472426e-21
Kwal_26.87034442052386e-21
CAGL0L03520g14472872439e-21
KLLA0F23507g4872252352e-20
KLLA0F12188g5463082362e-20
YBR274W (CHK1)5272292352e-20
YHL007C (STE20)9392042364e-20
AEL205W7932032364e-20
AFL217C6913202354e-20
CAGL0I04422g4222872298e-20
KLLA0F01276g5192202319e-20
KLLA0B13607g9892112331e-19
ACR117W5242172301e-19
Scas_668.228932422312e-19
Scas_619.5*5102972282e-19
CAGL0J03828g4672012272e-19
Kwal_26.78619552692312e-19
AEL185C5153052282e-19
YHR030C (SLT2)4843192272e-19
Kwal_14.24974181862253e-19
Kwal_33.141678383002303e-19
CAGL0K01617g7743172293e-19
Scas_640.165052852263e-19
KLLA0A07403g8792042293e-19
CAGL0M03729g8612042293e-19
ABR014W9712072293e-19
AAL029W5343082264e-19
KLLA0B11902g4953122246e-19
Scas_688.144793172228e-19
ADR379C4922992228e-19
Scas_713.216412872249e-19
Kwal_27.97734062542209e-19
ACL053C11813672251e-18
KLLA0D09328g10463352232e-18
Kwal_23.52908192032222e-18
Kwal_23.55765043122202e-18
Kwal_55.203267502732222e-18
AER222C4232982173e-18
Scas_598.67902622203e-18
CAGL0M11748g4473372173e-18
CAGL0D02244g4873152183e-18
Scas_700.354392042155e-18
Scas_623.113782202145e-18
YCR073C (SSK22)13312132196e-18
Kwal_33.132221481121997e-18
YAR018C (KIN3)4352782139e-18
Kwal_56.238414323372131e-17
Scas_602.1111864172171e-17
AER232C5693102141e-17
Scas_633.297893122151e-17
Scas_713.384323372102e-17
CAGL0D02002g5533012122e-17
Scas_720.9416832682143e-17
Scas_568.9*3063002053e-17
KLLA0F20053g4443372093e-17
KLLA0A02497g3622222073e-17
YER129W (PAK1)11422842133e-17
CAGL0F00913g12062562133e-17
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0K03399g
         (692 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0K03399g complement(310487..312598) highly similar to sp|P12...  1240   0.0  
Scas_721.124                                                          957   0.0  
Scas_717.69                                                           922   0.0  
ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C (Y...   895   0.0  
KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces...   865   0.0  
Kwal_26.7635                                                          858   0.0  
CAGL0K07458g complement(736336..738450) similar to sp|P12688 Sac...   771   0.0  
Kwal_47.16761                                                         353   e-111
ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH] complement(...   350   e-110
Scas_703.5                                                            344   e-108
YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine pro...   345   e-107
CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces c...   342   e-107
KLLA0B03586g complement(326871..329075) similar to sp|P11792 Sac...   336   e-105
KLLA0B07205g complement(624606..625973) some similarities with s...   278   4e-86
CAGL0M08404g complement(836791..838179) some similarities with s...   276   3e-85
Scas_689.25*                                                          274   5e-85
Kwal_33.13846                                                         272   6e-85
Scas_651.18                                                           272   7e-85
CAGL0G09020g 860266..861351 highly similar to sp|P06245 Saccharo...   271   2e-84
Kwal_56.24059                                                         269   4e-84
AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH] complement(...   261   4e-81
Scas_690.13                                                           258   8e-80
KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732....   275   2e-79
ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..68...   273   7e-79
KLLA0D03190g 267933..269051 highly similar to sp|P06245 Saccharo...   256   7e-79
CAGL0M09361g complement(928484..931918) highly similar to sp|P24...   273   8e-79
Kwal_27.10581                                                         271   4e-78
Scas_715.34                                                           270   6e-78
YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase...   267   1e-76
AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C (...   251   1e-76
CAGL0J06072g complement(572377..574698) similar to sp|P53894 Sac...   230   2e-65
Kwal_23.6458                                                          229   1e-64
Kwal_56.22788                                                         222   2e-64
CAGL0C03509g complement(350846..353533) similar to sp|P53739 Sac...   229   3e-64
KLLA0F24618g complement(2288943..2290613) similar to sp|P38070 S...   220   2e-63
ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) ...   224   2e-62
YBR028C (YBR028C) [220] chr2 complement(294387..295964) Serine/t...   217   2e-62
YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine pro...   221   2e-62
Scas_629.16                                                           224   3e-62
KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1 Kluyvero...   220   1e-61
AEL083W [2423] [Homologous to ScYBR028C - SH] complement(470964....   213   8e-61
CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces c...   210   9e-60
Scas_720.103                                                          215   1e-59
Scas_593.14d                                                          199   3e-56
CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces c...   179   4e-50
AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH] (249144..25...   177   2e-49
Scas_705.23                                                           174   7e-47
KLLA0B02332g complement(206863..207948) similar to sp|P38991 Sac...   166   1e-45
YGR092W (DBF2) [2052] chr7 (668191..669909) Serine/threonine pro...   169   9e-45
Kwal_56.24091                                                         164   1e-44
CAGL0B04147g 402798..404498 highly similar to sp|P22204 Saccharo...   167   2e-44
CAGL0G03047g 282299..283918 highly similar to sp|P22204 Saccharo...   165   1e-43
Kwal_23.3992                                                          166   1e-43
Kwal_56.22693                                                         168   3e-43
YDR490C (PKH1) [1306] chr4 complement(1431956..1434256) Serine/t...   166   5e-43
KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236 Saccha...   167   7e-43
KLLA0E03487g complement(323764..325707) similar to sgd|S0002874 ...   164   1e-42
ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W (...   162   3e-42
Scas_627.7                                                            156   6e-42
KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1 Kluyvero...   157   7e-41
Scas_716.33                                                           155   3e-40
AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C (...   158   4e-40
AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)...   157   4e-40
CAGL0G04609g complement(437162..440059) similar to sp|Q12236 Sac...   158   4e-40
Scas_660.20                                                           157   7e-40
CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces c...   157   1e-39
YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine p...   153   2e-38
KLLA0D07810g complement(669095..671251) gi|401646|sp|P31034|YL44...   151   3e-38
AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH] complement(...   150   1e-37
Kwal_33.14554                                                         149   2e-37
KLLA0F13552g complement(1252906..1256709) gi|33386566|emb|CAD877...   149   3e-37
Scas_654.12                                                           148   5e-37
Kwal_47.18307                                                         145   1e-36
ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH] complement(3...   145   6e-36
Scas_502.2                                                            145   8e-36
Kwal_26.7788                                                          144   3e-35
YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kin...   140   3e-35
CAGL0K06479g 636296..639271 some similarities with tr|Q03306 Sac...   143   4e-35
KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomy...   140   2e-34
AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C (C...   135   8e-34
KLLA0E01584g 149713..150960 highly similar to sp|P39009 Saccharo...   134   8e-34
Scas_616.10                                                           138   2e-33
CAGL0J11638g complement(1128620..1130860) highly similar to sp|P...   137   2e-33
CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces c...   134   5e-33
Kwal_47.18233                                                         134   8e-33
CAGL0K08514g complement(853314..857783) similar to sp|P34244 Sac...   136   9e-33
Kwal_0.96                                                             131   1e-32
KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235....   133   1e-32
KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces c...   134   2e-32
CAGL0M08910g complement(887703..889541) highly similar to sp|Q00...   132   3e-32
Scas_660.28                                                           132   3e-32
ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH] complement(...   133   4e-32
AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH] complement(...   131   6e-32
YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine p...   131   9e-32
CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces...   131   3e-31
Scas_564.7                                                            131   3e-31
CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces c...   129   4e-31
AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W (...   130   5e-31
Scas_693.17                                                           130   5e-31
Kwal_56.22476                                                         129   7e-31
KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces...   125   8e-31
ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023) [...   129   8e-31
Scas_618.8                                                            125   8e-31
Scas_613.5                                                            127   8e-31
CAGL0K05709g complement(555903..559214) similar to sp|Q12263 Sac...   129   1e-30
Kwal_26.8709                                                          129   1e-30
Kwal_26.8796                                                          128   2e-30
CAGL0M02233g complement(267332..269635) highly similar to sp|P22...   127   2e-30
Scas_644.15                                                           126   7e-30
Scas_700.34                                                           125   1e-29
ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH] complement...   125   1e-29
Kwal_23.3590                                                          123   2e-29
CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces c...   125   2e-29
CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces c...   122   2e-29
AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W (...   125   2e-29
CAGL0K10604g complement(1029226..1030566) similar to sp|P27466 S...   121   3e-29
AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH] (1769897..1...   120   5e-29
CAGL0M02519g complement(290723..292993) highly similar to tr|Q03...   123   6e-29
Kwal_33.13112                                                         120   9e-29
YDR507C (GIN4) [1321] chr4 complement(1462346..1465774) Serine/t...   123   9e-29
Scas_700.54                                                           122   1e-28
YFR014C (CMK1) [1695] chr6 complement(172529..173869) Calcium/ca...   119   1e-28
ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH] (157357..160...   122   2e-28
KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces c...   122   2e-28
Scas_493.2                                                            122   2e-28
KLLA0F11143g complement(1026129..1028570) similar to sp|P22216 S...   120   4e-28
KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces...   120   5e-28
CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces...   120   9e-28
CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces c...   119   9e-28
YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine pro...   120   1e-27
Kwal_26.8751                                                          119   1e-27
Kwal_47.17252                                                         119   1e-27
KLLA0F09020g 836287..839073 weakly similar to sp|P43565 Saccharo...   119   1e-27
AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..902...   117   1e-27
Scas_580.6                                                            119   2e-27
CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces...   119   2e-27
YFL033C (RIM15) [1651] chr6 complement(69113..74425) Serine/thre...   119   2e-27
Scas_700.28                                                           118   2e-27
Scas_640.14*                                                          118   3e-27
CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces c...   116   3e-27
YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protei...   117   5e-27
ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -...   116   2e-26
ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH] complement...   116   2e-26
KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062 Sacch...   115   2e-26
Scas_201.1*                                                           109   3e-26
YDR523C (SPS1) [1335] chr4 complement(1485554..1487026) Serine/t...   113   3e-26
YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine prot...   114   5e-26
Scas_707.3                                                            114   1e-25
Kwal_55.21545                                                         113   1e-25
KLLA0E21780g complement(1936438..1939488) similar to sp|P38692 S...   112   2e-25
Scas_713.7                                                            112   2e-25
Kwal_26.7355                                                          112   2e-25
CAGL0C05005g complement(467626..470856) similar to sp|P27636 Sac...   112   3e-25
Kwal_14.1159                                                          111   5e-25
Scas_573.10                                                           110   6e-25
Scas_711.25                                                           111   6e-25
Kwal_56.23717                                                         110   8e-25
CAGL0L06006g complement(670707..673535) similar to sp|P53104 Sac...   110   9e-25
KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces cer...   108   1e-24
YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine pro...   108   2e-24
ACL054W [995] [Homologous to ScYGL180W (APG1) - SH] complement(2...   109   2e-24
Kwal_0.155                                                            108   2e-24
KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces...   108   3e-24
KLLA0F09031g 839103..841004 similar to sp|P43565 Saccharomyces c...   107   4e-24
AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH] (1044971.....   108   4e-24
YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine pro...   108   4e-24
CAGL0L05632g 610481..612514 similar to sp|P08018 Saccharomyces c...   107   4e-24
KLLA0C04191g 384198..386591 weakly similar to sp|P27636 Saccharo...   108   5e-24
YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase ...   107   1e-23
Kwal_27.9763                                                          107   1e-23
Scas_582.1                                                            105   3e-23
Scas_673.20*                                                          104   5e-23
Kwal_23.6325                                                          104   1e-22
Scas_675.2                                                            102   1e-22
KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces c...   103   1e-22
Scas_707.36                                                           102   2e-22
CAGL0K02167g complement(191468..194956) similar to sp|P38990 Sac...   102   4e-22
CAGL0K02673g complement(240509..243256) similar to sp|Q03497 Sac...   101   5e-22
AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C ...   102   6e-22
CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomy...   100   7e-22
Kwal_47.17263                                                         101   8e-22
CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces cer...   100   8e-22
Scas_685.24                                                            99   1e-21
CAGL0B03509g complement(349638..351431) similar to sp|P38623 Sac...   100   1e-21
KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyvero...   100   3e-21
Kwal_33.14081                                                          99   3e-21
CAGL0M10153g complement(1010688..1013291) some similarities with...    99   3e-21
AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH] complement(...   100   3e-21
KLLA0E15378g 1362851..1365025 some similarities with sp|P08018 S...    99   4e-21
Scas_707.34                                                            99   5e-21
CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces c...    97   5e-21
KLLA0D07304g 623352..624749 some similarities with sp|P32491 Sac...    97   6e-21
Scas_618.15                                                            98   6e-21
Kwal_26.8703                                                           96   6e-21
CAGL0L03520g complement(401103..405446) similar to sp|Q01389 Sac...    98   9e-21
KLLA0F23507g complement(2198603..2200066) similar to sp|P24719 S...    95   2e-20
KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces...    96   2e-20
YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase, re...    95   2e-20
YHL007C (STE20) [2279] chr8 complement(95113..97932) Serine/thre...    96   4e-20
AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W (...    96   4e-20
AFL217C [2978] [Homologous to ScYJL128C (PBS2) - SH] (30765..328...    95   4e-20
CAGL0I04422g 394159..395427 some similarities with sp|P22209 Sac...    93   8e-20
KLLA0F01276g complement(120001..121560) similar to sp|P38147 Sac...    94   9e-20
KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497 Saccha...    94   1e-19
ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C (...    93   1e-19
Scas_668.22                                                            94   2e-19
Scas_619.5*                                                            92   2e-19
CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces c...    92   2e-19
Kwal_26.7861                                                           94   2e-19
AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH] (291129..29...    92   2e-19
YHR030C (SLT2) [2317] chr8 complement(168882..170336) Serine/thr...    92   2e-19
Kwal_14.2497                                                           91   3e-19
Kwal_33.14167                                                          93   3e-19
CAGL0K01617g complement(142479..144803) similar to sp|P54199 Sac...    93   3e-19
Scas_640.16                                                            92   3e-19
KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces c...    93   3e-19
CAGL0M03729g complement(420316..422901) similar to sp|P48562 Sac...    93   3e-19
ABR014W [605] [Homologous to ScYHL007C (STE20) - SH] complement(...    93   3e-19
AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W (R...    92   4e-19
KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_...    91   6e-19
Scas_688.14                                                            90   8e-19
ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH] (1386601..1...    90   8e-19
Scas_713.21                                                            91   9e-19
Kwal_27.9773                                                           89   9e-19
ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C (T...    91   1e-18
KLLA0D09328g complement(788565..791705) some similarities with s...    91   2e-18
Kwal_23.5290                                                           90   2e-18
Kwal_23.5576                                                           89   2e-18
Kwal_55.20326                                                          90   2e-18
AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH] (1043479..1...    88   3e-18
Scas_598.6                                                             89   3e-18
CAGL0M11748g 1167306..1168649 highly similar to sp|P32485 Saccha...    88   3e-18
CAGL0D02244g complement(229504..230967) similar to sp|P24719 Sac...    89   3e-18
Scas_700.35                                                            87   5e-18
Scas_623.11                                                            87   5e-18
YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase...    89   6e-18
Kwal_33.13222                                                          81   7e-18
YAR018C (KIN3) [73] chr1 complement(170393..171700) Serine/threo...    87   9e-18
Kwal_56.23841                                                          87   1e-17
Scas_602.11                                                            88   1e-17
AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -...    87   1e-17
Scas_633.29                                                            87   1e-17
Scas_713.38                                                            86   2e-17
CAGL0D02002g 207419..209080 similar to sp|Q03957 Saccharomyces c...    86   2e-17
Scas_720.94                                                            87   3e-17
Scas_568.9*                                                            84   3e-17
KLLA0F20053g 1867209..1868543 highly similar to sp|P32485 Saccha...    85   3e-17
KLLA0A02497g 218592..219680 highly similar to sp|P14681 Saccharo...    84   3e-17
YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capab...    87   3e-17
CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces ce...    87   3e-17
Kwal_55.22001                                                          84   4e-17
AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH] (807470..80...    85   4e-17
ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..2757...    84   4e-17
Scas_716.73                                                            84   4e-17
CAGL0L12474g complement(1345044..1345952) highly similar to sp|P...    83   5e-17
KLLA0E11979g complement(1060048..1061892) some similarities with...    85   6e-17
KLLA0B11946g complement(1048033..1049352) similar to sp|P41808 S...    84   7e-17
KLLA0B13112g complement(1146006..1148198) similar to sp|P23561 S...    85   8e-17
AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919) [...    84   8e-17
ADR317C [2058] [Homologous to ScYDL028C (MPS1) - SH] (1263082..1...    85   9e-17
Scas_643.20                                                            85   9e-17
Scas_683.6                                                             83   1e-16
ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH] (146098..14...    83   1e-16
Kwal_27.12559                                                          83   1e-16
CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces c...    83   1e-16
Scas_628.9                                                             84   2e-16
YCR008W (SAT4) [542] chr3 (128467..130278) Serine/threonine prot...    84   2e-16
YGL179C (TOS3) [1812] chr7 complement(163413..165095) Serine/thr...    84   2e-16
Kwal_33.13984                                                          84   2e-16
CAGL0D01694g complement(176981..178279) similar to sp|P41808 Sac...    82   2e-16
CAGL0L07810g complement(857656..859446) similar to sp|P25333 Sac...    83   2e-16
KLLA0D11990g join(complement(1023928..1023944), gi|2499590|sp|Q9...    80   3e-16
CAGL0B02739g complement(262590..264620) similar to sp|P23561 Sac...    83   3e-16
KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces c...    83   4e-16
Kwal_23.4276                                                           82   4e-16
Kwal_0.307                                                             82   5e-16
Kwal_27.11803                                                          78   7e-16
Scas_651.3                                                             82   7e-16
ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -...    80   1e-15
KLLA0E07414g complement(672690..673787) highly similar to sp|P21...    79   1e-15
Scas_544.6                                                             80   1e-15
CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces c...    81   2e-15
Scas_680.20                                                            80   2e-15
ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH] (797020..79...    80   2e-15
KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces c...    81   2e-15
Scas_548.6                                                             81   2e-15
Kwal_26.7154                                                           80   2e-15
YDL028C (MPS1) [834] chr4 complement(400994..403288) Multi-funct...    80   3e-15
CAGL0J04290g complement(400939..402012) similar to sp|P16892 Sac...    78   3e-15
KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces c...    79   3e-15
CAGL0I05896g 560169..562505 some similarities with sp|P14680 Sac...    80   3e-15
Scas_634.5                                                             80   4e-15
YDL159W (STE7) [712] chr4 (172482..174029) Serine/threonine/tyro...    79   4e-15
Kwal_14.1416                                                           78   4e-15
Scas_721.132                                                           79   4e-15
AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH] (805583..80...    78   5e-15
CAGL0H07535g 736241..737137 highly similar to sp|P00546 Saccharo...    76   6e-15
ABL011C [581] [Homologous to ScYLR362W (STE11) - SH] (378259..38...    79   6e-15
CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces c...    77   6e-15
KLLA0E14828g complement(1323743..1324675) gi|27526973|emb|CAD369...    77   6e-15
CAGL0E01683g complement(166584..167711) highly similar to sp|P21...    77   7e-15
Scas_721.110                                                           78   7e-15
Scas_477.5                                                             79   8e-15
Kwal_26.7552                                                           78   8e-15
YGR040W (KSS1) [2006] chr7 (575400..576506) Serine/threonine pro...    77   1e-14
ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) ...    78   1e-14
Kwal_26.8347                                                           77   1e-14
KLLA0A05819g 541545..543659 similar to sp|P14680 Saccharomyces c...    77   2e-14
AER195C [2697] [Homologous to ScYCR008W (SAT4) - SH] (1005431..1...    77   2e-14
Scas_710.28                                                            75   2e-14
Scas_667.18                                                            76   2e-14
ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH] (692321..69...    77   2e-14
KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA6115...    75   3e-14
ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C ...    75   3e-14
Kwal_23.5668                                                           77   4e-14
Kwal_47.17868                                                          74   5e-14
ABL055C [537] [Homologous to ScYKL116C (PRR1) - SH] (295497..297...    75   5e-14
Kwal_56.24584                                                          75   7e-14
Scas_635.1                                                             74   7e-14
KLLA0B07579g 659591..661759 weakly similar to sp|P32944 Saccharo...    75   9e-14
CAGL0M13541g 1332296..1334164 similar to sp|Q03533 Saccharomyces...    75   9e-14
AGR334W [4645] [Homologous to ScYMR291W - SH] complement(1354612...    75   1e-13
KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1 Kluyverom...    74   1e-13
Scas_336.1                                                             74   1e-13
YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine prote...    75   1e-13
KLLA0A09713g 851952..853625 similar to sp|Q03533 Saccharomyces c...    74   2e-13
YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine prot...    72   2e-13
CAGL0K11550g 1118142..1119758 similar to sp|P28708 Saccharomyces...    73   3e-13
CAGL0L06820g 767038..768138 highly similar to sp|P38615 Saccharo...    72   3e-13
KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces c...    72   3e-13
CAGL0H01199g 110610..115556 highly similar to sp|P15442 Saccharo...    74   3e-13
CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces c...    72   4e-13
Scas_678.13                                                            72   5e-13
AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH] (246896..2...    70   7e-13
KLLA0A02717g 245082..246380 some similarities with sp|P53233 Sac...    72   7e-13
Scas_613.13*                                                           70   7e-13
KLLA0C16577g complement(1451181..1452695) some similarities with...    71   1e-12
ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH] complement...    69   2e-12
YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..3147...    70   2e-12
AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH] complement(1...    71   2e-12
KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces...    70   2e-12
Kwal_14.1273                                                           70   2e-12
Kwal_26.7682                                                           70   3e-12
KLLA0C10802g complement(926916..931934) similar to sp|P15442 Sac...    70   3e-12
AEL149C [2357] [Homologous to ScYJL187C (SWE1) - SH] (348350..35...    70   4e-12
Kwal_33.13831                                                          69   8e-12
Scas_721.46                                                            67   8e-12
Kwal_27.10004                                                          69   8e-12
Kwal_17.2687                                                           67   9e-12
Scas_684.28                                                            68   1e-11
YDR283C (GCN2) [1112] chr4 complement(1025062..1030041) Serine/t...    69   1e-11
YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent pro...    66   1e-11
Scas_678.24                                                            68   2e-11
CAGL0K00693g complement(74637..77267) similar to sp|P32944 Sacch...    68   2e-11
KLLA0B09790g complement(855327..856214) highly similar to sp|P00...    66   2e-11
ADL043C [1698] [Homologous to ScYLL019C (KNS1) - SH] (612091..61...    67   4e-11
YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699) Cycli...    65   4e-11
AFR019W [3211] [Homologous to ScYBL016W (FUS3) - SH] complement(...    65   7e-11
CAGL0H10318g complement(1006299..1007222) highly similar to sp|P...    64   1e-10
Kwal_23.3471                                                           62   2e-10
ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH] (810941..8...    63   2e-10
AFR150C [3342] [Homologous to ScYFL029C (CAK1) - SH] (707306..70...    63   2e-10
CAGL0G04455g 426386..428641 similar to sp|P32581 Saccharomyces c...    64   2e-10
ADL102C [1639] [Homologous to ScYIL035C (CKA1) - SH] (503670..50...    63   3e-10
KLLA0F02838g 264329..266596 some similarities with sp|P32581 Sac...    63   5e-10
CAGL0L12650g 1357789..1359492 similar to sp|P39073 Saccharomyces...    63   5e-10
CAGL0F03245g complement(316924..320034) similar to sp|P32361 Sac...    63   6e-10
KLLA0F26983g 2489326..2490729 some similarities with sp|P32801 S...    62   7e-10
Kwal_33.13681                                                          62   8e-10
Scas_711.15                                                            62   9e-10
Kwal_26.7276                                                           62   1e-09
CAGL0I05192g complement(493635..494756) highly similar to sp|P15...    60   2e-09
Scas_689.24                                                            61   2e-09
Scas_651.19                                                            61   3e-09
KLLA0F22297g complement(2083448..2085547) some similarities with...    60   3e-09
KLLA0E04136g 382874..383995 similar to sp|P15790 Saccharomyces c...    60   3e-09
KLLA0C03938g complement(358851..360632) some similarities with s...    60   3e-09
Kwal_55.21709                                                          59   4e-09
AGL249C [4063] [Homologous to ScYPL042C (SSN3) - SH] (234347..23...    60   4e-09
KLLA0D11814g complement(1007240..1009021) similar to sp|P39073 S...    60   5e-09
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    60   5e-09
CAGL0D06600g 626571..628748 similar to tr|Q12399 Saccharomyces c...    60   5e-09
Kwal_27.11919                                                          57   5e-09
Kwal_47.18098                                                          59   5e-09
Scas_654.17                                                            59   6e-09
Scas_704.50                                                            59   6e-09
Scas_22.1                                                              57   6e-09
Scas_649.30                                                            59   6e-09
CAGL0J04972g 472984..474003 some similarities with tr|Q12100 Sac...    59   7e-09
Scas_697.12                                                            59   9e-09
Scas_568.13                                                            58   1e-08
ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH] (1222346..1...    59   1e-08
Kwal_27.11830                                                          58   2e-08
AFR076W [3268] [Homologous to ScYJL106W (IME2) - SH] complement(...    58   2e-08
KLLA0F16467g 1519800..1520822 highly similar to sp|P19454 Saccha...    57   2e-08
YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threon...    58   2e-08
Kwal_33.14434                                                          58   2e-08
KLLA0F08877g 825217..826182 gi|27526975|emb|CAD36965.1 Kluyverom...    57   2e-08
Scas_695.33                                                            58   2e-08
AFR040W [3232] [Homologous to ScYHR135C (YCK1) - SH; ScYNL154C (...    57   3e-08
Scas_648.17                                                            57   3e-08
CAGL0G02035g 179911..180930 highly similar to sp|P19454 Saccharo...    56   3e-08
ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH] (735828..738...    57   3e-08
ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH] complement(...    56   4e-08
CAGL0H10208g complement(996853..999936) similar to sp|P38080 Sac...    57   4e-08
Scas_673.34*                                                           57   4e-08
Kwal_33.14192                                                          57   4e-08
AFR372W [3564] [Homologous to ScYJR059W (PTK2 ) - SH] complement...    57   5e-08
Scas_610.7                                                             57   5e-08
CAGL0M13167g complement(1291524..1293356) similar to sp|P32801 S...    57   5e-08
CAGL0G06138g complement(585585..587204) similar to sp|P23291 Sac...    56   5e-08
KLLA0A06820g complement(615686..618004) some similarities with s...    57   6e-08
Scas_683.12                                                            55   6e-08
AEL118C [2388] [Homologous to ScYKL168C (KKQ8) - SH; ScYJL165C (...    56   7e-08
Kwal_55.21900                                                          56   8e-08
Kwal_33.14596                                                          55   8e-08
CAGL0I06248g 600351..602792 similar to sp|P38970 Saccharomyces c...    56   8e-08
YHR135C (YCK1) [2422] chr8 complement(372695..374311) Casein kin...    55   9e-08
Scas_698.37                                                            55   1e-07
KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces c...    55   1e-07
Kwal_55.20189                                                          55   1e-07
Scas_653.25                                                            55   1e-07
Scas_671.16                                                            55   1e-07
CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces c...    55   1e-07
KLLA0F01507g 144356..145774 some similarities with sp|P47042 Sac...    55   1e-07
KLLA0F01408g 135424..136302 weakly similar to sgd|S0002183 Sacch...    54   1e-07
CAGL0K11990g complement(1155395..1158370) some similarities with...    55   2e-07
KLLA0D13266g complement(1137750..1141208) similar to sp|P32361 S...    55   2e-07
KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces c...    55   2e-07
CAGL0I08349g complement(813728..815731) similar to sp|P23293 Sac...    55   2e-07
Scas_677.18                                                            55   2e-07
CAGL0I05390g complement(508677..510041) similar to sp|Q12505 Sac...    54   2e-07
KLLA0E08371g complement(756205..758538) similar to sp|P40494 Sac...    54   3e-07
ADR163W [1905] [Homologous to ScYDR247W - SH; ScYPL026C (SKS1) -...    54   3e-07
Scas_703.47                                                            54   3e-07
CAGL0J05940g 560563..562023 similar to sp|P23291 Saccharomyces c...    54   3e-07
Scas_718.90                                                            54   3e-07
KLLA0E17127g complement(1515721..1518279) similar to sp|P38691 S...    54   3e-07
Scas_601.6                                                             54   4e-07
CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces...    54   4e-07
CAGL0H01837g complement(176352..178736) tr|Q9C1R8 Candida glabra...    54   4e-07
KLLA0D11044g complement(942458..944068) gi|730472|sp|P40230|RAG8...    53   4e-07
Kwal_27.11777                                                          53   5e-07
Kwal_14.1249                                                           53   5e-07
KLLA0C07535g 658746..660620 some similarities with sgd|S0005793 ...    53   5e-07
YDR247W (VHS1) [1081] chr4 (956005..957390) Serine/threonine pro...    53   5e-07
Kwal_47.17345                                                          53   6e-07
Kwal_27.10945                                                          53   7e-07
Scas_655.2                                                             53   8e-07
KLLA0B06501g complement(576636..579089) some similarities with s...    53   8e-07
Kwal_27.11542                                                          53   9e-07
CAGL0H09152g complement(895722..898055) similar to sp|P47116 Sac...    52   1e-06
CAGL0K12496g 1218391..1219473 similar to sp|P43568 Saccharomyces...    51   2e-06
ADR313W [2054] [Homologous to ScYDL025C - SH] complement(1255932...    52   2e-06
Scas_707.7                                                             51   2e-06
ADL217W [1524] [Homologous to ScYIL095W (PRK1) - SH; ScYNL020C (...    52   2e-06
CAGL0M08360g complement(833220..835520) some similarities with s...    51   2e-06
YHR082C (KSP1) [2372] chr8 complement(268460..271549) Serine/thr...    51   3e-06
CAGL0G02607g complement(240244..242310) similar to sp|P40494 Sac...    50   4e-06
Kwal_55.20221                                                          50   4e-06
Scas_458.1                                                             50   4e-06
ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)...    50   4e-06
AGR027C [4337] [Homologous to ScYBR059C (AKL1) - SH] (763309..76...    50   4e-06
ABR088C [679] [Homologous to ScYKL048C (ELM1) - SH] (546324..547...    50   4e-06
Scas_721.61                                                            50   5e-06
YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine ...    50   5e-06
CAGL0K01661g complement(146952..148400) some similarities with t...    50   5e-06
CAGL0K11275g 1093797..1095374 similar to tr|Q03785 Saccharomyces...    49   7e-06
Scas_584.11                                                            50   7e-06
CAGL0C02893g complement(286017..287966) similar to tr|Q08732 Sac...    49   9e-06
Kwal_26.8941                                                           49   9e-06
Scas_661.27                                                            49   1e-05
Scas_689.22                                                            49   1e-05
CAGL0F03707g complement(359839..361665) similar to sp|Q08732 Sac...    49   1e-05
CAGL0F03311g complement(327599..330736) similar to sp|P38691 Sac...    49   2e-05
ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C (P...    49   2e-05
CAGL0J05082g 481179..483140 similar to sp|P47042 Saccharomyces c...    47   3e-05
AEL173W [2333] [Homologous to ScYJL057C (IKS1) - SH] complement(...    47   3e-05
KLLA0F18612g 1711131..1713575 some similarities with sp|P38080 S...    47   7e-05
ADR293C [2034] [Homologous to ScYHR079C (IRE1) - SH] (1207023..1...    46   9e-05
Scas_627.4                                                             45   1e-04
Kwal_47.17314                                                          45   2e-04
YBR059C (AKL1) [250] chr2 complement(356821..360147) Serine/thre...    45   2e-04
KLLA0D12100g complement(1031728..1033161) some similarities with...    44   2e-04
YBR097W (VPS15) [288] chr2 (436908..441272) Serine/threonine pro...    45   3e-04
YER123W (YCK3) [1553] chr5 (404809..406383) Casein kinase I isof...    44   3e-04
Scas_692.24                                                            44   3e-04
Kwal_33.13225                                                          44   3e-04
Scas_584.8                                                             44   3e-04
CAGL0H08437g complement(825191..829423) similar to sp|P22219 Sac...    44   3e-04
AEL179W [2327] [Homologous to NOHBY] complement(302948..303817) ...    43   4e-04
CAGL0G01716g complement(155248..156390) similar to tr|Q06098 Sac...    44   5e-04
ADL053C [1688] [Homologous to ScYER123W (YCK3) - SH] (589602..59...    43   5e-04
AFL091W [3102] [Homologous to ScYPL204W (HRR25) - SH] complement...    43   6e-04
CAGL0G05720g complement(547617..549833) similar to sp|P22211 Sac...    44   6e-04
CAGL0K01815g 162144..163658 similar to sp|P06243 Saccharomyces c...    43   8e-04
Kwal_33.15381                                                          42   0.001
KLLA0E13563g 1193481..1194902 some similarities with sp|P39962 S...    42   0.001
KLLA0B11924g complement(1043344..1047582) similar to sp|P22219 S...    42   0.002
Kwal_56.24274                                                          42   0.002

>CAGL0K03399g complement(310487..312598) highly similar to sp|P12688
           Saccharomyces cerevisiae YKL126w
           Serine/threonine-protein kinase, start by similarity
          Length = 703

 Score = 1240 bits (3209), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 615/692 (88%), Positives = 615/692 (88%)

Query: 1   MYSWXXXXXXXXXXXXXXXXXXXXXXXXXXTGSDVSDNFGNGNDKEKSVDSLPSSSEITP 60
           MYSW                          TGSDVSDNFGNGNDKEKSVDSLPSSSEITP
Sbjct: 1   MYSWKKFKFGKSKDEKEQKKDKLFHFHHKHTGSDVSDNFGNGNDKEKSVDSLPSSSEITP 60

Query: 61  YPSDLPSQNTNGNNSSRNDTMVXXXXXXXXXXXXXXXXXXXXXXTIKDVPLGGENERSSS 120
           YPSDLPSQNTNGNNSSRNDTMV                      TIKDVPLGGENERSSS
Sbjct: 61  YPSDLPSQNTNGNNSSRNDTMVNSNSSNRISSASSAKGPGSSSSTIKDVPLGGENERSSS 120

Query: 121 HIDQVXXXXXXXXXXXXXXXXGVMTIKVYNGDGFRLPFPITSNKKILSRLLESGIASDNH 180
           HIDQV                GVMTIKVYNGDGFRLPFPITSNKKILSRLLESGIASDNH
Sbjct: 121 HIDQVSQKSATSTKKTSTPSTGVMTIKVYNGDGFRLPFPITSNKKILSRLLESGIASDNH 180

Query: 181 DTSLEVEAILQRISRXXXXXXXXXXXXXPGDIATQSIPSTIKLPNSVPLNPLLYFTIEFD 240
           DTSLEVEAILQRISR             PGDIATQSIPSTIKLPNSVPLNPLLYFTIEFD
Sbjct: 181 DTSLEVEAILQRISRLELTNSNSNENLLPGDIATQSIPSTIKLPNSVPLNPLLYFTIEFD 240

Query: 241 NTVATIEPESGTMAQPIFNKISTFDVTRKLPQLNIDVFVRIPSILLPPKQWQQEMGAQDE 300
           NTVATIEPESGTMAQPIFNKISTFDVTRKLPQLNIDVFVRIPSILLPPKQWQQEMGAQDE
Sbjct: 241 NTVATIEPESGTMAQPIFNKISTFDVTRKLPQLNIDVFVRIPSILLPPKQWQQEMGAQDE 300

Query: 301 KLQALLDKINTNQDVHLDSFQLPVNLLIDSAATIRLYNHHWVELRDGLGKINISVDYKPS 360
           KLQALLDKINTNQDVHLDSFQLPVNLLIDSAATIRLYNHHWVELRDGLGKINISVDYKPS
Sbjct: 301 KLQALLDKINTNQDVHLDSFQLPVNLLIDSAATIRLYNHHWVELRDGLGKINISVDYKPS 360

Query: 361 RNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERT 420
           RNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERT
Sbjct: 361 RNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERT 420

Query: 421 VLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCA 480
           VLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCA
Sbjct: 421 VLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCA 480

Query: 481 LDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELL 540
           LDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELL
Sbjct: 481 LDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELL 540

Query: 541 LGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLLI 600
           LGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLLI
Sbjct: 541 LGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLLI 600

Query: 601 GLLSRDPQRRLGYNGADEIKNHPFFSQLSWKRLLMKGYIPPYKPPVTSATDTSNFDQEFT 660
           GLLSRDPQRRLGYNGADEIKNHPFFSQLSWKRLLMKGYIPPYKPPVTSATDTSNFDQEFT
Sbjct: 601 GLLSRDPQRRLGYNGADEIKNHPFFSQLSWKRLLMKGYIPPYKPPVTSATDTSNFDQEFT 660

Query: 661 REKPIDSVVDEYLSESVQKQFGGWTYVGSEQL 692
           REKPIDSVVDEYLSESVQKQFGGWTYVGSEQL
Sbjct: 661 REKPIDSVVDEYLSESVQKQFGGWTYVGSEQL 692

>Scas_721.124
          Length = 684

 Score =  957 bits (2473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/579 (79%), Positives = 506/579 (87%), Gaps = 2/579 (0%)

Query: 115 NERSSSHIDQVXXXXXXXXXXXXXXXXGVMTIKVYNGDGFRLPFPITSNKKILSRLLESG 174
           +E S S I Q                 G+MTIK+YNGD F LPFPITSN++ILS+LL SG
Sbjct: 96  HESSVSQISQDTASNDPHPQNTHISSSGIMTIKIYNGDAFTLPFPITSNQQILSKLLGSG 155

Query: 175 IASDNHDTSLEVEAILQRISRXXXXXXX-XXXXXXPGDIATQSIPSTIKLPNSVPLNPLL 233
           I+  +  T  +V+ ++ ++SR                D++++ IP+TIKLP S  LNPLL
Sbjct: 156 ISPPSTATP-DVDTLVSQLSRVQLQNQGPAEENLLASDVSSKFIPATIKLPGSSVLNPLL 214

Query: 234 YFTIEFDNTVATIEPESGTMAQPIFNKISTFDVTRKLPQLNIDVFVRIPSILLPPKQWQQ 293
           YFTIEFDNTVATIEPE GTM +P+FNKISTFDVTRKLP L IDVF RIPSILLP K WQQ
Sbjct: 215 YFTIEFDNTVATIEPEYGTMTKPVFNKISTFDVTRKLPFLKIDVFARIPSILLPSKMWQQ 274

Query: 294 EMGAQDEKLQALLDKINTNQDVHLDSFQLPVNLLIDSAATIRLYNHHWVELRDGLGKINI 353
           EM A DEKL+ +L+KIN+NQDVHLDSFQLP+NL  D+A+ IRLYNHHWV L +GLG+INI
Sbjct: 275 EMSANDEKLKEMLEKINSNQDVHLDSFQLPINLKFDTASNIRLYNHHWVSLENGLGRINI 334

Query: 354 SVDYKPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVT 413
           S+DYKPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDT+KIYALKAIRK+YIVSKSEVT
Sbjct: 335 SIDYKPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKAIRKAYIVSKSEVT 394

Query: 414 HTLAERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFY 473
           HTLAERTVLARIDCPFIVPLKFSFQS +KLYLVLACINGGELFYHLQ+EGRFDLSRSRFY
Sbjct: 395 HTLAERTVLARIDCPFIVPLKFSFQSPDKLYLVLACINGGELFYHLQKEGRFDLSRSRFY 454

Query: 474 AAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPE 533
           AAELLCAL+TLH ++VIYRDLKPENILLDYQGHIALCDFGLCKLNMKD+DKTDTFCGTPE
Sbjct: 455 AAELLCALETLHNLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDDDKTDTFCGTPE 514

Query: 534 YLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDR 593
           YLAPELLLGQGY+KVVDWWTLGVLLYEMLTGLPPYYDE+VPKMYKKILQDPL FPDGFDR
Sbjct: 515 YLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDGFDR 574

Query: 594 DAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQLSWKRLLMKGYIPPYKPPVTSATDTS 653
           DAKDLLIGLLSRDP RRLG NGADEIKNHPFFSQLSWKRLLMKGYIPPYKPPVTSA DTS
Sbjct: 575 DAKDLLIGLLSRDPTRRLGCNGADEIKNHPFFSQLSWKRLLMKGYIPPYKPPVTSAIDTS 634

Query: 654 NFDQEFTREKPIDSVVDEYLSESVQKQFGGWTYVGSEQL 692
           NFDQEFTREKP+DSVVDE+LSESVQKQFGGWTYVGSEQL
Sbjct: 635 NFDQEFTREKPVDSVVDEFLSESVQKQFGGWTYVGSEQL 673

>Scas_717.69
          Length = 674

 Score =  922 bits (2382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/553 (80%), Positives = 484/553 (87%), Gaps = 2/553 (0%)

Query: 142 GVMTIKVYNGDGFRLPFPITSNKKILSRLLESGIASDNHDTSLEVEAILQRISRXXXXXX 201
           G+MTIKVYNG+GF LP  ITSN+ ILSRLL SGI S + + S EV+A++ R+SR      
Sbjct: 115 GIMTIKVYNGEGFILPVSITSNETILSRLLSSGINSAHVNLSNEVDALISRLSRMQLETS 174

Query: 202 XXXXXXX--PGDIATQSIPSTIKLPNSVPLNPLLYFTIEFDNTVATIEPESGTMAQPIFN 259
                     G+  T+ IP+T+KLP S  LNPLLYFTIEFDNTVATIEPE G MA P+FN
Sbjct: 175 RNIQEEKLINGETCTKYIPATVKLPGSNRLNPLLYFTIEFDNTVATIEPEYGLMADPVFN 234

Query: 260 KISTFDVTRKLPQLNIDVFVRIPSILLPPKQWQQEMGAQDEKLQALLDKINTNQDVHLDS 319
           KISTFDVTRKLP L IDVF RIPSILLP K WQQ     D +++ +LDKIN+NQDVHLDS
Sbjct: 235 KISTFDVTRKLPYLKIDVFARIPSILLPSKLWQQTQSEHDSRMKVILDKINSNQDVHLDS 294

Query: 320 FQLPVNLLIDSAATIRLYNHHWVELRDGLGKINISVDYKPSRNKPLSIDDFDLLKVIGKG 379
            Q+P+NL  DSAA IRLYNHHWV L + LG+INISVDYKPS+NK L+IDDFDLLKVIGKG
Sbjct: 295 LQIPINLKFDSAANIRLYNHHWVTLENTLGRINISVDYKPSKNKRLTIDDFDLLKVIGKG 354

Query: 380 SFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPFIVPLKFSFQS 439
           SFGKVMQVRK+DT+KIYALKAIRKSYIVSKSEVTHTLAERTVLAR++CPFIVPLKFSFQS
Sbjct: 355 SFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPFIVPLKFSFQS 414

Query: 440 QEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENI 499
            EKLYLVLACINGGELFYHLQ+EGRF+LSR+RFY AELLCAL+TLH +DVIYRDLKPENI
Sbjct: 415 PEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLDVIYRDLKPENI 474

Query: 500 LLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLY 559
           LLDYQGHIALCDFGLCKLNMKD+DKTDTFCGTPEYLAPELLL QGYSKVVDWWTLG+LLY
Sbjct: 475 LLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLY 534

Query: 560 EMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLLIGLLSRDPQRRLGYNGADEI 619
           EMLTGLPPYYDE+VPKMY+KILQDPL FP+GFDRDAKDLLIGLLSRDP RRLG NGA EI
Sbjct: 535 EMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAKDLLIGLLSRDPDRRLGCNGAHEI 594

Query: 620 KNHPFFSQLSWKRLLMKGYIPPYKPPVTSATDTSNFDQEFTREKPIDSVVDEYLSESVQK 679
           KNHPFFSQLSWKRL  KGYIPPYKPPV+ A DT NFDQEFT+EKPIDSVVDEYLSESVQK
Sbjct: 595 KNHPFFSQLSWKRLWNKGYIPPYKPPVSDAADTRNFDQEFTKEKPIDSVVDEYLSESVQK 654

Query: 680 QFGGWTYVGSEQL 692
           QFGGWTYVGSEQL
Sbjct: 655 QFGGWTYVGSEQL 667

>ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C
           (YPK2) - SH] complement(345955..348123) [2169 bp, 722
           aa]
          Length = 722

 Score =  895 bits (2314), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/551 (77%), Positives = 479/551 (86%), Gaps = 2/551 (0%)

Query: 142 GVMTIKVYNGDGFRLPFPITSNKKILSRLLESGIASDNHDTSLEVEAILQRISRXXXXXX 201
           G+MTIKVYNG+ F+LPF +TSN +IL +LL SG+ + +      V+ ++  + +      
Sbjct: 163 GIMTIKVYNGNSFKLPFALTSNPQILGKLLSSGVNAISRTGRSSVDELISSVEQVTLSED 222

Query: 202 XXXXXXXPGDIATQSIPSTIKLPNSVPLNPLLYFTIEFDNTVATIEPESGTMAQPIFNKI 261
                  PGD AT  IP+TIKLP+S  LNPL+Y TIEFDNTVATIEPE G +  P+FNKI
Sbjct: 223 EDKLL--PGDAATNYIPATIKLPDSEDLNPLIYLTIEFDNTVATIEPECGNLKSPVFNKI 280

Query: 262 STFDVTRKLPQLNIDVFVRIPSILLPPKQWQQEMGAQDEKLQALLDKINTNQDVHLDSFQ 321
           STFDVTRKLP L ++VFVRIPSILLP K WQQ   AQD +LQ LL K+N+N DV LDSFQ
Sbjct: 281 STFDVTRKLPYLKVNVFVRIPSILLPSKAWQQVYAAQDPELQDLLKKVNSNMDVQLDSFQ 340

Query: 322 LPVNLLIDSAATIRLYNHHWVELRDGLGKINISVDYKPSRNKPLSIDDFDLLKVIGKGSF 381
           LP+NL  +SA +IRLYNH W+ +  GLG++NI++DYKPS+NKPLSIDDFDLLKVIGKGSF
Sbjct: 341 LPLNLQFNSATSIRLYNHQWLNMEKGLGRVNITIDYKPSKNKPLSIDDFDLLKVIGKGSF 400

Query: 382 GKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPFIVPLKFSFQSQE 441
           GKVMQV+KKDT KIYALKAIRKSYIVSKSEVTHTLAERTVLAR+D PFIVPLKFSFQS E
Sbjct: 401 GKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSPE 460

Query: 442 KLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILL 501
           KLYLVLA INGGELF+HLQ+EGRFDLSR+RFY AELLCAL+TLH ++VIYRDLKPENILL
Sbjct: 461 KLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILL 520

Query: 502 DYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEM 561
           DYQGHIALCDFGLCKLNMKD+DKT+TFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEM
Sbjct: 521 DYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEM 580

Query: 562 LTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLLIGLLSRDPQRRLGYNGADEIKN 621
           LTGLPPYYDE+VPKMYKKILQ+PL FPDGFDR+AK+LLI LL RDP+RRLGYNGADEIK 
Sbjct: 581 LTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLLIELLCRDPKRRLGYNGADEIKR 640

Query: 622 HPFFSQLSWKRLLMKGYIPPYKPPVTSATDTSNFDQEFTREKPIDSVVDEYLSESVQKQF 681
           HPFFSQLSWKRL MKGYIPPYKPPV SA DTSNFDQEFTREKP+DSVV+++LSESVQ+QF
Sbjct: 641 HPFFSQLSWKRLWMKGYIPPYKPPVMSALDTSNFDQEFTREKPVDSVVNDFLSESVQQQF 700

Query: 682 GGWTYVGSEQL 692
           GGWTYVGSEQL
Sbjct: 701 GGWTYVGSEQL 711

>KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces
           cerevisiae YKL126w YPK1 ser/thr-specific protein kinase,
           start by similarity
          Length = 716

 Score =  865 bits (2234), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/551 (74%), Positives = 470/551 (85%), Gaps = 2/551 (0%)

Query: 142 GVMTIKVYNGDGFRLPFPITSNKKILSRLLESGIASDNHDTSLEVEAILQRISRXXXXXX 201
           G++T+KVY+GD F+LP PIT N+++LS+LL SG+   +      +E ++Q  S       
Sbjct: 156 GILTVKVYSGDSFKLPLPITYNEQVLSKLLSSGVDVTSTTQQDSLEELIQ--SMHGLSLL 213

Query: 202 XXXXXXXPGDIATQSIPSTIKLPNSVPLNPLLYFTIEFDNTVATIEPESGTMAQPIFNKI 261
                   G+ A+  IP+++ LP S  LN LLYFTIEFDNT+ATIEPESGT+ +PIFNKI
Sbjct: 214 REEDKLLSGEDASHFIPASVILPGSKNLNSLLYFTIEFDNTIATIEPESGTLNRPIFNKI 273

Query: 262 STFDVTRKLPQLNIDVFVRIPSILLPPKQWQQEMGAQDEKLQALLDKINTNQDVHLDSFQ 321
           STFDVTR+LP L IDVF RIPSILLP + WQ+   + ++ L   + KI  N D+HLDSF 
Sbjct: 274 STFDVTRRLPFLKIDVFARIPSILLPSQNWQETQISNNDILGDYVKKIRNNSDIHLDSFH 333

Query: 322 LPVNLLIDSAATIRLYNHHWVELRDGLGKINISVDYKPSRNKPLSIDDFDLLKVIGKGSF 381
           LP+NL IDSA+ IRLYNHHW+EL   +GK+N+SVDYKPS +K LSIDDFDLLKVIGKGSF
Sbjct: 334 LPLNLKIDSASNIRLYNHHWIELESKMGKLNLSVDYKPSTHKHLSIDDFDLLKVIGKGSF 393

Query: 382 GKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPFIVPLKFSFQSQE 441
           GKVMQVRK+DT KIYALKAIRKSYIVSKSEVTHTLAERTVLAR+D PFIVPLKFSFQS E
Sbjct: 394 GKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSSE 453

Query: 442 KLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILL 501
           KLYLVLA INGGELFYHLQREGRFDLSRSRFY AELLCAL+ LH  D+IYRDLKPENILL
Sbjct: 454 KLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDIIYRDLKPENILL 513

Query: 502 DYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEM 561
           DYQGHIALCDFGLCKLNMKD++KT TFCGTPEYLAPELLLGQGY+KVVDWWTLGVLLYEM
Sbjct: 514 DYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEM 573

Query: 562 LTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLLIGLLSRDPQRRLGYNGADEIKN 621
           LTGLPPYYDE+VPKMYKKILQDPL FPD FD+DAKDLLIGLL RDP+RRLGY+G+DEIK+
Sbjct: 574 LTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIGLLCRDPKRRLGYHGSDEIKS 633

Query: 622 HPFFSQLSWKRLLMKGYIPPYKPPVTSATDTSNFDQEFTREKPIDSVVDEYLSESVQKQF 681
           HPFF+QLSWKRL MKGYIPPYKPPV  A DTSNFDQEFTRE+P+DSVV+++LSESVQ+QF
Sbjct: 634 HPFFNQLSWKRLKMKGYIPPYKPPVMGAMDTSNFDQEFTREQPVDSVVNDFLSESVQQQF 693

Query: 682 GGWTYVGSEQL 692
           GGWTYVGSEQL
Sbjct: 694 GGWTYVGSEQL 704

>Kwal_26.7635
          Length = 691

 Score =  858 bits (2217), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/551 (74%), Positives = 473/551 (85%), Gaps = 2/551 (0%)

Query: 142 GVMTIKVYNGDGFRLPFPITSNKKILSRLLESGIASDNHDTSLEVEAILQRISRXXXXXX 201
           G+MTIKVY G+  RLPFPITSN +IL +LL SG+ + + D +   + ++  +S+      
Sbjct: 132 GIMTIKVYGGEVLRLPFPITSNVQILKKLLHSGVINQDTDEA-SADELVSSLSQLHLSDG 190

Query: 202 XXXXXXXPGDIATQSIPSTIKLPNSVPLNPLLYFTIEFDNTVATIEPESGTMAQPIFNKI 261
                   G+ AT+ IP+TI LPNS  LNPLLYFT+EFDNTVATIEPESGT++   FNKI
Sbjct: 191 GDEENLIDGNTATRYIPATITLPNSTDLNPLLYFTLEFDNTVATIEPESGTISNLTFNKI 250

Query: 262 STFDVTRKLPQLNIDVFVRIPSILLPPKQWQQEMGAQDEKLQALLDKINTNQDVHLDSFQ 321
           STFDVTRKL  L IDVF RIPSILLP K WQQ + + D  L+ +LD+IN NQD+H+DS+ 
Sbjct: 251 STFDVTRKLNFLKIDVFARIPSILLPSKSWQQ-LNSSDPSLKDILDRINDNQDIHIDSYN 309

Query: 322 LPVNLLIDSAATIRLYNHHWVELRDGLGKINISVDYKPSRNKPLSIDDFDLLKVIGKGSF 381
           LP+ L  D+A++ RLYNH W+ L  G GK+N+SVDYKP+ N+ LS+DDF+LLKVIGKGSF
Sbjct: 310 LPLTLDFDTASSFRLYNHQWIGLAQGNGKLNLSVDYKPATNRALSVDDFELLKVIGKGSF 369

Query: 382 GKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPFIVPLKFSFQSQE 441
           GKVMQVRKKDT K+YALKAIRKSYIVSKSEV HTLAERTVLAR++ PFIVPLKF+FQS +
Sbjct: 370 GKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPFIVPLKFTFQSPD 429

Query: 442 KLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILL 501
           KLY+VLA INGGELFYHLQREGRF LSR+R Y AELLCAL+TLH +DVIYRDLKPENILL
Sbjct: 430 KLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLDVIYRDLKPENILL 489

Query: 502 DYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEM 561
           D+QGHIALCDFGLCKLNMK +DKT+TFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEM
Sbjct: 490 DHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEM 549

Query: 562 LTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLLIGLLSRDPQRRLGYNGADEIKN 621
           +TGLPPYYDE+VPKMYKKILQ+PL FPDGFD+DAKDLLIGLLSRDP+RRLG+NGADEIK+
Sbjct: 550 MTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLLIGLLSRDPKRRLGFNGADEIKS 609

Query: 622 HPFFSQLSWKRLLMKGYIPPYKPPVTSATDTSNFDQEFTREKPIDSVVDEYLSESVQKQF 681
           HPFFSQLSWKRL MKGYIPPYKPPV ++ DTSNFDQEFT+E P+DSVV+++LSESVQ+QF
Sbjct: 610 HPFFSQLSWKRLWMKGYIPPYKPPVMNSLDTSNFDQEFTKELPVDSVVNDFLSESVQQQF 669

Query: 682 GGWTYVGSEQL 692
           GGWTYVGSEQL
Sbjct: 670 GGWTYVGSEQL 680

>CAGL0K07458g complement(736336..738450) similar to sp|P12688
           Saccharomyces cerevisiae YKL126w or sp|P18961
           Saccharomyces cerevisiae YMR104c ser/thr-specific
           protein kinases, start by similarity
          Length = 704

 Score =  771 bits (1992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/553 (65%), Positives = 450/553 (81%), Gaps = 3/553 (0%)

Query: 142 GVMTIKVYNGDGFRLPFPITSNKKILSRLLESGIAS--DNHDTSLEVEAILQRISRXXXX 199
           G++T+KVY+G  F +P PITS++ IL  LL S I+S   +++T  E+E ++ ++S+    
Sbjct: 148 GLLTVKVYSGSNFTMPVPITSDQGILHNLLNSSISSLEGDNNTYAEMEQLITQLSQVHLA 207

Query: 200 XXXXXXXXXPGDIATQSIPSTIKLPNSVPLNPLLYFTIEFDNTVATIEPESGTMAQPIFN 259
                        ++  IP+ IK+P      PL+Y T+E+DNT+ATI PE GT+++P+FN
Sbjct: 208 NQTSEEQLISNAFSSTFIPAVIKVPGHDDY-PLIYMTVEYDNTMATIYPEGGTISKPVFN 266

Query: 260 KISTFDVTRKLPQLNIDVFVRIPSILLPPKQWQQEMGAQDEKLQALLDKINTNQDVHLDS 319
           KISTFDVTRKLP L   VF++IPS LLP  +WQQE    D  ++++L+ I+  +++ LDS
Sbjct: 267 KISTFDVTRKLPFLKCSVFIKIPSALLPSMRWQQEAALADPNMRSILETIHAGKEIFLDS 326

Query: 320 FQLPVNLLIDSAATIRLYNHHWVELRDGLGKINISVDYKPSRNKPLSIDDFDLLKVIGKG 379
           F LPV L ++SA+  RL+NH W+ L+ GLG IN++VD+KPS +KP+ IDDF+LL V+GKG
Sbjct: 327 FTLPVVLDMNSASNFRLFNHQWINLKQGLGTINLTVDFKPSYSKPVGIDDFELLTVLGKG 386

Query: 380 SFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPFIVPLKFSFQS 439
           S+GKVMQVRKKDT+KIYALKAIRKSYIV+KSEV HTLAERT+LAR++CPFIVPLKF+FQ+
Sbjct: 387 SYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVPLKFTFQT 446

Query: 440 QEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENI 499
            EKLYLVLACINGGELF+HLQREG FD+SR+RFYA+ELL ALD+LHKMDV+YRDLKPENI
Sbjct: 447 PEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVYRDLKPENI 506

Query: 500 LLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLY 559
           LLD QGHIALCDFGLCKLNMKD +KT TFCGTPEYLAPE+LLG+GY+KVVDWWTLGVLLY
Sbjct: 507 LLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLY 566

Query: 560 EMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLLIGLLSRDPQRRLGYNGADEI 619
           EMLTGLPPYYDENV +MYKKIL+ PL+FPDG D DAKDLL  LL+RDP RRLG NGADEI
Sbjct: 567 EMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRLLNRDPNRRLGANGADEI 626

Query: 620 KNHPFFSQLSWKRLLMKGYIPPYKPPVTSATDTSNFDQEFTREKPIDSVVDEYLSESVQK 679
           KNH FF+ L W  +  K Y+PP++P V +A DTSNFD EFT++KP+DSV+DEYLSESVQ 
Sbjct: 627 KNHKFFNDLIWDSIWNKEYLPPFRPDVQNANDTSNFDNEFTKQKPVDSVIDEYLSESVQN 686

Query: 680 QFGGWTYVGSEQL 692
           QF GW+Y+GSEQL
Sbjct: 687 QFKGWSYLGSEQL 699

>Kwal_47.16761
          Length = 744

 Score =  353 bits (907), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 195/451 (43%), Positives = 277/451 (61%), Gaps = 54/451 (11%)

Query: 254 AQPIFNKISTFDVTRKLPQLNIDVFVRIPSILLPPKQWQQEMGAQDEKLQALLDKINTNQ 313
           A P+++  +TFDV     +L+I V+                  A D              
Sbjct: 246 ANPVWHHQTTFDVLGAHSELDISVYD----------------AAHD-------------- 275

Query: 314 DVHLDSFQLPVNLLIDSAATIRLYNH-HWVELRDGL------GKINISVDYKPSRNKPLS 366
           D+ L   +L  NL      +    NH  W +L+  +      G I++  D+K +  +   
Sbjct: 276 DMFLGQVRLRPNL-----ESFSHSNHEQWYKLQSRIVGESVTGHISVKWDFKATMKQHYG 330

Query: 367 IDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARI- 425
             DF++L+++GKG+FG+V QVRKKDTK+IYA+K + K  IV K+E+ HT+ ER +L R  
Sbjct: 331 PQDFEVLRLLGKGTFGQVYQVRKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILVRTA 390

Query: 426 --DCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDT 483
              CPFIV LKFSFQ+   LYLV   ++GGELF+HLQ+EGRF   R+RFY AEL+ AL+ 
Sbjct: 391 SKSCPFIVGLKFSFQTPADLYLVTDFMSGGELFWHLQKEGRFAEDRARFYIAELVLALEY 450

Query: 484 LHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQ 543
           LH+ D++YRDLKPENILLD  G+IALCDFGL K ++K  D+T+TFCGT EYLAPELLL +
Sbjct: 451 LHENDIVYRDLKPENILLDANGNIALCDFGLSKADLK--DRTNTFCGTTEYLAPELLLDE 508

Query: 544 -GYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFP-DGFDRDAKDLLIG 601
            GY+K+VD+W+LGVL++EM  G  P++ E+  KMY+KI    + FP D    + +  + G
Sbjct: 509 SGYTKMVDFWSLGVLIFEMCCGWSPFFAEDNQKMYQKIAFGKVKFPRDVLSPEGRSFVKG 568

Query: 602 LLSRDPQRRLGY-NGADEIKNHPFFSQLSWKRLLMKGYIPPYKPPVTSATDTSNFDQEFT 660
           LL+R+P+ RLG  +   E++ HPFF+++ W+ L  K   PP+KP +T  TDTSNFD EFT
Sbjct: 569 LLNRNPRHRLGAIDDGRELRAHPFFAEIDWEALRQKKIPPPFKPHLTGETDTSNFDPEFT 628

Query: 661 REKPI----DSVVDEYLSESVQKQFGGWTYV 687
           +          +    LS ++Q +F G+T+V
Sbjct: 629 QTSTSFMNKQGIAATPLSPAMQAKFVGFTFV 659

>ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH]
           complement(27643..29778) [2136 bp, 711 aa]
          Length = 711

 Score =  350 bits (898), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 195/455 (42%), Positives = 277/455 (60%), Gaps = 59/455 (12%)

Query: 252 TMAQPIFNKISTFDVTRKLPQLNIDVF------VRIPSILLPPKQWQQEMGAQDEKLQAL 305
           T + P+++  +TFDV     +L I V+      V +  + L P                 
Sbjct: 215 TSSNPVWHHETTFDVIGARSELEISVYDAAHGDVFLGQVRLRPN---------------- 258

Query: 306 LDKINTNQDVHLDSFQLPVNLLIDSAATIRLYNHHWVELRDGLGKINISVDYKPSRNKPL 365
               +T  DVH    +L    + +S +                G+I +  +Y  +  +  
Sbjct: 259 ---THTKHDVHNQWSKLNGRTVGESVS----------------GEILVRWEYWHTEKRHY 299

Query: 366 SIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARI 425
              DF++L+++GKG+FG+V QVRKKDTK+IYA+K + K  IV K+E+ HT+ ER +L R 
Sbjct: 300 GPQDFEVLRLLGKGTFGQVYQVRKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILVRT 359

Query: 426 ---DCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALD 482
               CPFIV LKFSFQ+   LYLV   ++GGELF+HLQ+EGRF   R++FY AEL+ AL+
Sbjct: 360 ASKSCPFIVGLKFSFQTPTDLYLVTDFLSGGELFWHLQKEGRFTEERAKFYIAELVLALE 419

Query: 483 TLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLG 542
            LH  D++YRDLKPENILLD  G+IALCDFGL K ++K  D+T+TFCGT EYLAPELLL 
Sbjct: 420 YLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLK--DRTNTFCGTTEYLAPELLLD 477

Query: 543 Q-GYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFP-DGFDRDAKDLLI 600
           + GY+K+VD+W+LGVL++EM  G  P++ E+  KMY+KI    + FP D    + +  + 
Sbjct: 478 ETGYTKMVDFWSLGVLIFEMCCGWSPFFAEDNQKMYQKIAFGKVKFPRDVLSPEGRSFVK 537

Query: 601 GLLSRDPQRRLG-YNGADEIKNHPFFSQLSWKRLLMKGYIPPYKPPVTSATDTSNFDQEF 659
           GLL+R+P+ RLG  N   E++ HPF S + W+ L  K   PP+KP +TS TDTSNFD EF
Sbjct: 538 GLLNRNPKHRLGAVNDGAEVRAHPFLSDIDWEALRNKQIPPPFKPHLTSETDTSNFDPEF 597

Query: 660 TR-------EKPIDSVVDEYLSESVQKQFGGWTYV 687
           T+       ++PI +     LS ++Q +F G+T+V
Sbjct: 598 TQTSTSFMNKQPIAATP---LSPAMQAKFAGFTFV 629

>Scas_703.5
          Length = 749

 Score =  344 bits (882), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 196/465 (42%), Positives = 280/465 (60%), Gaps = 55/465 (11%)

Query: 240 DNTVATIEPESGTMAQPIFNKISTFDVTRKLPQLNIDVFVRIPSILLPPKQWQQEMGAQD 299
           D +  ++E   G  + PI++  +TFDV     +L+I V+                  A D
Sbjct: 244 DTSSGSLEQNDG--SNPIWHHKTTFDVLGAHSELDISVYD----------------AAHD 285

Query: 300 EKLQA---LLDKINTNQDVHLDSFQLPVNLLIDSAATIRLYNHHWVELRDGLGKINISVD 356
           +       L   I+T Q    D +    + ++D   T               G I I  +
Sbjct: 286 DMFMGQVRLRPNIHTTQFASQDKWYPLKSRVLDENVT---------------GDILIKWE 330

Query: 357 YKPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTL 416
           Y  ++ +    +DF++L+++GKG+FG+V QV+KKDTK+IYA+K + K  IV K+EV HT+
Sbjct: 331 YSSTKKRHYGPNDFEVLRLLGKGTFGQVYQVKKKDTKRIYAMKVLSKKVIVKKNEVAHTI 390

Query: 417 AERTVL---ARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFY 473
            ER +L   A    PFIV LKFSFQ+   LYLV   ++GGELF+HLQ+EGRF   R++FY
Sbjct: 391 GERNILVTTATKASPFIVGLKFSFQTPTDLYLVTDFMSGGELFWHLQKEGRFTEERAKFY 450

Query: 474 AAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPE 533
            AEL+ AL+ LH  D++YRDLKPENILLD  G+IALCDFGL K ++K  D+T+TFCGT E
Sbjct: 451 IAELVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLK--DRTNTFCGTTE 508

Query: 534 YLAPELLLGQ-GYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFP-DGF 591
           YLAPELLL + GY+K+VD+W+LGVL++EM  G  P++ E+  KMY+KI    + FP D  
Sbjct: 509 YLAPELLLDEAGYTKMVDFWSLGVLIFEMCCGWSPFFAEDNQKMYQKIAFGKVKFPRDVL 568

Query: 592 DRDAKDLLIGLLSRDPQRRLGY-NGADEIKNHPFFSQLSWKRLLMKGYIPPYKPPVTSAT 650
             + +  + GLL+R+P+ RLG  +   E++ HPFF+ + W  L  K   PP+KP + S T
Sbjct: 569 SPEGRSFVKGLLNRNPKHRLGAIDDGRELRAHPFFADIDWDALREKKIPPPFKPHLVSET 628

Query: 651 DTSNFDQEFT--------REKPIDSVVDEYLSESVQKQFGGWTYV 687
           DTSNFD EFT        + +PI +     LS ++Q +F G+T+V
Sbjct: 629 DTSNFDPEFTQTSTSYMNKHQPIAATP---LSPAMQAKFAGFTFV 670

>YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway that is probably
           parallel to cAMP pathway, affects life span [2475 bp,
           824 aa]
          Length = 824

 Score =  345 bits (886), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 177/369 (47%), Positives = 249/369 (67%), Gaps = 24/369 (6%)

Query: 339 HHWVELRDGL------GKINISVDYKPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDT 392
           H W  L+  +      G I I   YK ++ +     DF++L+++GKG+FG+V QV+KKDT
Sbjct: 375 HQWHSLKPRVIDEVVSGDILIKWTYKQTKKRHYGPQDFEVLRLLGKGTFGQVYQVKKKDT 434

Query: 393 KKIYALKAIRKSYIVSKSEVTHTLAERTVL---ARIDCPFIVPLKFSFQSQEKLYLVLAC 449
           ++IYA+K + K  IV K+E+ HT+ ER +L   A    PFIV LKFSFQ+   LYLV   
Sbjct: 435 QRIYAMKVLSKKVIVKKNEIAHTIGERNILVTTASKSSPFIVGLKFSFQTPTDLYLVTDY 494

Query: 450 INGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIAL 509
           ++GGELF+HLQ+EGRF   R++FY AEL+ AL+ LH  D++YRDLKPENILLD  G+IAL
Sbjct: 495 MSGGELFWHLQKEGRFSEDRAKFYIAELVLALEHLHDNDIVYRDLKPENILLDANGNIAL 554

Query: 510 CDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQ-GYSKVVDWWTLGVLLYEMLTGLPPY 568
           CDFGL K ++K  D+T+TFCGT EYLAPELLL + GY+K+VD+W+LGVL++EM  G  P+
Sbjct: 555 CDFGLSKADLK--DRTNTFCGTTEYLAPELLLDETGYTKMVDFWSLGVLIFEMCCGWSPF 612

Query: 569 YDENVPKMYKKILQDPLVFP-DGFDRDAKDLLIGLLSRDPQRRLGY-NGADEIKNHPFFS 626
           + EN  KMY+KI    + FP D   ++ +  + GLL+R+P+ RLG  +   E++ HPFF+
Sbjct: 613 FAENNQKMYQKIAFGKVKFPRDVLSQEGRSFVKGLLNRNPKHRLGAIDDGRELRAHPFFA 672

Query: 627 QLSWKRLLMKGYIPPYKPPVTSATDTSNFDQEFT--------REKPIDSVVDEYLSESVQ 678
            + W+ L  K   PP+KP + S TDTSNFD EFT        + +P+ +     LS ++Q
Sbjct: 673 DIDWEALKQKKIPPPFKPHLVSETDTSNFDPEFTTASTSYMNKHQPMMTATP--LSPAMQ 730

Query: 679 KQFGGWTYV 687
            +F G+T+V
Sbjct: 731 AKFAGFTFV 739

>CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces
           cerevisiae YHR205w SCH9 serine/threonine protein kinase,
           start by similarity
          Length = 746

 Score =  342 bits (876), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 181/391 (46%), Positives = 255/391 (65%), Gaps = 23/391 (5%)

Query: 316 HLDSFQLPVNLLIDSAATIRLYNHHWVELRDGL------GKINISVDYKPSRNKPLSIDD 369
           H D F   V L  +   T  + +  W  L+  +      G+I +   Y  ++ +     D
Sbjct: 280 HEDMFLGQVRLRPNIHTTSNMSHEQWYPLQSRVMDEKITGEILVKWHYTLTKKRHYGPQD 339

Query: 370 FDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDC-- 427
           F++L+++GKG+FG+V QV+KKDTK+IYA+K + K  IV K+E+ HT+ ER +L       
Sbjct: 340 FEVLRLLGKGTFGQVYQVKKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILVTTSSKA 399

Query: 428 -PFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHK 486
            PFIV LKFSFQ+   LYLV   ++GGELF+HLQREGRF   R++FY AEL+ AL+ LH 
Sbjct: 400 SPFIVGLKFSFQTPTDLYLVTDYMSGGELFWHLQREGRFTEDRAKFYIAELVLALEHLHD 459

Query: 487 MDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQ-GY 545
            D++YRDLKPENILLD  G+IALCDFGL K ++K  D+T+TFCGT EYLAPELLL + GY
Sbjct: 460 NDIVYRDLKPENILLDANGNIALCDFGLSKADLK--DRTNTFCGTTEYLAPELLLDESGY 517

Query: 546 SKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFP-DGFDRDAKDLLIGLLS 604
           +K+VD+W+LGVL++EM  G  P+Y E+  KMY+KI    + FP D    + +  + GLL+
Sbjct: 518 TKMVDFWSLGVLIFEMCCGWSPFYAEDNQKMYQKIAFGKVKFPRDILSPEGRSFVKGLLN 577

Query: 605 RDPQRRLGY-NGADEIKNHPFFSQLSWKRLLMKGYIPPYKPPVTSATDTSNFDQEFTREK 663
           R+P+ RLG  +   E++ HPFF+ + W+ L  K   PP+KP + S TDTSNFD EFT+  
Sbjct: 578 RNPKHRLGAIDDGRELRAHPFFADIDWELLKQKKIPPPFKPHLVSETDTSNFDPEFTQTS 637

Query: 664 PIDSVVDEY-------LSESVQKQFGGWTYV 687
              S ++++       LS  +Q +F G+T+V
Sbjct: 638 --TSYMNKHHQMAATPLSPGMQAKFAGFTFV 666

>KLLA0B03586g complement(326871..329075) similar to sp|P11792
           Saccharomyces cerevisiae YHR205w SCH9 serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway, start by similarity
          Length = 734

 Score =  336 bits (862), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 171/352 (48%), Positives = 242/352 (68%), Gaps = 18/352 (5%)

Query: 349 GKINISVDYKPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVS 408
           G I I  +Y  ++ +     DF++L+++GKG+FG+V QVRKKDT +IYA+K + K  IV 
Sbjct: 304 GDILIHWEYTSTKKRQYGPQDFEVLRLLGKGTFGQVYQVRKKDTMRIYAMKVLSKKVIVK 363

Query: 409 KSEVTHTLAERTVLARI---DCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRF 465
           K+E+ HT+ ER +L R      PFIV LKFSFQ+   LYLV   ++GGELF+HLQ+EGRF
Sbjct: 364 KNEIAHTIGERNILVRTASKSSPFIVGLKFSFQTPTDLYLVTDFMSGGELFWHLQKEGRF 423

Query: 466 DLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKT 525
              R++FY AEL+ AL+ LH  D++YRDLKPENILLD  G+IALCDFGL K ++K  D+T
Sbjct: 424 TEDRAKFYIAELVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLK--DRT 481

Query: 526 DTFCGTPEYLAPELLLGQ-GYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDP 584
           +TFCGT EYLAPELL+ + GY+K+VD+W+LGVL++EM  G  P++  +  KMY+KI    
Sbjct: 482 NTFCGTTEYLAPELLMDETGYTKMVDFWSLGVLIFEMCCGWSPFFASDNQKMYQKIAFGK 541

Query: 585 LVFP-DGFDRDAKDLLIGLLSRDPQRRLGY-NGADEIKNHPFFSQLSWKRLLMKGYIPPY 642
           + FP D    + +  + GLL+R+P+ RLG  +   E++ HPFF+ + W+ +  K   PP+
Sbjct: 542 VKFPRDVLSPEGRSFVKGLLNRNPKHRLGAIDDGRELRAHPFFNDIDWEAVRQKKIPPPF 601

Query: 643 KPPVTSATDTSNFDQEFTR-------EKPIDSVVDEYLSESVQKQFGGWTYV 687
           KP + S TDTSNFD EFT+       ++PI +     LS ++Q +F G+T+V
Sbjct: 602 KPHLISETDTSNFDPEFTQTSTSFMNKQPIAATP---LSPAMQAKFVGFTFV 650

>KLLA0B07205g complement(624606..625973) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3
           cAMP-dependent protein kinase 3, catalytic chain,
           hypothetical start
          Length = 455

 Score =  278 bits (711), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 134/292 (45%), Positives = 194/292 (66%), Gaps = 6/292 (2%)

Query: 369 DFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCP 428
           DF +L+ +G GSFG+V  VR     + YA+K ++K+ +V   +V HT  ER +L+ +  P
Sbjct: 144 DFQILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKNTVVKLKQVEHTNDERNMLSIVSHP 203

Query: 429 FIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMD 488
           FI+ +  +FQ  ++L++++  I GGELF  L++  RF    ++FYAAE+  AL+ LH   
Sbjct: 204 FIIRMWGTFQDSQQLFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKG 263

Query: 489 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKV 548
           +IYRDLKPENILLD  GHI L DFG  K      D T T CGTP+Y+APE++  + Y+K 
Sbjct: 264 IIYRDLKPENILLDKNGHIKLTDFGFAKY---VPDVTYTLCGTPDYIAPEVVSTKPYNKS 320

Query: 549 VDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLLIGLLSRDPQ 608
           VDWW+ GVL+YEML G  P+YD N  K Y+ IL  P+ FP  F  DA+DL+  L++RD  
Sbjct: 321 VDWWSFGVLIYEMLAGYTPFYDSNTIKTYENILNAPVRFPPFFHSDAQDLISKLITRDLS 380

Query: 609 RRLG--YNGADEIKNHPFFSQLSWKRLLMKGYIPPYKPPVTSAT-DTSNFDQ 657
           +RLG   NG++++KNHP+FS++ W++LL K    PY+PP+ +   DTS +D+
Sbjct: 381 QRLGNLQNGSEDVKNHPWFSEVVWEKLLCKNIETPYEPPIQAGQGDTSQYDR 432

>CAGL0M08404g complement(836791..838179) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3 or
           sp|P06244 Saccharomyces cerevisiae YJL164c SRA3 or
           sp|P06245 Saccharomyces cerevisiae YPL203w TPK2,
           hypothetical start
          Length = 462

 Score =  276 bits (706), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 134/304 (44%), Positives = 196/304 (64%), Gaps = 6/304 (1%)

Query: 357 YKPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTL 416
           Y  + +   ++ DF +L+ +G GSFG+V  +R     + YALKA++K  +V   +V HT 
Sbjct: 139 YGANTSGKYTLSDFQILRTLGTGSFGRVHLIRSNHNGRFYALKALKKHTVVKLKQVEHTN 198

Query: 417 AERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAE 476
            ER +L+ +  PFI+ +  +FQ  + +++V+  I GGELF  L++  RF    ++FYAAE
Sbjct: 199 DERRMLSIVSHPFIIRMWGTFQDSQHVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAE 258

Query: 477 LLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLA 536
           +  AL+ LH  ++IYRDLKPENILLD  GHI + DFG  K      D T T CGTP+Y+A
Sbjct: 259 VCLALEYLHSKEIIYRDLKPENILLDKNGHIKITDFGFAKYV---PDVTYTLCGTPDYIA 315

Query: 537 PELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAK 596
           PE++  + Y+K VDWW+ G+L+YEML G  P+YD N  K Y+ IL   L FP  F  D +
Sbjct: 316 PEVVSTKPYNKSVDWWSFGILIYEMLAGYTPFYDANTMKTYEHILNSELKFPSFFHPDVQ 375

Query: 597 DLLIGLLSRDPQRRLG--YNGADEIKNHPFFSQLSWKRLLMKGYIPPYKPPVTSAT-DTS 653
           DLL  L++RD  +RLG   NG++++KNHP+FS++ W++LL +    PY+PP+     DTS
Sbjct: 376 DLLSKLITRDLSKRLGNLQNGSEDVKNHPWFSEVVWEKLLARYIETPYEPPIQQGQGDTS 435

Query: 654 NFDQ 657
            FD+
Sbjct: 436 QFDR 439

>Scas_689.25*
          Length = 409

 Score =  274 bits (700), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 139/295 (47%), Positives = 191/295 (64%), Gaps = 6/295 (2%)

Query: 366 SIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARI 425
           +IDDF++L+  G GSFG+V  VR     + YALK ++K  +V   +V HT  ER +L+  
Sbjct: 95  TIDDFNILRTSGTGSFGRVHLVRSVHNGRFYALKVLKKQTVVRLKQVEHTNDERRMLSVS 154

Query: 426 DCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLH 485
              FIV L  +FQ  E L++++  + GGELF  L+R  RF    ++FYAAE+  ALD LH
Sbjct: 155 VHAFIVRLWGTFQDSEHLFMIMDYVEGGELFSLLRRSQRFPNPVAKFYAAEVCLALDYLH 214

Query: 486 KMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGY 545
            +D+IYRDLKPEN+LLD  GHI + DFG  K      D T T CGTP+Y+APE++  + Y
Sbjct: 215 SLDIIYRDLKPENLLLDRNGHIKVTDFGFAKYV---PDVTYTLCGTPDYIAPEVISAKPY 271

Query: 546 SKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLLIGLLSR 605
           +K VDWW+ G+L+YEML+G  P+YD +  K Y+ IL  PL FP  F  DA+DLL  L++R
Sbjct: 272 NKSVDWWSFGILIYEMLSGHTPFYDSSTMKTYENILNAPLKFPKYFTPDAQDLLSRLITR 331

Query: 606 DPQRRLG--YNGADEIKNHPFFSQLSWKRLLMKGYIPPYKPPVTSAT-DTSNFDQ 657
           D   RLG   NG ++IKNH +FS++ W +LL +    PY+PP+     DTS FD+
Sbjct: 332 DLTERLGNLQNGTEDIKNHAWFSEVIWDKLLDRCIETPYEPPIQQGQGDTSQFDR 386

>Kwal_33.13846
          Length = 375

 Score =  272 bits (696), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 130/295 (44%), Positives = 193/295 (65%), Gaps = 6/295 (2%)

Query: 366 SIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARI 425
           +++DF +L+ +G GSFG+V  VR     + YA+K ++K  IV   +V HT  ER +L+ +
Sbjct: 61  TLNDFHILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKRTIVKLKQVEHTNDERRMLSVV 120

Query: 426 DCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLH 485
             PFI+ +  +FQ  E +++++  I GGELF  L++  RF    ++FYAAE+  AL+ LH
Sbjct: 121 SHPFIIRMWGTFQDAEHVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLH 180

Query: 486 KMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGY 545
             D+IYRDLKPEN+LLD  GH+ + DFG  K      D T T CGTP+Y+APE++  + Y
Sbjct: 181 AQDIIYRDLKPENVLLDKNGHVKITDFGFAKFV---PDVTYTLCGTPDYIAPEVVSTKPY 237

Query: 546 SKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLLIGLLSR 605
           +K VDWW+ G+L++EML G  P+YD N  K Y+ IL   L FP  F  D +DLL  L++R
Sbjct: 238 NKSVDWWSFGILIFEMLAGYTPFYDSNTMKTYENILNAELQFPPFFHSDVQDLLSQLITR 297

Query: 606 DPQRRLG--YNGADEIKNHPFFSQLSWKRLLMKGYIPPYKPPVTSAT-DTSNFDQ 657
           D  +RLG   NG++++KNH +FS++ W++LL +    PY+PPV +   DTS +D+
Sbjct: 298 DLSKRLGNLKNGSEDVKNHAWFSEVVWEKLLCRNIETPYEPPVQAGQGDTSQYDR 352

>Scas_651.18
          Length = 371

 Score =  272 bits (695), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 133/295 (45%), Positives = 194/295 (65%), Gaps = 6/295 (2%)

Query: 366 SIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARI 425
           +++DF +L+ +G GSFG+V  +R     + YALK ++K  IV   +V HT  ER +L+ +
Sbjct: 55  TLNDFQILRTLGTGSFGRVHLIRSNHNGRFYALKVLKKHTIVKLKQVEHTNDERLMLSVV 114

Query: 426 DCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLH 485
             PF+V +  +FQ  E++++++  I GGELF  L++  RF    ++FYAAE+  AL+ LH
Sbjct: 115 SHPFLVRMWGTFQDFEQVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLH 174

Query: 486 KMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGY 545
            MD+IYRDLKPENILLD  GHI + DFG  K      D T T CGTP+Y+APE++  + Y
Sbjct: 175 SMDIIYRDLKPENILLDKNGHIKITDFGFAKYV---PDITYTLCGTPDYIAPEVVSTKPY 231

Query: 546 SKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLLIGLLSR 605
           +K VDWW+ G+L+YEML G  P+YD N  K Y+ IL   L FP+ F  D KDLL  L+++
Sbjct: 232 NKSVDWWSFGILIYEMLAGYTPFYDSNTMKTYENILNCKLKFPNFFHDDVKDLLSKLITK 291

Query: 606 DPQRRLG--YNGADEIKNHPFFSQLSWKRLLMKGYIPPYKPPVTSAT-DTSNFDQ 657
           +   RLG   NG++++K HP+FS++ W++LL +    PY+PP+     DTS FD+
Sbjct: 292 NLTERLGNLQNGSEDVKRHPWFSEVIWEKLLSRNIETPYEPPIQQGQGDTSQFDR 346

>CAGL0G09020g 860266..861351 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, hypothetical start
          Length = 361

 Score =  271 bits (692), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 134/295 (45%), Positives = 194/295 (65%), Gaps = 6/295 (2%)

Query: 366 SIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARI 425
           S+ DF +++ +G GSFG+V  VR     + YA+K ++K+ +V   ++ HT  ER +L  +
Sbjct: 47  SLQDFHIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKAQVVKMKQIEHTNDERRMLKLV 106

Query: 426 DCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLH 485
           + PF++ +  +FQ    L++V+  I GGELF  L++  RF    ++FYAAE+  AL+ LH
Sbjct: 107 EHPFLIRMWGTFQDSRNLFMVMDYIEGGELFTLLRKSQRFPNPVAKFYAAEVTLALEYLH 166

Query: 486 KMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGY 545
             ++IYRDLKPENILLD  GHI + DFG  K   + E  T T CGTP+Y+APE++  + Y
Sbjct: 167 FHNIIYRDLKPENILLDRNGHIKITDFGFAK---EVETVTWTLCGTPDYIAPEVIATKPY 223

Query: 546 SKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLLIGLLSR 605
           +K VDWW+LGVL+YEML G  P+YD    K Y+KIL   +V+P  F+ D  DLL  LL+ 
Sbjct: 224 NKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILHGKVVYPQFFNSDVIDLLSKLLTA 283

Query: 606 DPQRRLG--YNGADEIKNHPFFSQLSWKRLLMKGYIPPYKPPVTSAT-DTSNFDQ 657
           D  RR+G    GA +IK+HP+F+++ W++LL K    PY+PP+T+   DTS FDQ
Sbjct: 284 DLTRRIGNLQKGAQDIKSHPWFAEVVWEKLLAKDIETPYEPPITAGVGDTSLFDQ 338

>Kwal_56.24059
          Length = 353

 Score =  269 bits (688), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 140/328 (42%), Positives = 206/328 (62%), Gaps = 12/328 (3%)

Query: 337 YNHHWVELRDGLGKINISVDYKPSRNK----PLSIDDFDLLKVIGKGSFGKVMQVRKKDT 392
           Y    V  R G+G+   S+   P R+       S++DF +L+ +G GSFG+V  VR    
Sbjct: 8   YGQTMVSDRPGMGERQRSM--LPQRSAVSKGKYSLNDFQILRTLGTGSFGRVHLVRSVHN 65

Query: 393 KKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPFIVPLKFSFQSQEKLYLVLACING 452
            + YA+K ++K  ++   ++ HT  ER +L  +D PF++ +  +FQ    L++V+  I G
Sbjct: 66  GRYYAIKVLKKEQVIRMKQIEHTNDERRMLKLVDHPFLIRMWGTFQDSRNLFMVMDYIEG 125

Query: 453 GELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDF 512
           GELF  L++  RF    ++FYAAE++ AL+ LH  D+IYRDLKPENILLD  GHI + DF
Sbjct: 126 GELFSLLRKSQRFPNPVAKFYAAEVILALEYLHSHDIIYRDLKPENILLDRNGHIKITDF 185

Query: 513 GLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEN 572
           G  K   + +  T T CGTP+Y+APE++  + Y+K VDWW+LG+L++EML G  P+YD  
Sbjct: 186 GFAK---EVDTVTWTLCGTPDYIAPEVIATKPYNKSVDWWSLGILIFEMLAGYTPFYDAT 242

Query: 573 VPKMYKKILQDPLVFPDGFDRDAKDLLIGLLSRDPQRRLG--YNGADEIKNHPFFSQLSW 630
             K Y+KILQ  + +P  F  D  DLL  L++ D  RRLG   +G  ++K+HP+FS++ W
Sbjct: 243 PMKTYEKILQGKVAYPPFFHPDVVDLLCKLITSDLTRRLGNLQSGPQDVKSHPWFSEVVW 302

Query: 631 KRLLMKGYIPPYKPPVTSAT-DTSNFDQ 657
           ++LL K    PY+PP+T+   DTS FDQ
Sbjct: 303 EKLLAKDIETPYEPPITAGVGDTSLFDQ 330

>AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH]
           complement(274336..275376) [1041 bp, 346 aa]
          Length = 346

 Score =  261 bits (667), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 130/295 (44%), Positives = 194/295 (65%), Gaps = 6/295 (2%)

Query: 366 SIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARI 425
           S+ DF +++ +G GSFG+V  VR     + YA+K ++K  ++   ++ HT  ER +L  +
Sbjct: 32  SLQDFQIMRTLGTGSFGRVHLVRSIHNGRYYAIKVLKKQQVIRMKQIEHTNDERRMLKVV 91

Query: 426 DCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLH 485
           + PF++ +  +FQ    L++V+  I GGELF  L++  RF    ++FYAAE+  AL+ LH
Sbjct: 92  EHPFLIRMWGTFQDARNLFIVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLH 151

Query: 486 KMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGY 545
             ++IYRDLKPENILLD  GHI + DFG  K   + +  T T CGTP+Y+APE++  + Y
Sbjct: 152 AHNIIYRDLKPENILLDRNGHIKITDFGFAK---EVDTVTWTLCGTPDYIAPEVITTKPY 208

Query: 546 SKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLLIGLLSR 605
           +K +DWW+LG+L++EML G  P+YD    K Y+KIL   +VFP  F  DA DLL  L++ 
Sbjct: 209 NKSIDWWSLGILIFEMLAGYTPFYDVTPIKTYEKILAGKVVFPPFFHPDAIDLLGKLITD 268

Query: 606 DPQRRLG--YNGADEIKNHPFFSQLSWKRLLMKGYIPPYKPPVTSAT-DTSNFDQ 657
           D  RRLG   +G+ +IK+HP+FS++ W++LL K    PY+PP+T+   D+S FDQ
Sbjct: 269 DLTRRLGNLQSGSQDIKSHPWFSEVIWEKLLAKDIETPYEPPITAGVGDSSLFDQ 323

>Scas_690.13
          Length = 354

 Score =  258 bits (659), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 129/295 (43%), Positives = 191/295 (64%), Gaps = 6/295 (2%)

Query: 366 SIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARI 425
           ++ DF +++ +G GSFG+V  VR     + YA+K ++K  +V   ++ HT  ER +L  +
Sbjct: 40  TLHDFQVMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVRMKQIEHTNDERRMLKLV 99

Query: 426 DCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLH 485
           + PF++ +  +FQ    L++V+  I GGELF  L++  RF    ++FYAAE+   L+ LH
Sbjct: 100 EHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLGLEYLH 159

Query: 486 KMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGY 545
             ++IYRDLKPENILLD  GHI + DFG  K   + +  T T CG P+Y+APE++  + Y
Sbjct: 160 SHNIIYRDLKPENILLDRNGHIKITDFGFAK---EVDTVTWTLCGPPDYIAPEVIATKPY 216

Query: 546 SKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLLIGLLSR 605
           +K VDWW+LGVL++EML G  P+YD    K Y+KILQ  +V+P  F  D  DLL  L++ 
Sbjct: 217 NKSVDWWSLGVLIFEMLAGYTPFYDTTPMKTYEKILQGKVVYPTFFHPDVVDLLGKLITA 276

Query: 606 DPQRRLG--YNGADEIKNHPFFSQLSWKRLLMKGYIPPYKPPVTSAT-DTSNFDQ 657
           D  RR+G   +G+ +IK HP+FS++ W++LL K    PY+PP+T+   DTS FDQ
Sbjct: 277 DLTRRIGNLQSGSKDIKCHPWFSEVVWEKLLAKDIETPYEPPITTGIGDTSLFDQ 331

>KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732.1
            Kluyveromyces lactis protein kinase C, start by
            similarity
          Length = 1161

 Score =  275 bits (702), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 139/328 (42%), Positives = 206/328 (62%), Gaps = 6/328 (1%)

Query: 365  LSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVL-- 422
            +S+DDF LLKV+GKG+FGKV+  R K+T  + A+K ++K  I+   ++    AE+ V   
Sbjct: 829  VSLDDFILLKVLGKGNFGKVLLARSKNTSNLCAIKVLKKDNIIKNHDIESARAEKKVFLL 888

Query: 423  -ARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCAL 481
                  PF+  L  SFQ++ ++Y  +  I GG+L +H+Q   R  + R++FYAAE+L +L
Sbjct: 889  ATETKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNR-RLSVRRAKFYAAEVLLSL 947

Query: 482  DTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLL 541
               H   VIYRDLK ENILL  +GHI + D+GLCK NM   +KT TFCGTPE++APE+L 
Sbjct: 948  KYFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDNMWYGNKTSTFCGTPEFMAPEILK 1007

Query: 542  GQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLLIG 601
            GQ Y+K VDWWT GVLLY+ML    P+  E+  +++  IL D  ++P     D   +  G
Sbjct: 1008 GQAYTKAVDWWTFGVLLYQMLLCQSPFSGEDEDEVFNAILTDEPLYPIDMAGDIVQIFQG 1067

Query: 602  LLSRDPQRRLGYNGAD--EIKNHPFFSQLSWKRLLMKGYIPPYKPPVTSATDTSNFDQEF 659
            LL++DP++RLG    D  EI   PFFS +++  +L     PP+ P + +A DTS F++EF
Sbjct: 1068 LLTKDPEKRLGAGPKDALEIMAEPFFSNINFDDILNLRVEPPFVPEIKAADDTSYFEKEF 1127

Query: 660  TREKPIDSVVDEYLSESVQKQFGGWTYV 687
            T   P  + +   LS  +Q++F G++++
Sbjct: 1128 TSAPPTLTPLPSVLSSVLQEEFRGFSFM 1155

>ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..683847)
            [3450 bp, 1149 aa]
          Length = 1149

 Score =  273 bits (698), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 136/334 (40%), Positives = 210/334 (62%), Gaps = 7/334 (2%)

Query: 359  PSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAE 418
            P R K +S+DDF LLKV+GKG+FGKV+  R K+T ++ A+K ++K +I+   ++    AE
Sbjct: 812  PKRRK-VSLDDFILLKVLGKGNFGKVLLARSKNTDRLCAIKVLKKDHIIQNHDIESARAE 870

Query: 419  RTVL---ARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAA 475
            + V     +   PF+  L  SFQ++ ++Y  +  I GG+L +H+Q + R  + R++FYAA
Sbjct: 871  KKVFLLATKAKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQ-RLSVRRAKFYAA 929

Query: 476  ELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYL 535
            E+L AL   H   +IYRDLK ENILL  +GHI + D+GLCK  M   ++T TFCGTPE++
Sbjct: 930  EVLLALKYFHDNGIIYRDLKLENILLTLEGHIKIADYGLCKDEMWFGNRTSTFCGTPEFM 989

Query: 536  APELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDA 595
            APE+L  Q Y+K VDWW  GVLLY+ML    P+  ++  +++  IL D  ++P     D 
Sbjct: 990  APEILREQAYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGDI 1049

Query: 596  KDLLIGLLSRDPQRRLGYNGAD--EIKNHPFFSQLSWKRLLMKGYIPPYKPPVTSATDTS 653
              +  GLL++DP++RLG    D  E+   PFF  +++  +L     PPY P + +A DTS
Sbjct: 1050 VQIFQGLLTKDPEKRLGAGSRDALEVMEEPFFRNINFDDILNLRVEPPYIPTIKAADDTS 1109

Query: 654  NFDQEFTREKPIDSVVDEYLSESVQKQFGGWTYV 687
             F++EFT   P  + +   LS ++Q++F G++++
Sbjct: 1110 YFEKEFTAAPPTLTPLPSILSSNLQEEFRGFSFM 1143

>KLLA0D03190g 267933..269051 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, start by similarity
          Length = 372

 Score =  256 bits (654), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 127/295 (43%), Positives = 190/295 (64%), Gaps = 6/295 (2%)

Query: 366 SIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARI 425
           ++ DF +++ +G GSFG+V  VR     + YA+K ++K  I+   ++ HT  ER +L  +
Sbjct: 58  TLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKHQIIRMKQIEHTNDERRMLKLV 117

Query: 426 DCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLH 485
           + PF++ +  +FQ    L++V+  I GGELF  L++  RF    ++FYAAE+  AL+ LH
Sbjct: 118 EHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLH 177

Query: 486 KMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGY 545
             ++IYRDLKPENILLD  GHI + DFG  K  +     T T CGTP+Y+APE++  + Y
Sbjct: 178 SHNIIYRDLKPENILLDRNGHIKITDFGFAKEVIT---VTWTLCGTPDYIAPEVITTKPY 234

Query: 546 SKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLLIGLLSR 605
           +K VDWW+LG+L++EML G  P+YD    K Y+KIL   +V+P  F  D  DLL  L++ 
Sbjct: 235 NKSVDWWSLGILIFEMLAGYTPFYDVTPMKTYEKILAGEVVYPPFFHPDVVDLLGKLITA 294

Query: 606 DPQRRLG--YNGADEIKNHPFFSQLSWKRLLMKGYIPPYKPPVTSAT-DTSNFDQ 657
           D  RRLG   +G D+IK+HP+F+++ W++L+ K    PY+PP+     D+S FDQ
Sbjct: 295 DLTRRLGNLQSGPDDIKSHPWFAEVIWEKLVAKDIETPYEPPIAVGVGDSSLFDQ 349

>CAGL0M09361g complement(928484..931918) highly similar to sp|P24583
            Saccharomyces cerevisiae YBL105c PKC1 ser/thr protein
            kinase, start by similarity
          Length = 1144

 Score =  273 bits (698), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 141/335 (42%), Positives = 208/335 (62%), Gaps = 6/335 (1%)

Query: 358  KPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLA 417
            + S+   +S+D+F LLKV+GKG+FGKV+  R K+T ++ A+K ++K  I+   ++    A
Sbjct: 805  RGSKRPKVSLDNFVLLKVLGKGNFGKVILSRSKNTNRLCAIKVLKKDNIIQNHDIESARA 864

Query: 418  ERTVL---ARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYA 474
            E+ V     +   PF+  L  SFQ++ ++Y  +  I GG+L +H+Q + R  + R++FYA
Sbjct: 865  EKKVFLLATKTKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQ-RLSVRRAKFYA 923

Query: 475  AELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEY 534
            AE+L AL   H   VIYRDLK ENILL  +GHI + D+GLCK  M   +KT TFCGTPE+
Sbjct: 924  AEVLLALKFFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDGMWYGNKTSTFCGTPEF 983

Query: 535  LAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRD 594
            +APELL  Q Y+K VDWW  GVLLY+ML    P+  ++  +++  IL D  ++P     D
Sbjct: 984  MAPELLREQDYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGD 1043

Query: 595  AKDLLIGLLSRDPQRRLGYNGAD--EIKNHPFFSQLSWKRLLMKGYIPPYKPPVTSATDT 652
               +  GLL++DP++RLG    D  EI   PFF  +++  LL     PPY P + SA DT
Sbjct: 1044 IVQIFQGLLTKDPEKRLGAGPRDALEIMEEPFFRNINFDDLLNLRIKPPYIPEIKSAEDT 1103

Query: 653  SNFDQEFTREKPIDSVVDEYLSESVQKQFGGWTYV 687
            S F+QEFT   P  + +   LS + Q++F G++Y+
Sbjct: 1104 SYFEQEFTSAPPSLTPLPSVLSTTQQEEFRGFSYM 1138

>Kwal_27.10581
          Length = 1154

 Score =  271 bits (693), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 138/334 (41%), Positives = 208/334 (62%), Gaps = 7/334 (2%)

Query: 359  PSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAE 418
            P R K +S+DDF LLKV+GKG+FGKV+    K+ +++ A+K ++K +I+   ++    AE
Sbjct: 817  PKRRK-ISLDDFVLLKVLGKGNFGKVLLAESKNNERLCAIKVLKKDHIIKNHDIESARAE 875

Query: 419  RTVL---ARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAA 475
            + V     +   PF+  L  SFQ++ ++Y  +  I GG+L +H+Q + R  + R++FYAA
Sbjct: 876  KKVFLLATKAKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQ-RLSVRRAKFYAA 934

Query: 476  ELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYL 535
            E+L AL   H   VIYRDLK ENILL  +GHI + D+GLCK  M   +KT TFCGTPE++
Sbjct: 935  EVLLALKYFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDEMWYGNKTSTFCGTPEFM 994

Query: 536  APELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDA 595
            APE+L  Q Y+K VDWW  GVLLY+ML    P+  E+  +++  IL D  ++P     D 
Sbjct: 995  APEILKEQEYTKAVDWWAFGVLLYQMLLCQSPFSGEDEDEVFNAILTDEPLYPIDMAGDI 1054

Query: 596  KDLLIGLLSRDPQRRLGYNGAD--EIKNHPFFSQLSWKRLLMKGYIPPYKPPVTSATDTS 653
              +  GLL++DP+RRLG    D  E+   PFF  + +  +L     PPY P + +A DTS
Sbjct: 1055 VQIFQGLLTKDPERRLGAGPRDAAEVMAEPFFRNIVFDDILNLRVQPPYIPEIKAADDTS 1114

Query: 654  NFDQEFTREKPIDSVVDEYLSESVQKQFGGWTYV 687
             F++EFT   P  + +   LS ++Q++F G++++
Sbjct: 1115 YFEKEFTSAPPTLTPLPSVLSSNLQEEFRGFSFM 1148

>Scas_715.34
          Length = 1150

 Score =  270 bits (691), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 135/335 (40%), Positives = 208/335 (62%), Gaps = 6/335 (1%)

Query: 358  KPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLA 417
            + S+ + +S+D+F LLKV+GKG+FGKV+  R K+T ++ A+K ++K  I+   ++    A
Sbjct: 811  RNSKRRKVSLDNFILLKVLGKGNFGKVILSRSKNTGRLCAIKVLKKDNIIQNHDIESARA 870

Query: 418  ERTVL---ARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYA 474
            E+ V     +   PF+  L  SFQ++ ++Y  +  I GG+L +H+Q + R  + R++FYA
Sbjct: 871  EKKVFLLATKTKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQ-RLSVRRAKFYA 929

Query: 475  AELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEY 534
            AE+L AL   H   VIYRDLK ENILL  QGHI + D+GLCK  M   +KT TFCGTPE+
Sbjct: 930  AEVLLALKYFHDNGVIYRDLKLENILLTPQGHIKIADYGLCKDEMWYNNKTSTFCGTPEF 989

Query: 535  LAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRD 594
            +APE+L  QGY++ VDWW  GVLLY+ML    P+  ++  +++  IL D  ++P     D
Sbjct: 990  MAPEILKEQGYTRAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGD 1049

Query: 595  AKDLLIGLLSRDPQRRLGYNGAD--EIKNHPFFSQLSWKRLLMKGYIPPYKPPVTSATDT 652
               +  GLL++DP+ RLG    D  E+   PFF  ++++ +L     PPY P + S  DT
Sbjct: 1050 IVQIFQGLLTKDPENRLGAGQRDALEVMEEPFFRNINFEDILNLRVQPPYVPEIKSPEDT 1109

Query: 653  SNFDQEFTREKPIDSVVDEYLSESVQKQFGGWTYV 687
            S F+ EFT   P  + +   L+ + Q++F G++++
Sbjct: 1110 SYFEHEFTSAPPTLTPLPSILTTTQQEEFRGFSFM 1144

>YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase C,
            regulates MAP kinase cascade involved in regulating cell
            wall metabolism [3456 bp, 1151 aa]
          Length = 1151

 Score =  267 bits (682), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 133/335 (39%), Positives = 209/335 (62%), Gaps = 6/335 (1%)

Query: 358  KPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLA 417
            + ++ + +S+D+F LLKV+GKG+FGKV+  + K+T ++ A+K ++K  I+   ++    A
Sbjct: 812  RAAKRRKVSLDNFVLLKVLGKGNFGKVILSKSKNTDRLCAIKVLKKDNIIQNHDIESARA 871

Query: 418  ERTVL---ARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYA 474
            E+ V     +   PF+  L  SFQ++ ++Y  +  I GG+L +H+Q + R  + R++FYA
Sbjct: 872  EKKVFLLATKTKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQ-RLSVRRAKFYA 930

Query: 475  AELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEY 534
            AE+L AL   H   VIYRDLK ENILL  +GHI + D+GLCK  M   ++T TFCGTPE+
Sbjct: 931  AEVLLALKYFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDEMWYGNRTSTFCGTPEF 990

Query: 535  LAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRD 594
            +APE+L  Q Y+K VDWW  GVLLY+ML    P+  ++  +++  IL D  ++P     +
Sbjct: 991  MAPEILKEQEYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGE 1050

Query: 595  AKDLLIGLLSRDPQRRLGY--NGADEIKNHPFFSQLSWKRLLMKGYIPPYKPPVTSATDT 652
               +  GLL++DP++RLG     ADE+   PFF  +++  +L     PPY P + S  DT
Sbjct: 1051 IVQIFQGLLTKDPEKRLGAGPRDADEVMEEPFFRNINFDDILNLRVKPPYIPEIKSPEDT 1110

Query: 653  SNFDQEFTREKPIDSVVDEYLSESVQKQFGGWTYV 687
            S F+QEFT   P  + +   L+ S Q++F G++++
Sbjct: 1111 SYFEQEFTSAPPTLTPLPSVLTTSQQEEFRGFSFM 1145

>AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C
           (TPK1) - SH] (405062..406222) [1161 bp, 386 aa]
          Length = 386

 Score =  251 bits (640), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 128/295 (43%), Positives = 190/295 (64%), Gaps = 6/295 (2%)

Query: 366 SIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARI 425
           ++ DF +L+ +G GSFG+V  VR     + YA+K ++K  +V   +V HT  ER +L+ +
Sbjct: 72  TLYDFQILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKHVVVKLKQVEHTNDERKMLSVV 131

Query: 426 DCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLH 485
             PFI+ +  +FQ   ++++++  I GGELF  L++  RF    ++FYAAE+  AL+ LH
Sbjct: 132 SHPFIIRMWGTFQDAHQVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLH 191

Query: 486 KMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGY 545
             D+IYRDLKPENILLD  GHI L DFG  K      D T T CGTP+Y+APE++  + Y
Sbjct: 192 SKDIIYRDLKPENILLDKNGHIKLTDFGFAKYV---PDVTYTLCGTPDYIAPEVVSTKPY 248

Query: 546 SKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLLIGLLSR 605
           +K VDWW+ G+L+YEML G  P+YD+N    Y+ IL   + FP  F+   +DLL  L++R
Sbjct: 249 NKSVDWWSFGILIYEMLAGYTPFYDQNTMGTYENILNAEVKFPPFFNAKVRDLLSQLITR 308

Query: 606 DPQRRLG--YNGADEIKNHPFFSQLSWKRLLMKGYIPPYKPPVTSAT-DTSNFDQ 657
           D  +RLG   NG+ ++K HP+FS++ W +LL +    PY+PP+ +   DTS +D+
Sbjct: 309 DLSKRLGNLQNGSQDVKAHPWFSEVIWDKLLCRNIETPYEPPIHAGQGDTSQYDR 363

>CAGL0J06072g complement(572377..574698) similar to sp|P53894
           Saccharomyces cerevisiae YNL161w CBK1, hypothetical
           start
          Length = 773

 Score =  230 bits (587), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 144/386 (37%), Positives = 203/386 (52%), Gaps = 70/386 (18%)

Query: 336 LYNHHWVELRDG-----LGKINISVDYKPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKK 390
           L +H+W E R+      LGK      +   R   LS++DF  ++VIGKG+FG+V  V+KK
Sbjct: 333 LGSHNWSEERNARQLASLGKK--ESQFLRLRRTRLSLEDFHTVQVIGKGAFGEVRLVQKK 390

Query: 391 DTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPFIVPLKFSFQSQEKLYLVLACI 450
           DT KIYA+K + KS +  K ++ H  AER VLA  D P+IV L +SFQ  + LYL++  +
Sbjct: 391 DTGKIYAMKTLLKSEMYKKDQLAHVKAERDVLAGTDSPWIVSLYYSFQDAQYLYLIMEFL 450

Query: 451 NGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALC 510
            GG+L   L R   F    +RFY AE + A++T+HK+  I+RD+KP+NIL+D +GHI L 
Sbjct: 451 PGGDLMTMLIRWQLFTEDVTRFYMAECILAIETIHKLGFIHRDIKPDNILIDIRGHIKLS 510

Query: 511 DFGLC-------------KLNMKDEDKTD------------------------------- 526
           DFGL              KL  +DE  T                                
Sbjct: 511 DFGLSTGFHKTHDSNYYKKLLQQDEATTKNGAPNDAGDGSNNRQTMIVDSINLTMSNRQQ 570

Query: 527 -------------TFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENV 573
                        +  GTP+Y+APE+ L QGY +  DWW+LG ++YE L G PP+  E  
Sbjct: 571 IQTWRKSRRLMAYSTVGTPDYIAPEIFLYQGYGQDCDWWSLGAIMYECLIGWPPFCSETP 630

Query: 574 PKMYKKIL--QDPLVFPD--GFDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQLS 629
            + Y+KI+  +  L FP+      +A+DL+  LL+   QR     GADEIK+HPFF  + 
Sbjct: 631 QETYRKIMNFEQTLQFPEDVHISYEAEDLIRRLLTHSNQRLGRQGGADEIKSHPFFRGVD 690

Query: 630 WKRLLMKGYIPPYKPPVTSATDTSNF 655
           W  +  +    PY P ++S TDT  F
Sbjct: 691 WNTI--RQVEAPYIPKLSSITDTRFF 714

>Kwal_23.6458
          Length = 868

 Score =  229 bits (585), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 123/305 (40%), Positives = 178/305 (58%), Gaps = 30/305 (9%)

Query: 370 FDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPF 429
           F+ +K++G+G  GKV  V++K T ++YALK   K  ++ + ++   LAE+ +LA  + PF
Sbjct: 464 FEKIKLLGQGDVGKVYLVKEKKTNRLYALKIFSKEEMIKRKKIKRILAEQEILATSNHPF 523

Query: 430 IVPLKFSFQSQEKLYLVLACINGGELFYHLQ--REGRFDLSRSRFYAAELLCALDTLHKM 487
           IV L  SFQS++ LYL +    GGE F  LQ  +    D   +RFY++E++ A++ LH M
Sbjct: 524 IVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKTKCIDEDDARFYSSEVVAAIEYLHLM 583

Query: 488 DVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDED----------------------KT 525
             IYRDLKPENILL   GHI L DF L  +  KD                        +T
Sbjct: 584 GFIYRDLKPENILLHKSGHIMLSDFDLS-VQAKDTKNPVVKGSAQSSLLDTKICSDGFRT 642

Query: 526 DTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPL 585
           ++F GT EY+APE++ G G++  VDWWTLG+L+YEML G  PY  +N  K +  +L++ +
Sbjct: 643 NSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPYKGDNTNKTFSNVLKNEV 702

Query: 586 VFPDG--FDRDAKDLLIGLLSRDPQRRLGYN-GADEIKNHPFFSQLSWKRLLMKGYIPPY 642
            FP+     R+ KDL+  LL +   RRLG   GA +IK HPFF ++ W   L++   PP 
Sbjct: 703 SFPNNNEVSRNCKDLIRKLLIKSETRRLGSKFGASDIKKHPFFKKVQWS--LLRNQEPPL 760

Query: 643 KPPVT 647
            P +T
Sbjct: 761 IPVLT 765

>Kwal_56.22788
          Length = 515

 Score =  222 bits (566), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 132/386 (34%), Positives = 202/386 (52%), Gaps = 62/386 (16%)

Query: 366 SIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVS--------------KSE 411
           +++DF  ++V+G+G++GKV+ V+   T ++YA+K ++K+ I+               +  
Sbjct: 121 TLEDFAPVRVLGRGAYGKVLLVKDSHTSRLYAMKQLKKAEILIHDGSSEEGQPDSNLEKR 180

Query: 412 VTHTLAERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSR 471
           +  T AERT+L++++ P IV L +SF    KLYL+L  I GGELFYHL+ +G  D     
Sbjct: 181 LERTFAERTILSQLEHPNIVKLFYSFHDHHKLYLILQFIPGGELFYHLKEQGTLDEDTVA 240

Query: 472 FYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDED-------- 523
           FYAAE+ CAL  LHK  V+YRDLKPEN LLD +GH+ L DFGL K++  D+         
Sbjct: 241 FYAAEISCALRFLHKRGVVYRDLKPENCLLDERGHLVLTDFGLSKVSASDDSADGGDVNT 300

Query: 524 ---KTDTFC------GTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVP 574
              + ++ C      GTPEY APE+L G+ Y++  DW++LG L+++ML G PPY   N  
Sbjct: 301 NGHEGESVCTLHSIIGTPEYCAPEILEGKPYTQNCDWYSLGCLIFDMLIGKPPYTGVNHK 360

Query: 575 KMYKKILQDPL-VFPDGFDRDAKDLLIGLLSRDPQRR------------------LGYNG 615
            +  KIL+D +   P       KD L  LL +D  +R                   G   
Sbjct: 361 VILNKILKDKIPKIPSYLSEGMKDFLAALLKKDVTKRWDVDKFWNTDGPKLKKKKAGQAK 420

Query: 616 ADEIKNHPFFSQLSWKRL----LMKGYIPPYKPPVTSATDTSNFDQEFT--------REK 663
               + H  F ++SW ++    L +    P  P +T      NFD EFT        +++
Sbjct: 421 TTSFQAHFVFRKISWLKMETGELQRNTEGPILPIITDWELAENFDSEFTEMRLDSEAQDQ 480

Query: 664 PIDSVVDEYLSESVQKQFGGWTYVGS 689
           P +  ++ +     +  F G++YV S
Sbjct: 481 PANLQINGFSRSGDKDVFKGFSYVAS 506

>CAGL0C03509g complement(350846..353533) similar to sp|P53739
           Saccharomyces cerevisiae YNR047w or sp|P25341
           Saccharomyces cerevisiae YCR091w KIN82, hypothetical
           start
          Length = 895

 Score =  229 bits (583), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 121/305 (39%), Positives = 179/305 (58%), Gaps = 30/305 (9%)

Query: 370 FDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPF 429
           F+ ++++G+G  GKV  V++K T ++YALK   KS ++ + ++   LAE+ +LA  + PF
Sbjct: 497 FEKIRLLGQGDVGKVYLVKEKRTNRLYALKIFSKSEMIKRKKIKRILAEQEILATSNHPF 556

Query: 430 IVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSR--SRFYAAELLCALDTLHKM 487
           +V L  SFQS++ LYL +    GGE F  LQ      +S   ++FYA+E+  AL+ LH +
Sbjct: 557 VVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKSKCISEEDAKFYASEVTAALEYLHLL 616

Query: 488 DVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDED----------------------KT 525
             IYRDLKPENILL   GHI L DF L  +  KD                        +T
Sbjct: 617 GFIYRDLKPENILLHQSGHIMLSDFDLS-IQAKDAKVPVVKGNAQSTVVDTKICSDGFRT 675

Query: 526 DTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPL 585
           ++F GT EY+APE++ G G++  VDWWTLG+L+YEML G  P+  EN  + +  IL+  +
Sbjct: 676 NSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPFKGENTNETFSNILKKDV 735

Query: 586 VFPDG--FDRDAKDLLIGLLSRDPQRRLGYN-GADEIKNHPFFSQLSWKRLLMKGYIPPY 642
            FP+     R+ KDL+  LL ++  +RLG   GA +IK HPFF +++W   L++   PP 
Sbjct: 736 TFPNNNEVSRNCKDLIKKLLIKNESKRLGSKMGAADIKKHPFFKKVNW--TLLRNQEPPL 793

Query: 643 KPPVT 647
            P +T
Sbjct: 794 IPVLT 798

>KLLA0F24618g complement(2288943..2290613) similar to sp|P38070
           Saccharomyces cerevisiae YBR028c, start by similarity
          Length = 556

 Score =  220 bits (561), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 133/358 (37%), Positives = 189/358 (52%), Gaps = 55/358 (15%)

Query: 364 PLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIV-------------SKS 410
           P  +DDF  ++ +G+G++GKV+ V+   + K+YA+K ++K+ I+              + 
Sbjct: 164 PRVLDDFVPIRCLGEGAYGKVLLVKDSLSSKLYAMKQLKKAEILISEDSIEKDANTTVEK 223

Query: 411 EVTHTLAERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRS 470
            +  T AERT+L++++ P IV L +SF    KLYLVL  I GGELFYHL+ +G  D    
Sbjct: 224 RIERTFAERTILSQLEHPNIVKLFYSFHDNHKLYLVLQYIPGGELFYHLKEQGTLDEGTV 283

Query: 471 RFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTD---- 526
            FYAAEL CAL  LH   ++YRDLKPEN LL+ +GH+ L DFGL K ++ D+  T     
Sbjct: 284 AFYAAELSCALKFLHSKGIVYRDLKPENCLLNERGHLVLTDFGLSKKSVFDDAATPEEGE 343

Query: 527 ------TFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKI 580
                 +  GTPEY APE+L G+ Y++  DW++LG L+Y+ML G PP+   N   +  KI
Sbjct: 344 NVNQLYSIIGTPEYCAPEILAGEPYTQNCDWYSLGCLVYDMLIGKPPFTGVNHKIILNKI 403

Query: 581 LQD------PLVFPDGFDRDAKDLLIGLLSRDPQRR------------------LGYNGA 616
            Q+      P    DGF    KD L  LL +DP +R                   G    
Sbjct: 404 KQEKTGARIPSYLSDGF----KDYLGALLRKDPTKRWDVDKYWAQDGPKTKKKKAGQAKT 459

Query: 617 DEIKNHPFFSQLSWKRL----LMKGYIPPYKPPVTSATDTSNFDQEFTREKPIDSVVD 670
                H  F ++ WK+L    L K  + P  P +T      NFD EFT ++   S+ D
Sbjct: 460 TNYIGHFIFRKIIWKQLLSGDLQKISVGPILPIITDWELAENFDTEFTEKRLDTSIYD 517

>ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) -
           SH] complement(994583..997204) [2622 bp, 873 aa]
          Length = 873

 Score =  224 bits (570), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 123/304 (40%), Positives = 177/304 (58%), Gaps = 28/304 (9%)

Query: 370 FDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPF 429
           F+ ++++G+G  GKV  VR+K + ++YALK   K+ ++ + ++   LAE+ +LA  + PF
Sbjct: 461 FEKIRLLGQGDVGKVYLVREKKSDRLYALKIFGKAEMIKRKKIKRILAEQEILATSNHPF 520

Query: 430 IVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSR--SRFYAAELLCALDTLHKM 487
           IV L  SFQ+++ LYL +    GGE F  LQ      +S   +RFYA+E+  AL+ LH M
Sbjct: 521 IVTLYHSFQTEDYLYLCMEYCMGGEFFRALQTRKTKCISEDDARFYASEVTAALEYLHLM 580

Query: 488 DVIYRDLKPENILLDYQGHIALCDFGLC-----------KLNMK----------DEDKTD 526
             IYRDLKPENILL   GH+ L DF L            K N +          D  +T+
Sbjct: 581 GFIYRDLKPENILLHQSGHVMLSDFDLSVQAKGTRNPQVKGNAQSSLVDTKVCSDGFRTN 640

Query: 527 TFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLV 586
           +F GT EY+APE++ G G++  VDWWTLG+L YEML G  P+  +N  + +  IL++ + 
Sbjct: 641 SFVGTEEYIAPEVIRGNGHTASVDWWTLGILTYEMLFGFTPFKGDNTNQTFSNILKNDVY 700

Query: 587 FPDGFD--RDAKDLLIGLLSRDPQRRLGYN-GADEIKNHPFFSQLSWKRLLMKGYIPPYK 643
           FP+  D  R  KDL+  LL +   +RLG   GA EIK HPFF  + W   L++   PP  
Sbjct: 701 FPNNNDISRTCKDLIKKLLVKKESKRLGSKFGASEIKKHPFFKTVQW--ALLRNQEPPLI 758

Query: 644 PPVT 647
           P +T
Sbjct: 759 PVLT 762

>YBR028C (YBR028C) [220] chr2 complement(294387..295964)
           Serine/threonine protein kinase with similarity to
           Ypk2p/Ykr2p and Ypk1p [1578 bp, 525 aa]
          Length = 525

 Score =  217 bits (553), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 139/370 (37%), Positives = 190/370 (51%), Gaps = 77/370 (20%)

Query: 360 SRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIV-------SKSE- 411
           SRN    + DF  ++V+G+G++GKV+ V+  +T K+YA+K +RK+ I+       SK E 
Sbjct: 122 SRN----LHDFKPVRVLGQGAYGKVLLVKDVNTSKLYAMKQLRKAEILISQTATDSKRED 177

Query: 412 ------------------VTHTLAERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGG 453
                             +  T AER++L+ I+ P IV L +SF    KLYL+L  I GG
Sbjct: 178 EDKNDGNNNDNDDGLSKRLERTFAERSILSEIEHPNIVKLFYSFHDNSKLYLLLQYIPGG 237

Query: 454 ELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFG 513
           ELFYHL+  G  D +   FYAAE+ CAL  LH   V+YRDLKPEN LL+ +GH+ L DFG
Sbjct: 238 ELFYHLKEHGTLDETTVSFYAAEISCALRFLHTKGVVYRDLKPENCLLNQRGHLVLTDFG 297

Query: 514 LCKLNMKDE--DKTD--------TFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLT 563
           L K +  D   D+ D        +  GTPEY APE+LLG+ YS+  DW++LG LLY+ML 
Sbjct: 298 LSKKSANDSAVDEEDPENVNALYSIIGTPEYCAPEILLGKAYSQNCDWYSLGCLLYDMLV 357

Query: 564 GLPPYYDENVPKMYKKILQD------PLVFPDGFDRDAKDLLIGLLSRDPQRRLGYN--- 614
           G PPY   N   +  KI Q+      P    +G     KD+L  LL ++  +R   +   
Sbjct: 358 GKPPYTGSNHKVIINKIQQNKQGPKIPFYLSEGM----KDILNALLKKETAKRWNVDKYW 413

Query: 615 ---GADE-----------------IKNHPFFSQLSWKRL----LMKGYIPPYKPPVTSAT 650
              GA+                     H  F ++ WK L    L K  + P  P +T   
Sbjct: 414 AKTGANNKPTKSKKKKSGAARTSLFTEHFIFRKIDWKLLESGQLQKTTLGPIVPVITDLE 473

Query: 651 DTSNFDQEFT 660
              NFD EFT
Sbjct: 474 LAENFDTEFT 483

>YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine
           protein kinase with unknown role [2163 bp, 720 aa]
          Length = 720

 Score =  221 bits (564), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 117/300 (39%), Positives = 178/300 (59%), Gaps = 25/300 (8%)

Query: 370 FDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPF 429
           F+ ++++G+G  GKV  +R++DT +I+ALK + K  ++ + ++   L E+ +LA  D PF
Sbjct: 324 FEKIRLLGQGDVGKVYLMRERDTNQIFALKVLNKHEMIKRKKIKRVLTEQEILATSDHPF 383

Query: 430 IVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSR--SRFYAAELLCALDTLHKM 487
           IV L  SFQ+++ LYL +    GGE F  LQ      ++   ++FYA+E++ AL+ LH +
Sbjct: 384 IVTLYHSFQTKDYLYLCMEYCMGGEFFRALQTRKSKCIAEEDAKFYASEVVAALEYLHLL 443

Query: 488 DVIYRDLKPENILLDYQGHIALCDFGLC-------KLNMKDED-----------KTDTFC 529
             IYRDLKPENILL   GH+ L DF L        K  MKD             +T++F 
Sbjct: 444 GFIYRDLKPENILLHQSGHVMLSDFDLSIQATGSKKPTMKDSTYLDTKICSDGFRTNSFV 503

Query: 530 GTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPD 589
           GT EYLAPE++ G G++  VDWWTLG+L+YEML G  P+  +N  + +  IL   + FP 
Sbjct: 504 GTEEYLAPEVIRGNGHTAAVDWWTLGILIYEMLFGCTPFKGDNSNETFSNILTKDVKFPH 563

Query: 590 G--FDRDAKDLLIGLLSRDPQRRLGY-NGADEIKNHPFFSQLSWKRLLMKGYIPPYKPPV 646
                ++ KDL+  LL+++  +RLG  +GA +IK HPFF ++ W    ++   PP  P +
Sbjct: 564 DKEVSKNCKDLIKKLLNKNEAKRLGSKSGAADIKRHPFFKKVQWS--FLRNQDPPLIPAL 621

>Scas_629.16
          Length = 918

 Score =  224 bits (570), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 119/302 (39%), Positives = 175/302 (57%), Gaps = 30/302 (9%)

Query: 370 FDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPF 429
           F+ +K++G+G  GKV  VR+K T ++YALK   KS ++ + ++   LAE+ +LA  + PF
Sbjct: 519 FEKIKLLGQGDVGKVYLVREKKTNRLYALKIFSKSEMIKRKKIKRILAEQEILATSNHPF 578

Query: 430 IVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSR--SRFYAAELLCALDTLHKM 487
           +V L  SFQS++ LY  +    GGE F  LQ      +S   +RFYA+E+  AL+ LH +
Sbjct: 579 VVTLYHSFQSEDYLYFCMEYCMGGEFFRALQTRRTKCISEDDARFYASEVTAALEYLHLL 638

Query: 488 DVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDED----------------------KT 525
             IYRDLKPENILL   GHI L DF L  +  KD                        +T
Sbjct: 639 GFIYRDLKPENILLHKSGHIMLSDFDLS-VQAKDAKVPVMKGSAESTVVDTKICSDGFRT 697

Query: 526 DTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPL 585
           ++F GT EY+APE++ G G++  VDWWTLG+L+YEML G  P+   +  + +  IL++ +
Sbjct: 698 NSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPFKGSSSNETFSNILKNDV 757

Query: 586 VFPDGFD--RDAKDLLIGLLSRDPQRRLGYN-GADEIKNHPFFSQLSWKRLLMKGYIPPY 642
            FP+  D  R+ KDL+  LL ++  +RLG   GA ++K HPFF ++ W    ++   PP 
Sbjct: 758 SFPNNNDISRNCKDLIKKLLCKNEAKRLGSKMGAADVKRHPFFKKVQWS--FLRNQEPPL 815

Query: 643 KP 644
            P
Sbjct: 816 IP 817

>KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1
           Kluyveromyces lactis MUP1 protein, hypothetical start
          Length = 774

 Score =  220 bits (560), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 118/302 (39%), Positives = 173/302 (57%), Gaps = 30/302 (9%)

Query: 370 FDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPF 429
           F+ ++++G+G  G+V  VR+K T ++YALK   K  ++ + ++   L E+ +LA  + PF
Sbjct: 379 FEKIRLLGQGDVGRVYLVREKQTNRLYALKIFSKPEMIKRKKIKRILTEQEILATSNHPF 438

Query: 430 IVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSR--SRFYAAELLCALDTLHKM 487
           IV L  SFQ+++ LYL +    GGE F  LQ      +S   +RFY++E+  AL+ LH M
Sbjct: 439 IVTLYHSFQTEDYLYLCMEYCMGGEFFRALQTRKTKCISEDDARFYSSEVTAALEYLHLM 498

Query: 488 DVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDED----------------------KT 525
             IYRDLKPENILL   GHI L DF L  +  KD                        +T
Sbjct: 499 GFIYRDLKPENILLHQSGHIMLSDFDLS-VQAKDTKNPQVKGNASHSLVDTKICSDGFRT 557

Query: 526 DTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPL 585
           ++F GT EY+APE++ G G++  VDWWTLG+L+YEML G  P+  +N  + +  IL++ +
Sbjct: 558 NSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPFKGDNTNQTFSNILKNEV 617

Query: 586 VFPDGFD--RDAKDLLIGLLSRDPQRRLGYN-GADEIKNHPFFSQLSWKRLLMKGYIPPY 642
           V P+  +  R  KDL+  LL ++  +RLG   GA +IK HPFF    W   L++   PP 
Sbjct: 618 VIPNNNETSRACKDLIRKLLIKNENKRLGSKLGASDIKKHPFFKNDQWS--LLRNQEPPL 675

Query: 643 KP 644
            P
Sbjct: 676 IP 677

>AEL083W [2423] [Homologous to ScYBR028C - SH]
           complement(470964..472574) [1611 bp, 536 aa]
          Length = 536

 Score =  213 bits (542), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 128/352 (36%), Positives = 182/352 (51%), Gaps = 52/352 (14%)

Query: 361 RNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKS---------- 410
           R  P  ++DF  ++V+G+G++GKV+ V+ + T K++A+K ++K+ IV  +          
Sbjct: 137 RQTPRKLEDFKPVRVLGRGAYGKVLLVKDQLTSKLFAMKQLKKAEIVVTAPEEESTDGED 196

Query: 411 ----------EVTHTLAERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQ 460
                      V  T AERT+L++++ P IV L +SF    KLYLVL  I GGELFYHL+
Sbjct: 197 AVLLPAVVEKRVERTFAERTILSQLEHPNIVKLFYSFHDHHKLYLVLQYIPGGELFYHLK 256

Query: 461 REGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMK 520
            +G  D     FYAAE+ CAL  LH   ++YRDLKPEN LLD +GH+ L DFGL K  + 
Sbjct: 257 EQGTLDEVTVSFYAAEISCALKFLHSKGIVYRDLKPENCLLDDKGHLVLTDFGLSKRGVN 316

Query: 521 DED---------KTDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDE 571
             D         +  +  GTPEY APE+L GQ Y++  DW++LG L Y+ML G PP+   
Sbjct: 317 QADSPLGGEQVEELYSIIGTPEYCAPEILCGQPYTQNCDWYSLGSLTYDMLIGKPPFTGA 376

Query: 572 NVPKMYKKILQDPLV-FPDGFDRDAKDLLIGLLSRDPQRRLGYN---------------- 614
           N   +  KI QD  +  P       KD L  LL +D  +R   +                
Sbjct: 377 NHKVILSKIKQDKGIKIPHYLSDGMKDYLNALLKKDIGKRWDVDRFWDKEGTKTKKKKAG 436

Query: 615 --GADEIKNHPFFSQLSWKRL----LMKGYIPPYKPPVTSATDTSNFDQEFT 660
                  ++H  F +++WK +    L +    P  P +T      NFD EFT
Sbjct: 437 QAKTSCYQSHFIFRKINWKLMENGDLQRTTYGPIIPVITDWELAENFDSEFT 488

>CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces
           cerevisiae YBR028c, start by similarity
          Length = 542

 Score =  210 bits (535), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 133/368 (36%), Positives = 182/368 (49%), Gaps = 78/368 (21%)

Query: 367 IDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIV------------------- 407
           I DF  ++V+G+G++GKV+ V+ K T K+YA+K ++K+ I+                   
Sbjct: 142 ISDFKPIRVLGQGAYGKVILVKDKQTSKLYAMKQLKKAEILIAPTDANTESMDKLAELDK 201

Query: 408 ---SKSE-----VTHTLAERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHL 459
              S+ E     +  T AERT+L++++ P IV L +SF    KLYL+L  I GGELF+HL
Sbjct: 202 PVDSEDEKLSKRIERTFAERTILSQLEHPNIVKLFYSFHDTSKLYLLLQYIPGGELFFHL 261

Query: 460 QREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNM 519
           +  G  +     FYAAE+ CAL  LH   V+YRDLKPEN LL+  GH+ L DFGL K + 
Sbjct: 262 KEHGTLEEDTVAFYAAEISCALKFLHSKGVVYRDLKPENCLLNQNGHLVLTDFGLSKSSA 321

Query: 520 KDEDKTD--------------TFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGL 565
            +  + D              +  GTPEY APE+LLGQ Y+   DW++LG LLY+MLTG 
Sbjct: 322 SNASQEDLGAGNEGEDVNELHSIIGTPEYCAPEILLGQPYTANCDWYSLGCLLYDMLTGK 381

Query: 566 PPYYDENVPKMYKKILQD------PLVFPDGFDRDAKDLLIGLLSRDPQRRLGYNG---- 615
           PPY   N   +  KI  D      P    DG     KD+L  LL  DP++R   +     
Sbjct: 382 PPYTGANHKVIANKIKNDKQGPKIPYYLSDGM----KDVLGALLKSDPKKRWDVDKYWSE 437

Query: 616 -------------------ADEIKNHPFFSQLSWKRL----LMKGYIPPYKPPVTSATDT 652
                                  ++H  F ++ WK L    L      P  P +T     
Sbjct: 438 PKKDNSQKKGQKKKKSKERTSPFQSHFVFRKVDWKGLSSGELQNTTFGPIVPVITDWELA 497

Query: 653 SNFDQEFT 660
            NFD EFT
Sbjct: 498 ENFDSEFT 505

>Scas_720.103
          Length = 804

 Score =  215 bits (547), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 124/358 (34%), Positives = 191/358 (53%), Gaps = 50/358 (13%)

Query: 338 NHHWVELRDGLGKINISVDYKPSRNKPL--------------SIDDFDLLKVIGKGSFGK 383
           NH   E++    K   S+D +P R++ L              +   F+ +K++G+G  GK
Sbjct: 359 NHTQSEVQISKDKRTYSIDSEPKRSQRLRNKSFGNKFQDIKVNPQSFEKIKLLGQGDVGK 418

Query: 384 VMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPFIVPLKFSFQSQEKL 443
           V  V++K T  +YA+K   K  ++ + ++   + E+ +LA  + PFIV L  SFQ+++ L
Sbjct: 419 VFLVKEKKTNGLYAMKIYNKKDMIKREKIKRVITEQEILATSNHPFIVTLYHSFQTEDYL 478

Query: 444 YLVLACINGGELFYHLQREGRFDLSR--SRFYAAELLCALDTLHKMDVIYRDLKPENILL 501
           YL +    GGE F  LQ      +    +RFYA+E+L AL+ LH +  IYRDLKPENILL
Sbjct: 479 YLCMEYCMGGEFFRALQTRDSKCICEDDARFYASEVLAALEYLHLLGFIYRDLKPENILL 538

Query: 502 DYQGHIALCDFGLCKLNMKDED----------------------------KTDTFCGTPE 533
              GHI L DF L  ++ KD                              +T++F GT E
Sbjct: 539 HKSGHIMLSDFDLS-VHAKDSKNPIFMKDGILPTTNSNLIVDTKICSEGFRTNSFVGTEE 597

Query: 534 YLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFD- 592
           Y+APE++ G G++  VDWWTLG+L++EML G  P+  +   + +  IL     FP+  D 
Sbjct: 598 YIAPEVIRGNGHTVAVDWWTLGILIFEMLFGKTPFKGDTTNETFANILSKDFEFPNSNDI 657

Query: 593 -RDAKDLLIGLLSRDPQRRLGYN-GADEIKNHPFFSQLSWKRLLMKGYIPPYKPPVTS 648
            R+ K+L+  LL+++  +RLG   GA EIK H FF  ++W   +++   PP  P ++S
Sbjct: 658 TRNCKNLIKKLLTKNETKRLGSKMGAAEIKKHSFFKNVNWN--MLRNEEPPLIPELSS 713

>Scas_593.14d
          Length = 495

 Score =  199 bits (507), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 119/296 (40%), Positives = 168/296 (56%), Gaps = 44/296 (14%)

Query: 366 SIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIV------SKSE-------- 411
           ++ DF  ++V+G+G++GKV+ V+ K T K+YA+K ++K+ I+      S  E        
Sbjct: 132 TVKDFRPVRVLGQGAYGKVILVKDKLTNKLYAMKQLKKAEILITESPKSNEEDDVNLGKR 191

Query: 412 VTHTLAERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSR 471
           +  T AE+++LA ++ P IV L +SF    KLYL+L  I GGELF+HL+ +G  D     
Sbjct: 192 IERTFAEKSILAELEHPNIVKLFYSFHDNSKLYLLLQYIPGGELFFHLKEQGTLDEDTVA 251

Query: 472 FYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCK--------------- 516
           FYAAE+ CAL  LH   ++YRDLKPEN LL+ +GH+ L DFGL K               
Sbjct: 252 FYAAEISCALKFLHDKGIVYRDLKPENCLLNDKGHLVLTDFGLSKKSVTQNSANPSEVTS 311

Query: 517 LNMKDEDKT--DTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVP 574
           LN   ED +   +  GTPEY APE+L G  Y+K  DW++LG L+Y+ML+G PPY   N  
Sbjct: 312 LNEPSEDLSTLHSIIGTPEYCAPEILQGLPYNKNCDWYSLGCLIYDMLSGKPPYTGANHK 371

Query: 575 KMYKKILQD------PLVFPDGFDRDAKDLLIGLLSRDPQRRL---GYNGADEIKN 621
            +  KI +D      P    +G     KD+L  LL +D  +R     Y  A+ IKN
Sbjct: 372 VILNKIQKDKQGPKIPYYLSEGM----KDMLNWLLKKDQSKRWDVDKYWAAEPIKN 423

>CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces
           cerevisiae YPL209c IPL1 ser/thr protein kinase, start by
           similarity
          Length = 358

 Score =  179 bits (453), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 100/268 (37%), Positives = 155/268 (57%), Gaps = 4/268 (1%)

Query: 358 KPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLA 417
           K + N  LS+ DF++ + +GKG FGKV  VR K +  I ALKAI K+ I+  + +     
Sbjct: 88  KSTYNNKLSLKDFEVGRKLGKGKFGKVYCVRHKKSGFICALKAIEKNEILQFNLLKQLKR 147

Query: 418 ERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAEL 477
           E  +   +D P I+ L   F  ++++YL++     GEL+  L+  G F+   +  Y  ++
Sbjct: 148 EVDIQLGMDHPNIIKLYAHFHDEKRVYLLMEHSINGELYKSLKNNGPFNDVLASHYIYQI 207

Query: 478 LCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAP 537
             AL  +HK  +I+RD+KPEN+L+ +   + L DFG   LN  +  K  T CGT +YL+P
Sbjct: 208 ADALHYMHKKRIIHRDVKPENVLIGFDNVVKLADFGWSILN-PEGSKRKTLCGTIDYLSP 266

Query: 538 ELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKD 597
           E++  + Y + VD W LGVL YE++ G+PP+ + +    YK+IL+  L FP+   +DAKD
Sbjct: 267 EMITPREYDEQVDVWALGVLAYELVVGVPPFEENSKELTYKRILKCDLNFPESISKDAKD 326

Query: 598 LLIGLLSRDPQRRLGYNGADEIKNHPFF 625
           L+  LL  D  +RL   G   +K HP+ 
Sbjct: 327 LISKLLVTDTTQRLSLTG---VKTHPWI 351

>AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH]
           (249144..250247) [1104 bp, 367 aa]
          Length = 367

 Score =  177 bits (448), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 157/268 (58%), Gaps = 4/268 (1%)

Query: 360 SRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAER 419
           S+ + L + DF++ KV+GKG FG+V  VR  ++  + ALKA+ K  I+  +       E 
Sbjct: 99  SKLQNLKLADFEIGKVLGKGKFGRVYCVRHIESGFVCALKAMEKKDIIQYNIEKQFRREV 158

Query: 420 TVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLC 479
            + + +  P +  L   F  ++++YL++  +  GEL+ HL+    F+   + +Y  ++  
Sbjct: 159 EIQSSLRHPNLTQLYGYFHDEKRVYLLMEYLVNGELYKHLKGRSHFNDVVASYYVYQMAD 218

Query: 480 ALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPEL 539
           ALD +H+ ++++RD+KPENI++ +   I L DFG   +  K   K  T CGT +YL+PEL
Sbjct: 219 ALDYMHERNILHRDIKPENIIIGFNNTIKLTDFGWSVITPKG-SKRKTLCGTVDYLSPEL 277

Query: 540 LLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLL 599
           +  + Y++ VD W LGVL YE+L G PP+ +E+    YK+IL+  L+FPD  D +A+ L+
Sbjct: 278 IRSREYNEKVDVWALGVLTYELLVGSPPFEEESKELTYKRILKRNLIFPDHVDTEARHLI 337

Query: 600 IGLLSRDPQRRLGYNGADEIKNHPFFSQ 627
             LL  DP  R+      E+K HP+  +
Sbjct: 338 SRLLEYDPGDRIPLK---EVKKHPWIEK 362

>Scas_705.23
          Length = 553

 Score =  174 bits (442), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 120/396 (30%), Positives = 192/396 (48%), Gaps = 80/396 (20%)

Query: 369 DFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCP 428
           DF+++  +G+G +G+V   RK+DTK++ ALK + K  +   +E  H L ER +L      
Sbjct: 157 DFEMITQVGQGGYGQVYLARKRDTKEVCALKILNKKLLFKLNETNHVLTERDILTTTRSD 216

Query: 429 FIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRF-DLSRSRFYAAELLCALDTLHKM 487
           ++V L ++FQ  E LYL +  + GG+ F  L    RF   + +RFY +E+ CA++ LH++
Sbjct: 217 WLVKLLYAFQDTESLYLAMEFVPGGD-FRTLLINTRFLRNTHARFYISEMFCAVNALHEL 275

Query: 488 DVIYRDLKPENILLDYQGHIALCDFGLC------------KLNMKD-------------- 521
              +RDLKPEN L+D +GHI L DFGL             K+ +++              
Sbjct: 276 GYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSI 335

Query: 522 EDK--------------TDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPP 567
           ED+               ++  G+P+Y+A E+L G+ Y   VD+W+LG +L+E L G  P
Sbjct: 336 EDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTP 395

Query: 568 YYDENVPKMY------KKILQDPLVFPDG---FDRDAKDLLIGLLSRDPQRRLGYNGADE 618
           +   +  + Y      KK L+ P V  +G   F     D++  L++ DP  RL     + 
Sbjct: 396 FSGSSTNETYENLRHWKKTLRRP-VLDNGRPAFSDRTWDIITRLIA-DPINRL--RSFEH 451

Query: 619 IKNHPFFSQLSWKRLLMKGYIPPYKPPVTSATDTSNFD------------QEFTREKPID 666
           IK  P+F+++++  L      PP+ P + S TD   FD              F R+  + 
Sbjct: 452 IKRMPYFAEVNFNTLRQSA--PPFTPQLDSETDAGYFDDFTNEADMAKYADVFKRQNKLS 509

Query: 667 SVVDE-----------YLSESVQKQFGGWTYVGSEQ 691
           S+VD+           +   + QK   G  Y GSE 
Sbjct: 510 SMVDDSAVDSKLVGFTFRHRNGQKGLSGILYNGSEH 545

>KLLA0B02332g complement(206863..207948) similar to sp|P38991
           Saccharomyces cerevisiae YPL209c IPL1 ser/thr protein
           kinase, start by similarity
          Length = 361

 Score =  166 bits (421), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 92/271 (33%), Positives = 155/271 (57%), Gaps = 6/271 (2%)

Query: 365 LSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLAR 424
           +++ DF++ K++GKG FGKV  V+ ++T  I ALKA+ K  IV  +       E  +   
Sbjct: 95  MTLQDFEIGKILGKGKFGKVYCVKHRETGLICALKAMEKKEIVQYTIQKQFRREVEIQGS 154

Query: 425 IDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTL 484
                +  L   F  ++++YL++  +  GEL+  L+  G  + + + ++  ++  ALD +
Sbjct: 155 FKHKNLTQLYGFFYDEKRVYLLMEYVYYGELYKFLKNNGPLNETLASYFVYQMANALDYM 214

Query: 485 HKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQG 544
           H  ++++RD+KPENIL+ +   I L DFG    N +D  K  T CGT +YL+PEL+  + 
Sbjct: 215 HSKNILHRDIKPENILIGFNNTIKLTDFGWSVYN-EDGQKRKTLCGTIDYLSPELIKSRE 273

Query: 545 YSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLLIGLLS 604
           Y+  VD W LGVL YE+L G PP+ ++     Y++IL+  L FP      A+DL++ LL 
Sbjct: 274 YNNKVDVWALGVLTYELLVGSPPFEEDTKEMTYRRILRCDLKFPLNVSPQARDLIVRLLQ 333

Query: 605 RDPQRRLGYNGADEIKNHPFFS--QLSWKRL 633
            +P +R+  +   E+K+H + +  + SW  L
Sbjct: 334 FEPSKRIPLS---EVKSHAWIANNRGSWTDL 361

>YGR092W (DBF2) [2052] chr7 (668191..669909) Serine/threonine
           protein kinase related to Dbf20p, required for events in
           anaphase/telophase, component of the CCR4-NOT
           transcriptional complex [1719 bp, 572 aa]
          Length = 572

 Score =  169 bits (428), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 107/353 (30%), Positives = 172/353 (48%), Gaps = 56/353 (15%)

Query: 369 DFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCP 428
           DF+++  +G+G +G+V   RKKDTK++ ALK + K  +   +E  H L ER +L      
Sbjct: 176 DFEMITQVGQGGYGQVYLARKKDTKEVCALKILNKKLLFKLNETKHVLTERDILTTTRSE 235

Query: 429 FIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMD 488
           ++V L ++FQ  + LYL +  + GG+    L          +RFY +E+ CA++ LH + 
Sbjct: 236 WLVKLLYAFQDLQSLYLAMEFVPGGDFRTLLINTRCLKSGHARFYISEMFCAVNALHDLG 295

Query: 489 VIYRDLKPENILLDYQGHIALCDFGLC--------------------------------- 515
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 296 YTHRDLKPENFLIDAKGHIKLTDFGLAAGTISNERIESMKIRLEKIKDLEFPAFTEKSIE 355

Query: 516 -------KLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPY 568
                  +L  K+ +  ++  G+P+Y+A E+L G+ Y   VD+W+LG +L+E L G  P+
Sbjct: 356 DRRKMYNQLREKEINYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPF 415

Query: 569 YDENVPKMY------KKILQDPLVFPDG---FDRDAKDLLIGLLSRDPQRRLGYNGADEI 619
              +  + Y      K+ L+ P    DG   F     DL+  L++ DP  RL     + +
Sbjct: 416 SGSSTNETYDNLRRWKQTLRRPRQ-SDGRAAFSDRTWDLITRLIA-DPINRL--RSFEHV 471

Query: 620 KNHPFFSQLSWKRLLMKGYIPPYKPPVTSATDTSNFDQEFTREKPIDSVVDEY 672
           K   +F+ +++  L  +  IPP+ P + S TD   FD +FT E  +    D +
Sbjct: 472 KRMSYFADINFSTL--RSMIPPFTPQLDSETDAGYFD-DFTSEADMAKYADVF 521

>Kwal_56.24091
          Length = 381

 Score =  164 bits (415), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 99/269 (36%), Positives = 156/269 (57%), Gaps = 4/269 (1%)

Query: 359 PSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAE 418
           P   + +S+DDF++ K +GKG FGKV  V+ K T  I ALKA++KS IV  +       E
Sbjct: 112 PVHYQDISLDDFEVGKKLGKGKFGKVYCVKHKRTGFICALKAMKKSEIVQYNVQKQFRRE 171

Query: 419 RTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELL 478
             + + +  P +  L   F  ++++YL++  +  GEL+ HL+  G F+   +  +  ++ 
Sbjct: 172 VEIQSSLKHPNLTRLYGYFHDEKRVYLLMEYLVNGELYKHLRSHGPFNDITASHFVHQMA 231

Query: 479 CALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPE 538
            AL+ +H  ++++RD+KPENILL +Q  + L DFG    N+ +  K  T CGT +YL+PE
Sbjct: 232 DALNYMHSKNILHRDIKPENILLGFQNTLKLTDFGWSVSNVGNS-KRKTLCGTMDYLSPE 290

Query: 539 LLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDL 598
           L+  + Y   VD W LGVL YE+L G PP+ ++     YK+I++  L FPD     A+DL
Sbjct: 291 LIKSREYDNKVDVWALGVLTYELLVGSPPFEEDTKELTYKRIIKRDLRFPDQVSPHARDL 350

Query: 599 LIGLLSRDPQRRLGYNGADEIKNHPFFSQ 627
           +  LL  DPQ R+      ++K HP+  +
Sbjct: 351 ISRLLEYDPQNRI---PLKDVKRHPWIKK 376

>CAGL0B04147g 402798..404498 highly similar to sp|P22204
           Saccharomyces cerevisiae YGR092w DBF2 ser/thrprotein
           kinase related to DBF20P or sp|P32328 Saccharomyces
           cerevisiae YPR111w DBF20 cell cycle protein kinase
           related to DBF2P, hypothetical start
          Length = 566

 Score =  167 bits (424), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 106/350 (30%), Positives = 168/350 (48%), Gaps = 54/350 (15%)

Query: 369 DFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCP 428
           DF+++  +G+G +G+V   RK+DTK++ ALK + K  +V  +E  H L ER +L      
Sbjct: 170 DFEMITQVGQGGYGQVYLARKRDTKEVCALKILNKKLLVKLNETNHILTERDILTTTRSE 229

Query: 429 FIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMD 488
           ++V L ++FQ  E LYL +  + GG+    L          +RFY +E+ CA++ LH++ 
Sbjct: 230 WLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELG 289

Query: 489 VIYRDLKPENILLDYQGHIALCDFGLC--------------------------------- 515
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 290 YTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIE 349

Query: 516 -------KLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPY 568
                   L   D +  ++  G+P+Y+A E+L G+ Y   VD+W+LG +L+E L G  P+
Sbjct: 350 DRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPF 409

Query: 569 YDENVPKMY------KKILQDPLVFPDGFD--RDAKDLLIGLLSRDPQRRLGYNGADEIK 620
              +  + Y      K+ L+ P +  DG     D    LI  L  DP  RL     + +K
Sbjct: 410 SGSSTNETYENLRHWKRTLRRPFL-NDGRSAISDRAWELITRLIADPINRL--RSFEHVK 466

Query: 621 NHPFFSQLSWKRLLMKGYIPPYKPPVTSATDTSNFDQEFTREKPIDSVVD 670
              +F ++++  L  +   PP+ P + + TD   FD +FT E  +    D
Sbjct: 467 RMNYFHEINFDTL--RQLSPPFTPQLDNETDAGYFD-DFTNEADMAKYAD 513

>CAGL0G03047g 282299..283918 highly similar to sp|P22204
           Saccharomyces cerevisiae YGR092w DBF2 ser/thrprotein
           kinase or sp|P32328 Saccharomyces cerevisiae YPR111w
           DBF20, hypothetical start
          Length = 539

 Score =  165 bits (418), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 110/376 (29%), Positives = 177/376 (47%), Gaps = 55/376 (14%)

Query: 342 VELRDGLGKINISVDYKPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAI 401
            E R  L K N  +  +  R KP + +DF++L  +G+G +G+V   RK+DTK++ ALK +
Sbjct: 119 TEWRGYLAKENNIL--RKRRLKPKN-NDFEMLTQVGQGGYGQVYLARKRDTKEVCALKIL 175

Query: 402 RKSYIVSKSEVTHTLAERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQR 461
            K  +   +E  H L ER +L      ++V L ++FQ    LYL +  + GG+    L  
Sbjct: 176 NKKLLHRLNETNHVLTERDILTTTRSEWLVKLLYAFQDSSSLYLAMEFVPGGDFRTLLIN 235

Query: 462 EGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKD 521
                 + +RFY +E+ CA++ LH++   +RDLKPEN L+D +GHI L DFGL    + +
Sbjct: 236 TKYLKSTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAKGHIKLTDFGLAAGTVSN 295

Query: 522 E----------------------------------------DKTDTFCGTPEYLAPELLL 541
           E                                        +  ++  G+P+Y+A E+L 
Sbjct: 296 ERIESMKIRLEEVKNLEFPAFTERPIEDRRKMYHDLRDTDINYANSMVGSPDYMALEVLE 355

Query: 542 GQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMY------KKILQDPLVFPDGFD-RD 594
           G+ Y   VD+W+LG +L+E L    P+      + Y      +K L+ P +    +   D
Sbjct: 356 GKKYDFTVDYWSLGCMLFESLVSFTPFSGATTNETYENLRHWRKTLRRPRLGNGRYAVSD 415

Query: 595 AKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQLSWKRLLMKGYIPPYKPPVTSATDTSN 654
                I  L  DP  RL     + +K  P+FS++ + +L  +   PP+ P + S  D   
Sbjct: 416 RTWAFITSLIADPINRL--KSFEHVKRMPYFSEIDFSKL--REMSPPFIPQLDSEVDAGY 471

Query: 655 FDQEFTREKPIDSVVD 670
           FD +FT E  +    D
Sbjct: 472 FD-DFTNEADMAKYAD 486

>Kwal_23.3992
          Length = 571

 Score =  166 bits (420), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 104/350 (29%), Positives = 169/350 (48%), Gaps = 54/350 (15%)

Query: 369 DFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCP 428
           DF+++  +G+G +G+V   RK+DT++I ALK + K  ++  +E  H L ER +L      
Sbjct: 175 DFEMITQVGQGGYGQVYLARKRDTREICALKILNKKLLIKLNETNHVLTERDILTTTRSE 234

Query: 429 FIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMD 488
           ++V L ++FQ    LYL +  + GG+    L          +RFY +E+ CA+D LH++ 
Sbjct: 235 WLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLG 294

Query: 489 VIYRDLKPENILLDYQGHIALCDFGLC--------------------------------- 515
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 295 YTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMN 354

Query: 516 -------KLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPY 568
                   L   D +   +  G+P+Y+A E+L  + Y   VD+W+LG +L+E L G  P+
Sbjct: 355 DRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 414

Query: 569 YDENVPKMY------KKILQDPLVFPD--GFDRDAKDLLIGLLSRDPQRRLGYNGADEIK 620
              +  + Y      K++L+ P        F     DL+I L++ DP  RL     + +K
Sbjct: 415 SGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIA-DPISRL--RSFEHVK 471

Query: 621 NHPFFSQLSWKRLLMKGYIPPYKPPVTSATDTSNFDQEFTREKPIDSVVD 670
              +F+++S++ L  +   PP+ P + + TD   FD +FT E  +    D
Sbjct: 472 KMKYFAEISFENL--RNVSPPFIPQLDNETDAGYFD-DFTSEADMAKYAD 518

>Kwal_56.22693
          Length = 984

 Score =  168 bits (425), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 89/273 (32%), Positives = 150/273 (54%), Gaps = 12/273 (4%)

Query: 367 IDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARI- 425
           I DF   +V+G GS+  VM  R  D+ K YA+K + K Y++ + +V +   E+  L R+ 
Sbjct: 155 IKDFRFGEVLGDGSYSTVMLARSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKNTLQRLN 214

Query: 426 DCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLH 485
           D   ++ L F+FQ +  LY +L     G+    +++ G      + +Y+A++L A+D LH
Sbjct: 215 DGRGVIKLYFTFQDEASLYFLLEYAPNGDFLSVIKKFGSLSQECAVYYSAQILDAIDYLH 274

Query: 486 KMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDE--------DKTDTFCGTPEYLAP 537
              +++RD+KPENILLD    + L DFG  ++  KDE        +++ +F GT EY++P
Sbjct: 275 HKGIVHRDIKPENILLDKDMKVKLTDFGTARILEKDETTQTFNLLERSKSFVGTAEYVSP 334

Query: 538 ELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKD 597
           ELL         D W  G +L++M+ G PP+   N    ++K+++    F  GF    +D
Sbjct: 335 ELLNDNYVDYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLVIRD 394

Query: 598 LLIGLLSRDPQRRLGYNGADEIKNHPFFSQLSW 630
           L+  +L + P++RL    A +IK H FF  +++
Sbjct: 395 LIKKILVKSPEQRL---DASQIKKHHFFKDVNF 424

>YDR490C (PKH1) [1306] chr4 complement(1431956..1434256)
           Serine/threonine protein kinase, functions similarly to
           mammalian 3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk1p, required for
           endocytosis [2301 bp, 766 aa]
          Length = 766

 Score =  166 bits (420), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 92/281 (32%), Positives = 153/281 (54%), Gaps = 17/281 (6%)

Query: 365 LSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLAR 424
           + I DF   + +G GS+  V+    +D+ K YA+K + K Y++ + +V +   E+  L +
Sbjct: 120 MGIKDFKFGEQLGDGSYSSVVLATARDSGKKYAVKVLSKEYLIRQKKVKYVTVEKLALQK 179

Query: 425 ID-CPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDT 483
           ++    I  L F+FQ +  LY +L     G+    +++ G  + + +R+YA++++ A+D+
Sbjct: 180 LNGTKGIFKLFFTFQDEASLYFLLEYAPHGDFLGLIKKYGSLNETCARYYASQIIDAVDS 239

Query: 484 LHKMDVIYRDLKPENILLDYQGHIALCDFGLCKL------NMKDED-------KTDTFCG 530
           LH + +I+RD+KPENILLD    + L DFG  K+      N  D         K+ +F G
Sbjct: 240 LHNIGIIHRDIKPENILLDKNMKVKLTDFGTAKILPEEPSNTADGKPYFDLYAKSKSFVG 299

Query: 531 TPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDG 590
           T EY++PELL         D W  G +LY+ML G PP+   N    ++K+++    F  G
Sbjct: 300 TAEYVSPELLNDNYTDSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAFTAG 359

Query: 591 FDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQLSWK 631
           F +  KDL+  LL RDP  RL      +IK H FF +++++
Sbjct: 360 FPQIVKDLVKKLLVRDPNDRLTIK---QIKAHLFFHEVNFE 397

>KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, start by
           similarity
          Length = 925

 Score =  167 bits (422), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 89/274 (32%), Positives = 153/274 (55%), Gaps = 13/274 (4%)

Query: 367 IDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARI- 425
           I+DF   + +G GS+  V+     ++ K YA+K + K Y++ + +V +   E+  L R+ 
Sbjct: 152 INDFKFGETLGDGSYSTVLLATSIESNKKYAVKILNKEYLIKQKKVKYVNIEKNTLQRLK 211

Query: 426 DCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLH 485
           +   I+ L F+FQ +  LY +L     G+L   +++ G  +   +++YAA+++ AL  +H
Sbjct: 212 NTKGIISLYFTFQDESSLYFLLEYAPNGDLLSLMRKHGSVNEKCTQYYAAQIIDALGFMH 271

Query: 486 KMDVIYRDLKPENILLDYQGHIALCDFGLCK-LNMKDED--------KTDTFCGTPEYLA 536
              VI+RDLKPENILLD    + L DFG  + L+   ED        ++++F GT EY++
Sbjct: 272 DKGVIHRDLKPENILLDVDMKVKLTDFGTARLLDSTSEDDLKYDLLTRSNSFVGTAEYVS 331

Query: 537 PELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAK 596
           PELL         D W  G +L++M+ G PP+   N    ++K+++    F  GF    +
Sbjct: 332 PELLNDNYVDFRCDIWAFGCILFQMIAGKPPFKANNEYLTFQKVMKVQFAFTAGFPMTVR 391

Query: 597 DLLIGLLSRDPQRRLGYNGADEIKNHPFFSQLSW 630
           DL+  +L ++P+RRL  N   +IK H FF+ +++
Sbjct: 392 DLVKNILIKNPERRLLIN---QIKAHQFFADVNF 422

>KLLA0E03487g complement(323764..325707) similar to sgd|S0002874
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 647

 Score =  164 bits (414), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 93/277 (33%), Positives = 151/277 (54%), Gaps = 12/277 (4%)

Query: 369 DFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERT---VLARI 425
           DF   + +G GS+  V +   + T +++A+K   K +I+S+++V +   E+    +LA  
Sbjct: 9   DFSFKERLGHGSYSTVYKAVDRSTGQLFAIKVCSKKHIISENKVKYVTIEKNTLNLLAHG 68

Query: 426 DCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLH 485
           + P I+ L ++F   E LY VL    GGEL   LQ +GRF+ + ++ +  +L+ AL+ +H
Sbjct: 69  NHPGIIKLYYTFHDSENLYFVLDFAPGGELLQLLQTQGRFNEAWTKHFMCQLIDALEYIH 128

Query: 486 KMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDK---TDTFCGTPEYLAPELLLG 542
              V++RDLKPEN+LL  +G + + DFG+   N+   D    T +F GT EY++PELLL 
Sbjct: 129 GCKVVHRDLKPENLLLSSEGKLMITDFGVAS-NLAATDNLSSTSSFVGTAEYVSPELLLQ 187

Query: 543 QGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLLIGL 602
              +   D W +G +LY+   G PP+  EN    ++KI+     +     +   DL+  +
Sbjct: 188 NKSNFCSDIWAVGCMLYQFTQGTPPFRGENELAAFEKIVNLDYHWIYMVSQHITDLVSKI 247

Query: 603 LSRDPQRRLGYNGADEIKNHPFFSQLSW--KRLLMKG 637
           L  DP  R       +IKNH +F  + W  K L+ KG
Sbjct: 248 LVLDPDSRYTL---PQIKNHAWFQGIDWTNKELIWKG 281

>ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W
           (DBF20) - SH] complement(764718..766451) [1734 bp, 577
           aa]
          Length = 577

 Score =  162 bits (409), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 106/351 (30%), Positives = 167/351 (47%), Gaps = 56/351 (15%)

Query: 369 DFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCP 428
           DF+++  +G+G +G+V   RKKDTK+I ALK + K+ +   +   H L ER +L      
Sbjct: 181 DFEIITQVGQGGYGQVYLARKKDTKEICALKILNKNLLAKLNGTDHVLTERDILTTTRSE 240

Query: 429 FIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMD 488
           ++V L ++FQ    LYL +  + GG+    L          +RFY +E+ CA+D LHK+ 
Sbjct: 241 WLVKLLYAFQDPHSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHKLG 300

Query: 489 VIYRDLKPENILLDYQGHIALCDFGLC--------------------------------- 515
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 301 YTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMRIRLEEVKNLEFPEFKETSMD 360

Query: 516 -------KLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPY 568
                  ++  K+ +   +  G+P+Y+A E+L  + Y   VD+W+LG +L+E L G  P+
Sbjct: 361 YRRKMYHRVREKELNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 420

Query: 569 YDENVPKMY------KKILQDPLV---FPDGFDRDAKDLLIGLLSRDPQRRLGYNGADEI 619
              +  + Y      K++L+ P      P   DR  +  LI  L  DP  RL     + +
Sbjct: 421 SGSSSNETYENLRRWKQVLRRPRCENGRPAFSDRTWE--LITRLIADPINRL--RSFEHV 476

Query: 620 KNHPFFSQLSWKRLLMKGYIPPYKPPVTSATDTSNFDQEFTREKPIDSVVD 670
           K   +F+++ +  L  +   PP+ P + S TD   FD +FT E  +    D
Sbjct: 477 KKMKYFAEIDFANL--RSMSPPFIPQLDSETDAGYFD-DFTNEADMAKYAD 524

>Scas_627.7
          Length = 349

 Score =  156 bits (394), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 102/268 (38%), Positives = 154/268 (57%), Gaps = 7/268 (2%)

Query: 363 KPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVL 422
           KPLS+DDF++ K +GKG FGKV  VR K+T  I ALK + K+ IV  +       E  + 
Sbjct: 84  KPLSLDDFEIGKKLGKGKFGKVYCVRHKETGFICALKVMDKAEIVQYNLQKQFRREVEIQ 143

Query: 423 ARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRF-DLSRSRFYAAELLCAL 481
             ++ P +  L   F  ++++YL++  +  GEL+  L+  G F D+  SRF   ++  AL
Sbjct: 144 TSLNHPNLTKLYGHFHDEKRVYLLMEYLVYGELYKLLRSHGPFNDVIASRF-VFQIADAL 202

Query: 482 DTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLL 541
           + LH   +I+RDLKPENIL+ +   I L DFG   +N +   K  T CGT +YL+PE++ 
Sbjct: 203 NYLHDKQIIHRDLKPENILIGFNNVIKLTDFGWSIINPRGV-KRKTLCGTIDYLSPEMIR 261

Query: 542 GQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLLIG 601
            + Y   VD W LGVL YE++ G PP+ ++     YK+IL++ + FP+    D KDL+  
Sbjct: 262 SREYDDKVDVWALGVLTYELIVGSPPFEEDTKELTYKRILKNDIKFPETVSHDVKDLISK 321

Query: 602 LLSRDPQRRLGYNGADE----IKNHPFF 625
           LL  +P  R+      +    I+N PF+
Sbjct: 322 LLKYNPSERISMRDVMKHPWIIRNKPFW 349

>KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1
           Kluyveromyces lactis DBF2, start by similarity
          Length = 567

 Score =  157 bits (398), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 105/353 (29%), Positives = 167/353 (47%), Gaps = 56/353 (15%)

Query: 369 DFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCP 428
           DF+++  +G+G +G+V   RKKDTK+I ALK + K  ++      H L ER +L      
Sbjct: 171 DFEMITQVGQGGYGQVYLARKKDTKEICALKILNKKLLMKLEGTDHVLTERDILTTTRSE 230

Query: 429 FIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMD 488
           ++V L ++FQ  + LYL +  + GG+    L          +RFY +E+ CA++ LH++ 
Sbjct: 231 WLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLG 290

Query: 489 VIYRDLKPENILLDYQGHIALCDFGLC--------------------------------- 515
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 291 YTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMD 350

Query: 516 -------KLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPY 568
                  KL  ++     +  G+P+Y+A E+L  + Y   VD+W+LG +L+E L G  P+
Sbjct: 351 DRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 410

Query: 569 YDENVPKMY------KKILQDPLVFPDGF---DRDAKDLLIGLLSRDPQRRLGYNGADEI 619
              +  + Y      K +LQ P      +   DR  +  LI  L  DP  RL     + +
Sbjct: 411 SGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWE--LITRLIADPINRL--KSFEHV 466

Query: 620 KNHPFFSQLSWKRLLMKGYIPPYKPPVTSATDTSNFDQEFTREKPIDSVVDEY 672
           K   +FS++ +  L  +   PP+ P + +  D   FD +FT E+ +   VD +
Sbjct: 467 KRMRYFSEIDFNTL--RTIHPPFIPQLDNEEDVGYFD-DFTNEEHMARYVDVF 516

>Scas_716.33
          Length = 573

 Score =  155 bits (393), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 106/354 (29%), Positives = 174/354 (49%), Gaps = 58/354 (16%)

Query: 369 DFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCP 428
           DF+++  +G+G +G+V   RKKDT ++ ALK + K  +   +E  H L ER +L      
Sbjct: 177 DFEMITQVGQGGYGQVYLARKKDTNEVCALKILNKKLLFKLNETNHVLTERDILTTTRSQ 236

Query: 429 FIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRF-DLSRSRFYAAELLCALDTLHKM 487
           ++V L ++FQ  + LYL +  + GG+ F  L    RF   + +RFY +E+  A++ LH +
Sbjct: 237 WLVKLLYAFQDTQNLYLAMEFVPGGD-FRTLLINTRFLKSTHARFYISEMFLAVNALHDL 295

Query: 488 DVIYRDLKPENILLDYQGHIALCDFGLC------------KLNMKD-------------- 521
              +RDLKPEN L+D +GHI L DFGL             K+ +++              
Sbjct: 296 GYTHRDLKPENFLIDAKGHIKLTDFGLAAGTISNDRIQSMKVRLEEVKNLEFPEFSDKSI 355

Query: 522 EDK--------------TDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPP 567
           ED+               ++  G+P+Y+A E+L G+ Y   VD+W+L  +L+E L G  P
Sbjct: 356 EDRRQMYQKYRETEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLSCMLFESLVGYTP 415

Query: 568 YYDENVPKMY------KKILQDPLV---FPDGFDRDAKDLLIGLLSRDPQRRLGYNGADE 618
           +   +  + Y      KK L+ P++    P   DR   D +  L++ DP  RL     + 
Sbjct: 416 FSGSSTNETYENLRHWKKTLRRPMLDNGRPAFSDR-TWDFITRLIA-DPINRL--RSFEH 471

Query: 619 IKNHPFFSQLSWKRLLMKGYIPPYKPPVTSATDTSNFDQEFTREKPIDSVVDEY 672
           +K   +F  + +  L  +   PP+ P + + TD   FD +FT E  +    D +
Sbjct: 472 VKRMTYFESVDFNTL--RDLSPPFIPQLDNETDAGYFD-DFTNEADMAKYADVF 522

>AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C
           (PKH1) - SH] (1046762..1049863) [3102 bp, 1033 aa]
          Length = 1033

 Score =  158 bits (400), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 89/276 (32%), Positives = 149/276 (53%), Gaps = 14/276 (5%)

Query: 367 IDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARID 426
           I DF   + +G GS+  V+     ++ K YA K + K Y++ + +V +   E+  L R++
Sbjct: 197 IKDFKFGEALGDGSYSTVVLATCIESGKKYAAKILNKEYLIKQKKVKYVNIEKNTLQRLN 256

Query: 427 ---CPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDT 483
               P ++ L F+FQ +  LY +L     G+    ++R G      +++Y A++L A+  
Sbjct: 257 SSRVPGVIKLYFTFQDEANLYFLLEYAPNGDFLSVMKRFGTLSEECTKYYGAQILDAIHH 316

Query: 484 LHKMDVIYRDLKPENILLDYQGHIALCDFGLCKL-NMKDEDK-------TDTFCGTPEYL 535
           LHK  +I+RD+KPENILLD    I L DFG  KL   +DE+K       + +F GT EY+
Sbjct: 317 LHKQGIIHRDVKPENILLDKTMKIKLTDFGTAKLIGREDENKPYDLNTRSKSFVGTAEYV 376

Query: 536 APELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDA 595
           +PELL         D W  G +L++M+ G PP+   N    ++K+++    F  GF    
Sbjct: 377 SPELLNDNYVDSRCDIWAFGCILFQMVAGKPPFKATNEYLTFQKVMRVQYAFTAGFPMIL 436

Query: 596 KDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQLSWK 631
           +DL+  LL + P++RL      +I+ H FF+ ++++
Sbjct: 437 RDLIKQLLVKKPEQRLTI---LQIEKHHFFNDINFR 469

>AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)
           [2181 bp, 726 aa]
          Length = 726

 Score =  157 bits (397), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 89/278 (32%), Positives = 151/278 (54%), Gaps = 12/278 (4%)

Query: 362 NKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERT- 420
           +K  S  DF   + +G GS+  V +V ++ ++  YA+K   K +I+ +++V +   E+  
Sbjct: 2   SKRKSPHDFLFREELGHGSYSTVYRVVERSSQHQYAIKICSKRHIIGENKVKYVTIEKNT 61

Query: 421 --VLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELL 478
             +L + + P I+ L ++F  QE LY V+    GGEL   L+R+  F  + +R Y  +L+
Sbjct: 62  LNLLGQANHPGIIKLYYTFHDQENLYFVMDLAPGGELLQLLRRQRVFSEAWARHYMCQLV 121

Query: 479 CALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTD------TFCGTP 532
             ++ +H M VI+RDLKPEN+LLD +G + + DFG      + +  +D      +F GT 
Sbjct: 122 DTVEYIHSMGVIHRDLKPENVLLDKEGRLMIADFGAAYTVGQSDAGSDGDKPATSFVGTA 181

Query: 533 EYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFD 592
           EY++PELLL        D W LG +LY+ L G PP+  +N  + +++I+     +    +
Sbjct: 182 EYVSPELLLENKSYYSSDVWALGCMLYQFLQGTPPFRGQNEMETFEQIVNLDYTWRIPAN 241

Query: 593 RDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQLSW 630
             A  L+  +L  DP +R      ++IK H +FS + W
Sbjct: 242 PLAAGLVSKILVLDPSQRYTL---EQIKKHKWFSGVDW 276

>CAGL0G04609g complement(437162..440059) similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, hypothetical
           start
          Length = 965

 Score =  158 bits (400), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 91/307 (29%), Positives = 154/307 (50%), Gaps = 30/307 (9%)

Query: 367 IDDFDLLKVIGKGSFGKV-MQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARI 425
           I DF    ++G GS+ +V +   K D+ K YA+K + K Y++ + +V +   E+T L  +
Sbjct: 115 IKDFKFGDMLGDGSYSQVFLATSKTDSSKTYAVKVLNKEYLIKQKKVKYVNIEKTALQNL 174

Query: 426 -DCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTL 484
                ++ L F+FQ +  LY +L     G+    +++ G  +   + +Y+A+++ A+ ++
Sbjct: 175 KSVTGVINLSFTFQDEANLYFLLEYAPNGDFLSLIKKFGTLNEECTIYYSAQIIDAIGSM 234

Query: 485 HKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDK-----------TDTFCGTPE 533
           H   +I+RD+KPENILLD    I L DFG  KL  K  DK           + +F GT E
Sbjct: 235 HSHGIIHRDIKPENILLDGNMKIKLTDFGTAKLLQKKSDKNGKPHYNLLTRSSSFVGTAE 294

Query: 534 YLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDR 593
           Y++PELL         D W  G L+Y+M+ G PP+   N    ++K+++    F  GF  
Sbjct: 295 YVSPELLSDNYTDYKCDIWAFGCLVYQMIAGKPPFKATNEYLTFQKVMKVQFAFTAGFPT 354

Query: 594 DAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQLS------WKR--------LLMKGYI 639
             +DL+  +L + P++RL      +IK H  F  ++      W R         +    +
Sbjct: 355 IIRDLVKNILVKQPEKRLTI---PQIKEHCLFENINFSDNSVWNRDPPKILPYRINAKSM 411

Query: 640 PPYKPPV 646
            P+ PP+
Sbjct: 412 QPFSPPI 418

>Scas_660.20
          Length = 957

 Score =  157 bits (398), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 94/282 (33%), Positives = 154/282 (54%), Gaps = 25/282 (8%)

Query: 369 DFDLLKVIGKGSFGKVMQ-VRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERT---VLAR 424
           DF   + +G GS+  V + + K++TK+I+A+K   K++I+ +S+V +   E+    +LA+
Sbjct: 10  DFIFKEELGHGSYSTVYKAIDKRNTKRIFAIKVCSKAHIIKESKVKYVTIEKNTLNLLAK 69

Query: 425 IDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTL 484
              P IV L ++F  +E LY VL  + GGEL   L +   F    S+ +  +L+  L+ +
Sbjct: 70  AHHPGIVKLYYTFHDEENLYYVLDYLPGGELLSLLHKMKTFSEVWSKHFTVQLVDTLEFI 129

Query: 485 HKMDVIYRDLKPENILLDYQGHIALCDFGLCKL----NMKDEDKTDTFCGTPEYLAPELL 540
           H   VI+RDLKPEN+LLD  G + + DFG        N      + +F GT EY++PELL
Sbjct: 130 HSQGVIHRDLKPENVLLDRDGKLMITDFGAAYTTTAGNNDANKSSSSFVGTAEYVSPELL 189

Query: 541 LGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFP--------DGFD 592
           L    S   D W LG ++++ +TG PP+  EN  K ++KI+   L +P        + F 
Sbjct: 190 LHNQCSFSSDVWALGCMIFQFVTGSPPFRGENELKTFEKIVA--LDYPWSSTNIHNNKFL 247

Query: 593 RDAKDLLIGLLSR----DPQRRLGYNGADEIKNHPFFSQLSW 630
            +   L+I L+ +    +P+ RL      +IK  P+F+ ++W
Sbjct: 248 NNINPLIINLVRKILVLEPKDRLSL---KKIKQDPWFATVNW 286

>CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces
           cerevisiae YOL100w PKH2, start by similarity
          Length = 1076

 Score =  157 bits (397), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 85/277 (30%), Positives = 149/277 (53%), Gaps = 15/277 (5%)

Query: 367 IDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARID 426
           I DF   +++G G++  VM    KD+ K YA+K + K Y++ + +V +   E+  L R++
Sbjct: 179 IKDFKFGEMVGDGAYSTVMLATAKDSGKKYAVKVLNKEYLIKQKKVKYVNIEKNALQRLN 238

Query: 427 -CPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLH 485
               IV L F+FQ +  LY +L     G+    +++ G      +R+Y+A+++  +  LH
Sbjct: 239 NSRGIVKLFFTFQDESSLYFLLEYAPNGDFLSVMKKYGSLSEDCTRYYSAQIIDGIKYLH 298

Query: 486 KMDVIYRDLKPENILLDYQGHIALCDFGLCK-LNMKDED----------KTDTFCGTPEY 534
              +I+RD+KPENILLD    + + DFG  K L  K+ED          ++ +F GT EY
Sbjct: 299 SKGIIHRDIKPENILLDKDMKVKITDFGTAKILEPKNEDEDNPEFNLLTRSKSFVGTAEY 358

Query: 535 LAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRD 594
           ++PELL         D W  G ++++M+ G PP+   N    ++K+++    F  GF   
Sbjct: 359 VSPELLNDSYVDARCDIWAFGCMVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPVV 418

Query: 595 AKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQLSWK 631
            +DL+  +L + P++RL      +I+ H F+  +S++
Sbjct: 419 VRDLVKRILLKVPEQRLTI---PQIEKHHFYKDISFE 452

>YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine
           protein kinase of unknown function [2697 bp, 898 aa]
          Length = 898

 Score =  153 bits (386), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 97/297 (32%), Positives = 153/297 (51%), Gaps = 37/297 (12%)

Query: 366 SIDDFDLLKVIGKGSFGKVMQ-VRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERT---V 421
           S  DF   + +G GS+  V + + KK   KIYA+K   K +I+ +++V +   E+    +
Sbjct: 7   SPHDFIFKEELGHGSYSTVFKALDKKSPNKIYAIKVCSKKHIIKEAKVKYVTIEKNTMNL 66

Query: 422 LARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCAL 481
           LA+     I+ L ++F  +E LY VL    GGEL   L + G F+   +R + A+L+ AL
Sbjct: 67  LAQKHHAGIIKLYYTFHDEENLYFVLDFAPGGELLSLLHKMGTFNDIWTRHFTAQLIDAL 126

Query: 482 DTLHKMDVIYRDLKPENILLDYQGHIALCDFGL------------CKLN-----MKDEDK 524
           + +H   +I+RDLKPEN+LLD  G + + DFG              K N      KD   
Sbjct: 127 EFIHSHGIIHRDLKPENVLLDRDGRLMITDFGAAATIDPSLSGDSAKFNSDSNGSKDNQN 186

Query: 525 TDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDP 584
             +F GT EY++PELLL        D W LG ++Y+ + G PP+  EN  K ++KI+   
Sbjct: 187 CASFVGTAEYVSPELLLYNQCGYGSDIWALGCMIYQFVQGQPPFRGENELKTFEKIVA-- 244

Query: 585 LVFPDGFDRDAKD-------LLIGLLSR----DPQRRLGYNGADEIKNHPFFSQLSW 630
           L +P G +    +       L+I L+ +    +   R+     ++IK HP+FS++ W
Sbjct: 245 LDYPWGPNNRINNSTSPINPLVINLVQKILVIEVNERISL---EQIKRHPYFSKVDW 298

>KLLA0D07810g complement(669095..671251)
           gi|401646|sp|P31034|YL44_KLULA Kluyveromyces lactis
           Hypothetical 31.8 kDa protein in L44/L41 3 region, start
           by similarity
          Length = 718

 Score =  151 bits (382), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 106/158 (67%)

Query: 368 DDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDC 427
           DDF+ +KVIGKG+FG+V  V+KKDT KIYA+K + KS + +K ++ H  AER VLA  D 
Sbjct: 301 DDFNSVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYNKDQLAHVKAERDVLAGSDS 360

Query: 428 PFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKM 487
           P++V L +SFQ  + LYL++  + GG+L   L R   F    +RFY AE + A++ +HK+
Sbjct: 361 PWVVSLYYSFQDSQYLYLIMEFLPGGDLMTMLIRWQIFTEDVTRFYMAECILAIEVIHKL 420

Query: 488 DVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKT 525
             I+RD+KP+NIL+D +GHI L DFGL     K  D +
Sbjct: 421 GFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSS 458

 Score =  109 bits (273), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 56/131 (42%), Positives = 78/131 (59%), Gaps = 6/131 (4%)

Query: 529 CGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKIL--QDPLV 586
            GTP+Y+APE+ L QGY +  DWW+LG ++YE L G PP+  E   + Y+KI+  +  L 
Sbjct: 531 VGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQ 590

Query: 587 FPD--GFDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQLSWKRLLMKGYIPPYKP 644
           FPD      +A+DL+  LL+    R   + GADEIK HPFFS + W  +  +    PY P
Sbjct: 591 FPDDIHISYEAEDLIRRLLTHSENRLGRHGGADEIKAHPFFSGVDWNTI--RQVEAPYIP 648

Query: 645 PVTSATDTSNF 655
            ++S TDT  F
Sbjct: 649 KLSSVTDTRFF 659

>AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH]
           complement(498529..500688) [2160 bp, 719 aa]
          Length = 719

 Score =  150 bits (378), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 85/194 (43%), Positives = 118/194 (60%), Gaps = 7/194 (3%)

Query: 335 RLYNHHWVELR-----DGLGKINISVDYKPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRK 389
           +L +H W E R       LGK      +   R   LS++DF  +KVIGKG+FG+V  V+K
Sbjct: 272 QLLSHGWSEERKNRQLSSLGKKE--SQFLRLRRTRLSLEDFHTVKVIGKGAFGEVRLVQK 329

Query: 390 KDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPFIVPLKFSFQSQEKLYLVLAC 449
           KDT KIYA+K + KS +  K ++ H  AER VLA  D P++V L +SFQ  + LYL++  
Sbjct: 330 KDTGKIYAMKTLLKSEMYKKDQLAHVKAERDVLAGSDSPWVVSLYYSFQDAQYLYLIMEF 389

Query: 450 INGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIAL 509
           + GG+L   L R   F    +RFY AE + A++ +HK+  I+RD+KP+NIL+D +GHI L
Sbjct: 390 LPGGDLMTMLIRWQIFTEDVTRFYMAECILAIEAIHKLGFIHRDIKPDNILIDIRGHIKL 449

Query: 510 CDFGLCKLNMKDED 523
            DFGL     K  D
Sbjct: 450 SDFGLSTGFHKTHD 463

 Score =  116 bits (290), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 60/131 (45%), Positives = 83/131 (63%), Gaps = 7/131 (5%)

Query: 529 CGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKIL--QDPLV 586
            GTP+Y+APE+ L QGY +  DWW+LG ++YE L G PP+  E   + Y+KI+  +  LV
Sbjct: 532 VGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLV 591

Query: 587 FPD--GFDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQLSWKRLLMKGYIPPYKP 644
           FPD      +A+DL+  LLS   + RLG +GA+EIKNHPFF  + W+ +   G   PY P
Sbjct: 592 FPDDIHISYEAEDLIRRLLSHADE-RLGRHGANEIKNHPFFRGVDWETIRQVG--APYIP 648

Query: 645 PVTSATDTSNF 655
            ++S TDT  F
Sbjct: 649 KLSSVTDTRFF 659

>Kwal_33.14554
          Length = 714

 Score =  149 bits (376), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 103/156 (66%)

Query: 368 DDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDC 427
           +DF  +KVIGKG+FG+V  V+KKDT KIYA+K + KS +  K ++ H  AER VLA  D 
Sbjct: 301 EDFQTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKDQLAHVKAERDVLAGSDS 360

Query: 428 PFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKM 487
           P++V L +SFQ  + LYL++  + GG+L   L R   F    +RFY AE + A++ +HK+
Sbjct: 361 PWVVSLYYSFQDTQYLYLIMEFLPGGDLMTMLIRWQIFTEDVTRFYMAECILAIEAIHKL 420

Query: 488 DVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDED 523
             I+RD+KP+NIL+D +GHI L DFGL     K  D
Sbjct: 421 GFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHD 456

 Score =  108 bits (271), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 56/131 (42%), Positives = 79/131 (60%), Gaps = 6/131 (4%)

Query: 529 CGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKIL--QDPLV 586
            GTP+Y+APE+ L QGY +  DWW+LG ++YE L G PP+  E   + Y+KI+  +  L 
Sbjct: 529 VGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQ 588

Query: 587 FPD--GFDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQLSWKRLLMKGYIPPYKP 644
           FPD      +A+DL+  LL+   QR   + GADEIK+HPFF  + W  +  +    PY P
Sbjct: 589 FPDDIHISYEAEDLIRRLLTHADQRLGRHGGADEIKSHPFFRGVDWNTI--RQVEAPYIP 646

Query: 645 PVTSATDTSNF 655
            ++S TDT  F
Sbjct: 647 KLSSITDTRFF 657

>KLLA0F13552g complement(1252906..1256709)
           gi|33386566|emb|CAD87727.1 Kluyveromyces lactis protein
           kinase, start by similarity
          Length = 1267

 Score =  149 bits (377), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 86/267 (32%), Positives = 149/267 (55%), Gaps = 9/267 (3%)

Query: 370 FDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKS--EVTHTLAERTVLAR-ID 426
           + L K +GKGS G+V   +  +T K+ A+K + K ++ S    ++ + +    ++ + I 
Sbjct: 73  WKLGKTLGKGSSGRVRLAKNMETGKLSAIKIVPKKFVKSNQIKQLPYGIEREIIIMKLIS 132

Query: 427 CPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHK 486
            P ++ L   ++++ +LYLVL  + GGELF +L  +G+   S +  Y  +++ A+   H 
Sbjct: 133 HPNVMGLYEVWENKSELYLVLEYVEGGELFDYLVSKGKLPESEAIHYFKQIVQAVAYCHG 192

Query: 487 MDVIYRDLKPENILLDYQGH-IALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGY 545
            ++ +RDLKPEN+LLD +   I + DFG+  L   D+   +T CG+P Y +PE++LG+ Y
Sbjct: 193 FNICHRDLKPENLLLDKKKRSIKIADFGMAALETSDK-LLETSCGSPHYASPEIVLGRKY 251

Query: 546 -SKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLLIGLLS 604
                D W+ G++L+ +LTG  P+ D+NV K+  K+       P     +AKDL+  +L 
Sbjct: 252 HGSPSDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQWLSVEAKDLISRILV 311

Query: 605 RDPQRRLGYNGADEIKNHPFFSQLSWK 631
            DP RR+     D+I  H   ++   K
Sbjct: 312 VDPNRRITI---DQILQHELLTKYDQK 335

>Scas_654.12
          Length = 737

 Score =  148 bits (373), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 103/156 (66%)

Query: 368 DDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDC 427
           +DF  +KVIGKG+FG+V  V+K DT KIYA+K + KS +  K ++ H  AER VLA  D 
Sbjct: 317 EDFHTVKVIGKGAFGEVRLVQKIDTGKIYAMKTLLKSEMYKKDQLAHVKAERDVLAGSDS 376

Query: 428 PFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKM 487
           P++V L +SFQ  + LYL++  + GG+L   L R   F    +RFY AE + A++T+HK+
Sbjct: 377 PWVVSLYYSFQDTQYLYLIMEFLPGGDLMTMLIRWQLFTEDVTRFYMAECILAIETIHKL 436

Query: 488 DVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDED 523
             I+RD+KP+NIL+D +GHI L DFGL     K  D
Sbjct: 437 GFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHD 472

 Score =  109 bits (272), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 56/131 (42%), Positives = 79/131 (60%), Gaps = 6/131 (4%)

Query: 529 CGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKIL--QDPLV 586
            GTP+Y+APE+ L QGY +  DWW+LG ++YE L G PP+  E   + Y+KI+  +  L 
Sbjct: 548 VGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQ 607

Query: 587 FPD--GFDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQLSWKRLLMKGYIPPYKP 644
           FPD      +A+DL+  LL+   QR   + GADEIK+HPFF  + W  +  +    PY P
Sbjct: 608 FPDDIHISYEAEDLIRRLLTHADQRLGRHGGADEIKSHPFFRGVDWNTI--RQVEAPYIP 665

Query: 645 PVTSATDTSNF 655
            ++S TDT  F
Sbjct: 666 KLSSITDTRFF 676

>Kwal_47.18307
          Length = 621

 Score =  145 bits (367), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 87/271 (32%), Positives = 144/271 (53%), Gaps = 11/271 (4%)

Query: 368 DDFDLLKVIGKGSFGKVMQ-VRKKDTKKIYALKAIRKSYIVSKSEVTHTLAER---TVLA 423
           D +  L  +G+GS+  V + V + ++ + YA+K   K +I+ + +V +   E+    +LA
Sbjct: 8   DSYVFLDRLGQGSYSTVYRAVERSNSGRNYAIKVCSKKHIIREKKVKYVTIEKDLLNMLA 67

Query: 424 RIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDT 483
           +     IV L  +F   E LY VL  ++GGEL   +QR GR     SR   A+L+  +D 
Sbjct: 68  KGGHLGIVKLFCTFHDIENLYFVLEYVSGGELLALIQRLGRLTEDLSRHITAQLVDTVDY 127

Query: 484 LHKMDVIYRDLKPENILLDYQGHIALCDFG-LCKL---NMKDEDKTDTFCGTPEYLAPEL 539
           +H   VI+RDLKPEN+LL  +G + + DFG  C       ++  +T +F GT EY++PEL
Sbjct: 128 MHSKGVIHRDLKPENVLLSQEGRVVITDFGAACTAADRKFENTKRTASFVGTAEYVSPEL 187

Query: 540 LLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLL 599
           LL        D W LG ++Y++  G PP+  EN  + ++KI+     +          ++
Sbjct: 188 LLHSQCGFSSDIWALGCIIYQLNQGKPPFRGENELQTFEKIVALDYKWLFSNSPQVVSIV 247

Query: 600 IGLLSRDPQRRLGYNGADEIKNHPFFSQLSW 630
             +L  DP +R     A ++K +P+F+ + W
Sbjct: 248 QSILVTDPLKR---PSAAQLKQNPWFASIDW 275

>ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH]
           complement(333434..337711) [4278 bp, 1425 aa]
          Length = 1425

 Score =  145 bits (367), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 85/273 (31%), Positives = 143/273 (52%), Gaps = 23/273 (8%)

Query: 366 SIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERT----- 420
           ++  + L K +GKGS G+V   +   + K+ A+K      IV K  V H   + T     
Sbjct: 57  TVGPWKLGKTLGKGSSGRVRLAKNMQSGKLAAIK------IVPKRNVRHNQKQVTALPYG 110

Query: 421 ------VLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYA 474
                 ++  I  P I+ L   ++++ +LYLVL  + GGELF +L   G+     +  Y 
Sbjct: 111 IEREIIIMKLITHPNIMALYEVWENKSELYLVLEYVEGGELFDYLIARGKLPEQEAIHYF 170

Query: 475 AELLCALDTLHKMDVIYRDLKPENILLDYQGH-IALCDFGLCKLNMKDEDKTDTFCGTPE 533
            +++  +   H  ++ +RDLKPEN+LLD +   + + DFG+  L   +    +T CG+P 
Sbjct: 171 KQIVQGVSYCHNFNICHRDLKPENLLLDKKNKTVKIADFGMAALETTNR-LLETSCGSPH 229

Query: 534 YLAPELLLGQGY-SKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFD 592
           Y +PE+++GQ Y     D W+ G++L+ +LTG  P+ D+NV K+  K+       P    
Sbjct: 230 YASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPFNDDNVRKLLLKVQHGRYQMPSNVS 289

Query: 593 RDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFF 625
           ++AKDL+  +L  DP++R+     D+I  HP  
Sbjct: 290 KEAKDLISKILVVDPEKRI---TVDKILEHPLL 319

>Scas_502.2
          Length = 1116

 Score =  145 bits (366), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 81/268 (30%), Positives = 142/268 (52%), Gaps = 12/268 (4%)

Query: 367 IDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARID 426
           I DF   +++G G++  VM     D+ K YA+K + K Y++ + +V +   E+  L R++
Sbjct: 171 IKDFKFGEMLGDGAYSTVMLATSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKLALQRLN 230

Query: 427 -CPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLH 485
               I+ L F+FQ +  LY +L     G+L   +++ G  +     +Y A+++ A+  +H
Sbjct: 231 NSRSIIRLFFTFQDEASLYFLLEYAPNGDLLSLMKKFGSLNEECCCYYGAQIIDAIKFMH 290

Query: 486 KMDVIYRDLKPENILLDYQGHIALCDFGLCK-LNMKDE-------DKTDTFCGTPEYLAP 537
              +I+RD+KPENILLD    + + DFG  K L+ K          ++ +F GT EY++P
Sbjct: 291 SKGIIHRDIKPENILLDKDMKVKITDFGTAKILDNKPPGTSYDLLTRSKSFVGTAEYVSP 350

Query: 538 ELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKD 597
           ELL         D W  G ++++M+ G PP+   N    ++K+++    F  GF    +D
Sbjct: 351 ELLNDNYTDARSDIWAFGCIVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPTVVRD 410

Query: 598 LLIGLLSRDPQRRLGYNGADEIKNHPFF 625
           L+  +L + P++RL     + I+ H FF
Sbjct: 411 LVKRILIKAPEQRLTI---EAIEKHHFF 435

>Kwal_26.7788
          Length = 1267

 Score =  144 bits (362), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 81/270 (30%), Positives = 147/270 (54%), Gaps = 7/270 (2%)

Query: 366 SIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLAR- 424
           +I  + L K +GKGS G+V   +  +T K+ A+K + K+       + + +    ++ + 
Sbjct: 54  TIGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKTKSSRTGSLPYGIEREIIIMKL 113

Query: 425 IDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTL 484
           I  P ++ L   ++++ +L+LVL  ++GGELF +L   GR     +  Y  +++      
Sbjct: 114 ISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLPEKEAIHYFRQIIEGTAYC 173

Query: 485 HKMDVIYRDLKPENILLDYQG-HIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQ 543
           H  ++ +RDLKPEN+LLD +   I + DFG+  L   ++   +T CG+P Y +PE+++G+
Sbjct: 174 HGFNICHRDLKPENLLLDKKNKRIKIADFGMAALQTSNK-LLETSCGSPHYASPEIVMGK 232

Query: 544 GYS-KVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLLIGL 602
            Y+    D W+ G++L+ +LTG  P+ D+N+ ++  K+       P      A+DL+  +
Sbjct: 233 NYNGGPSDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMPQSVSSGAQDLISRI 292

Query: 603 LSRDPQRRLGYNGADEIKNHPFFSQLSWKR 632
           L  DP +R+  N   EI  HP  ++   KR
Sbjct: 293 LVVDPDKRISIN---EILAHPLLAKYGNKR 319

>YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kinase
           required for induction of Rnr3p and DNA repair genes
           after DNA damage [1542 bp, 513 aa]
          Length = 513

 Score =  140 bits (353), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 100/301 (33%), Positives = 148/301 (49%), Gaps = 34/301 (11%)

Query: 358 KPSRNKPLSI-DDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTL 416
           K ++ +P+S  D + L K +G G +  V + + K T +  A+K         + +     
Sbjct: 187 KLNKTRPVSFFDKYLLGKELGAGHYALVKEAKNKKTGQQVAVKIFHAQQNDDQKKNKQFR 246

Query: 417 AERTVLARIDCPFIVPLKFSF-----QSQEKLYLVLACINGGELFYHLQREGRFDLSRSR 471
            E  +L R+  P IV L  SF     +SQ + YLVL  I+ GELF  + R+       S+
Sbjct: 247 EETNILMRVQHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQDESK 306

Query: 472 FYAAELLCALDTLHKMDVIYRDLKPENILLDYQG-------------------HIALCDF 512
               +LL  L  LH+ ++I+RD+KPENILL+                       + + DF
Sbjct: 307 ALFKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADF 366

Query: 513 GLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDE- 571
           GL K    +   T+T CGTP Y+APE+L  +GY+  VD W+ GV+LY  L G PP+ D+ 
Sbjct: 367 GLAKF-TGEMQFTNTLCGTPSYVAPEVLTKKGYTSKVDLWSAGVILYVCLCGFPPFSDQL 425

Query: 572 NVPKMYKKILQDPLVFP----DGFDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQ 627
             P + ++ILQ    F     D  D     L+  LL  +P  R  YN  DE  NHP+F+ 
Sbjct: 426 GPPSLKEQILQAKYAFYSPYWDKIDDSVLHLISNLLVLNPDER--YN-IDEALNHPWFND 482

Query: 628 L 628
           +
Sbjct: 483 I 483

>CAGL0K06479g 636296..639271 some similarities with tr|Q03306
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 991

 Score =  143 bits (360), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 98/308 (31%), Positives = 155/308 (50%), Gaps = 44/308 (14%)

Query: 369 DFDLLKVIGKGSFGKVMQVRKKDTKKI-YALKAIRKSYIVSKSEVTHTLAERT---VLAR 424
           +F   + +G GS+  V +   K   K  YA+K   K +I+ +++V +   E+    +LAR
Sbjct: 10  EFIFKEELGHGSYSTVYKALDKKDLKKPYAIKVCSKRHIIKEAKVKYVTIEKNTLNLLAR 69

Query: 425 IDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTL 484
            + P IV L ++F  +E LY VL   +GGEL   L + G F  S ++ +AA+L+  L+ +
Sbjct: 70  GNHPGIVKLYYTFHDEENLYFVLDYASGGELLSLLHKMGTFTDSWAKHFAAQLVDTLEFM 129

Query: 485 HKMDVIYRDLKPENILLDYQGHIALCDFGLCKL--NMKDEDKT----------------- 525
           H   VI+RDLKPEN+LL  +G + + DFG      N  D+D T                 
Sbjct: 130 HARGVIHRDLKPENVLLSKEGILMITDFGAAATQNNFSDKDNTRSNANEGIPKDDVPSSG 189

Query: 526 -----DTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKI 580
                 +F GT EY++PELLL    S   D W LG ++Y+ + G PP+  EN  K ++KI
Sbjct: 190 DKTECSSFVGTAEYVSPELLLYNKCSFGSDIWALGCMVYQFIQGFPPFRGENELKTFEKI 249

Query: 581 LQDPLVFPDGFDRDAK---------DLLIGLLSRDPQRRLGYNGADEIKNHPFFSQLSW- 630
           +   L +    +R            +L+  +L+ D  +R      D+IK  P+F+ + W 
Sbjct: 250 VS--LDYSWNPERQTNFGTINIQVVNLVRRMLTIDTTQRATI---DQIKRDPWFANVDWG 304

Query: 631 -KRLLMKG 637
            K+ L +G
Sbjct: 305 DKKKLWRG 312

>KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 843

 Score =  140 bits (354), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 85/261 (32%), Positives = 138/261 (52%), Gaps = 13/261 (4%)

Query: 367 IDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARID 426
           I ++ + K IG+GSFGKV     + T +   LK   K          + + E     + D
Sbjct: 34  IGNYKISKFIGEGSFGKVYLATHRLTHQKVVLKTGNK-------RDPNVVREVFYHRQFD 86

Query: 427 CPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHK 486
            P+I  L     ++ ++++VL   +G EL+ HL +E R  L  S+   +++  A+   H+
Sbjct: 87  FPYITKLYEVIVTESRVWMVLEYCSGHELYEHLLKEQRLSLEESKKLFSQIASAVYYAHE 146

Query: 487 MDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYS 546
           +  ++RDLK EN+LLD  GH  L DFG  +  M    + +T CGT  Y+APEL+  + Y 
Sbjct: 147 LKCVHRDLKLENVLLDGNGHAKLTDFGFTR-EMATRSQLETICGTTVYMAPELIERKCYD 205

Query: 547 KV-VDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVF-PDGFDRDAKDLLIGLLS 604
              VD W+LG++LY M+ G  P+ +++  K   KI+ D L F  +    DA DL+ G+L 
Sbjct: 206 GFKVDIWSLGIILYTMINGYMPFDEDDDIKTKLKIVNDELDFNQEWISDDAIDLIQGMLR 265

Query: 605 RDPQRRLGYNGADEIKNHPFF 625
           ++P  R+      ++ +HPF 
Sbjct: 266 KNPNERISLA---QVLSHPFL 283

>AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C
           (CMK1) - SH] complement(358947..360308) [1362 bp, 453
           aa]
          Length = 453

 Score =  135 bits (339), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 78/251 (31%), Positives = 133/251 (52%), Gaps = 10/251 (3%)

Query: 369 DFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCP 428
           D+   K +G G+FG V Q R     +  A+K + K  +   +E+     E ++L ++D P
Sbjct: 55  DYIFGKTLGAGAFGVVRQARNSKQNQNVAIKILLKRAL-KGNELQMLYDELSILQKLDHP 113

Query: 429 FIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMD 488
            IV  K  F+S+EK Y+V     GGELF  + ++G+F  + +     ++L A++ +H  +
Sbjct: 114 NIVKFKDWFESREKFYIVTQLATGGELFDRILKKGKFTETDAVKIVVQMLTAVEYMHSQN 173

Query: 489 VIYRDLKPENIL-LD--YQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGY 545
           V++RDLKPEN+L LD   +  + + DFG+ K    +        G+  Y+APE+L   G+
Sbjct: 174 VVHRDLKPENVLYLDPSDESQLVISDFGIAKQLSSESQLIHRAAGSMGYVAPEVLTTSGH 233

Query: 546 SKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKIL--QDPLVFP----DGFDRDAKDLL 599
            K  D W+LGV+ Y +L G  P+  E+     +++    DP+ F     +   ++AK  +
Sbjct: 234 GKPCDIWSLGVITYTLLCGYSPFIAESTEGFLEEVFSGSDPVTFHSPYWNNISKEAKQFI 293

Query: 600 IGLLSRDPQRR 610
           +  L+  P RR
Sbjct: 294 LRALTLTPARR 304

>KLLA0E01584g 149713..150960 highly similar to sp|P39009
           Saccharomyces cerevisiae YDL101c DUN1 protein kinase,
           start by similarity
          Length = 415

 Score =  134 bits (337), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 96/297 (32%), Positives = 136/297 (45%), Gaps = 34/297 (11%)

Query: 360 SRNKPLSI-DDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAE 418
           +R +P S  D +   K +G G +  V + R K+T +  A+K                  E
Sbjct: 90  TREQPRSFFDKYLAGKELGTGHYAIVKEARNKETGETVAVKIFHPQQNDDDKRTKKFTEE 149

Query: 419 RTVLARIDCPFIVPLKFSF-----QSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFY 473
             +L  I  P IV L   F     ++Q + YLVL  IN GELF  + R+       ++  
Sbjct: 150 TKILLSIQHPNIVKLIDRFVEPVSKTQIQTYLVLEKINDGELFERIVRKNNLREDETKAL 209

Query: 474 AAELLCALDTLHKMDVIYRDLKPENILLDYQG-------------------HIALCDFGL 514
             +LL  L  LH  ++I+RD+KPENILL                        + + DFGL
Sbjct: 210 FRQLLNGLKYLHSRNIIHRDIKPENILLSISKRRSPEEIALGPWDDDELDIQVKIADFGL 269

Query: 515 CKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENV- 573
            K    +   T+T CGTP Y+APE+L+  GY+  VD W+ GVLLY  L G PP+ ++   
Sbjct: 270 AKFT-GEMKFTNTLCGTPSYVAPEVLVKTGYTSRVDMWSAGVLLYVCLCGFPPFSEQLAP 328

Query: 574 PKMYKKILQDPLVFP----DGFDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFS 626
           P M ++ILQ    F     D  D     L+  LL  +P  R   N A     HP+F+
Sbjct: 329 PSMKEQILQGKFAFYSPYWDNIDDSVLHLISNLLVVNPASRFSVNDA---LTHPWFT 382

>Scas_616.10
          Length = 1461

 Score =  138 bits (348), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 90/317 (28%), Positives = 158/317 (49%), Gaps = 44/317 (13%)

Query: 349 GKINISVDYKPSRNKPL-SIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIV 407
            + + S D K S+ K   ++  + L K +GKGS G+V   +  +T ++ A+K + K + +
Sbjct: 79  SQFSTSTDTKSSKRKSRDTVGPWKLGKTLGKGSSGRVRLAKNIETGQLAAIKIVPKKHKL 138

Query: 408 ----SKSEVT------------HTLA---------------------ERTVLARIDCPFI 430
               S S V+             TLA                     E  ++  I  P +
Sbjct: 139 FMKSSHSNVSFFSAASNSNSNISTLATSPPMNNGSEKNQPNPYGIEREIVIMKLISHPNV 198

Query: 431 VPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDVI 490
           + L   ++++ +LYLVL  ++GGELF +L  +G+     +  Y  +++  +   H  ++ 
Sbjct: 199 MALYEVWENKSELYLVLEYVDGGELFDYLVSKGKLSEKEAVHYFKQIIQGVSYCHSFNIC 258

Query: 491 YRDLKPENILLDYQGH-IALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGY-SKV 548
           +RDLKPEN+LLD +   I + DFG+  L + ++    T CG+P Y +PE+++G+ Y    
Sbjct: 259 HRDLKPENLLLDKKNKSIKIADFGMAALELPNK-LLQTSCGSPHYASPEIVMGKSYHGGP 317

Query: 549 VDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLLIGLLSRDPQ 608
            D W+ G++L+ +LTG  P+ D+N+ K+  K+       P     +A+DL+  +L  DP 
Sbjct: 318 SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGKFRMPSTLSPEAQDLISRILVIDPS 377

Query: 609 RRLGYNGADEIKNHPFF 625
           +R+     D I NHP  
Sbjct: 378 KRI---TTDRILNHPLI 391

>CAGL0J11638g complement(1128620..1130860) highly similar to
           sp|P32562 Saccharomyces cerevisiae YMR001c CDC5 involved
           in regulation of DNA replication, hypothetical start
          Length = 746

 Score =  137 bits (344), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 84/278 (30%), Positives = 140/278 (50%), Gaps = 18/278 (6%)

Query: 369 DFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCP 428
           D+   + +G+G F +  Q+ K D+ KI+A K + K  I S+      L+E  +   +   
Sbjct: 80  DYHRGQFLGEGGFARCFQI-KDDSGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMSHT 138

Query: 429 FIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMD 488
            IV     F+    +Y++L     G L   +++         RF+  ++   +  +H   
Sbjct: 139 NIVQFIDCFEDNVNVYILLEICPNGSLMELIKKRKTITEPEVRFFMTQICGGIQYMHSNR 198

Query: 489 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQ--GYS 546
           VI+RDLK  NI  D   ++ + DFGL  +   D ++  T CGTP Y+APE+L+G+  G+S
Sbjct: 199 VIHRDLKLGNIFFDEHYNLKIGDFGLAAVLANDRERKFTICGTPNYIAPEVLMGKHSGHS 258

Query: 547 KVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFP--DGFDRDAKDLLIGLLS 604
             VD W++GV+LY +L G PP+  ++V  +Y++I Q    +P      +DAK L+  +LS
Sbjct: 259 YEVDIWSIGVMLYALLIGKPPFQAKDVNTIYERIKQRNFAYPKDKKISQDAKYLIDDILS 318

Query: 605 RDPQRRLGYNGADEIKNHPFFSQLSWKRLLMKGYIPPY 642
            +P  R       EI ++ +F          +G  PPY
Sbjct: 319 LNPMER---PSIQEIMDYVWF----------RGTFPPY 343

>CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces
           cerevisiae YDL101c DUN1 protein kinase, start by
           similarity
          Length = 506

 Score =  134 bits (336), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 96/302 (31%), Positives = 147/302 (48%), Gaps = 34/302 (11%)

Query: 358 KPSRNKPLSI-DDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTL 416
           K ++ KPLS  D + L K +G G +  V + + K T +  A+K         + +     
Sbjct: 180 KFAKLKPLSFFDKYLLGKDLGSGHYAIVKEAKNKTTGETVAVKIFHPQQNDDQKKNKQFR 239

Query: 417 AERTVLARIDCPFIVPLKFSF-----QSQEKLYLVLACINGGELFYHLQREGRFDLSRSR 471
            E T+L +I  P IV L  SF     ++Q + YLVL  I+ GELF  + ++       S+
Sbjct: 240 EETTILMKIHHPNIVNLLDSFVEPISKTQIQKYLVLEKIDDGELFDRIVKKTSLPQEESK 299

Query: 472 FYAAELLCALDTLHKMDVIYRDLKPENILLDYQG-------------------HIALCDF 512
               ++L  L  LH  ++I+RD+KPENILL+ +                     + + DF
Sbjct: 300 AIFKQILTGLKYLHSQNIIHRDIKPENILLNIRRRQSPDERQLGPWDEDEIDIQVKIADF 359

Query: 513 GLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDE- 571
           GL K    +   T+T CGTP Y+APE+L+ +GY+  VD W+ GV+LY  L G PP+ D+ 
Sbjct: 360 GLAKFT-GEMQFTNTLCGTPSYVAPEVLVKKGYTSKVDLWSAGVILYVCLCGFPPFSDQL 418

Query: 572 NVPKMYKKILQDPLVFP----DGFDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQ 627
             P + ++I+     F     D  D  A  L+  LL  DP+ R   + A     HP+   
Sbjct: 419 GPPSLKEQIMSAKYAFYSPYWDEIDDAALHLISNLLVLDPENRYDVDAA---AAHPWLDS 475

Query: 628 LS 629
           +S
Sbjct: 476 VS 477

>Kwal_47.18233
          Length = 598

 Score =  134 bits (337), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 91/318 (28%), Positives = 164/318 (51%), Gaps = 16/318 (5%)

Query: 367 IDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLA-ERTVLARI 425
           I  + ++K +G+GSFGKV       T +  ALK I K  +++KS++   +  E + L  +
Sbjct: 28  IGKYQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKK-VLAKSDMQGRIEREISYLRLL 86

Query: 426 DCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLH 485
             P I+ L    +S++++ +V+    G ELF ++ +  +   + +R +  +++ A++  H
Sbjct: 87  RHPHIIKLYDVVKSKDEIVMVIEYA-GNELFDYIVQRDKMSENEARRFFQQIISAVEYCH 145

Query: 486 KMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGY 545
           +  +++RDLKPEN+LLD   ++ + DFGL  + M D +   T CG+P Y APE++ G+ Y
Sbjct: 146 RHKIVHRDLKPENLLLDEHLNVKIADFGLSNI-MTDGNFLRTSCGSPNYAAPEVISGKLY 204

Query: 546 SK-VVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLLIGLLS 604
           +   VD W+ GV+LY ML    P+ DE++P ++K I       P      A +L+  +L 
Sbjct: 205 AGPEVDVWSSGVILYVMLCRRLPFDDESIPVLFKNISNGIYTLPKFLSPGAANLIKRMLI 264

Query: 605 RDPQRRLGYNGADEIKNHPFFSQLSWKRLLMKGYIPPYKPPVTSATDTSNFDQEFTREKP 664
            +P  R+  +            Q  W ++ M+ Y+ P  P + +  +    D E   +  
Sbjct: 265 VNPLNRITIHE---------IMQDEWFKVDMQDYLIP--PDLKNEAENHGHDGEQQGQND 313

Query: 665 IDSVVDEYLSESVQKQFG 682
            +  VD+ L   + K  G
Sbjct: 314 AEEEVDDSLVTMLSKTMG 331

>CAGL0K08514g complement(853314..857783) similar to sp|P34244
           Saccharomyces cerevisiae YKL101w
           serine/threonine-protein kinase, hypothetical start
          Length = 1489

 Score =  136 bits (342), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 70/212 (33%), Positives = 122/212 (57%), Gaps = 6/212 (2%)

Query: 418 ERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAEL 477
           E  ++  I  P ++ L   ++++ +LYLVL  ++GGELF +L  +G+     +  Y  ++
Sbjct: 176 EIVIMKLISHPNVMGLLEVWENKSELYLVLEYVDGGELFDYLVSKGKLSEPEAVHYFTQI 235

Query: 478 LCALDTLHKMDVIYRDLKPENILLDYQGH-IALCDFGLCKLNMKDEDKTDTFCGTPEYLA 536
           +  +   H  ++ +RDLKPEN+LLD +   I + DFG+  L + ++   +T CG+P Y +
Sbjct: 236 IQGVSYCHSFNICHRDLKPENLLLDKKNKVIKIADFGMAALELPNK-LLETSCGSPHYAS 294

Query: 537 PELLLGQGY-SKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDA 595
           PE+++G+ Y     D W+ G++L+ +LTG  P+ D+N+ K+  K+       P     DA
Sbjct: 295 PEIVMGKPYHGGPSDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGRFQLPPYLTNDA 354

Query: 596 KDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQ 627
           KDL+  +L  +P++RL  N   EI NHP   +
Sbjct: 355 KDLITRILVTNPEKRLTIN---EILNHPLIKK 383

>Kwal_0.96
          Length = 427

 Score =  131 bits (329), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 80/259 (30%), Positives = 138/259 (53%), Gaps = 10/259 (3%)

Query: 362 NKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKS-EVTHTLAERT 420
           N  ++  D+   K +G GSFG V Q R+  + +  A+K + K  +  K  E+     E +
Sbjct: 38  NSYVNKSDYIFGKTLGAGSFGVVRQARQVSSGENVAIKILLKKALKGKDVELQMLYDELS 97

Query: 421 VLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCA 480
           +L ++D P IV  K  F+S++K Y+V     GGELF  + ++G+F    +     ++L A
Sbjct: 98  ILQKLDHPNIVKFKDWFESKDKFYIVTQLATGGELFDRILKQGKFTEEDAVRIVYQILKA 157

Query: 481 LDTLHKMDVIYRDLKPENILLDYQG---HIALCDFGLCKLNMKDEDKTDTFCGTPEYLAP 537
           ++ LH  ++++RDLKPEN+L   +     + L DFG+ K    D++      G+  Y+AP
Sbjct: 158 VEYLHSRNIVHRDLKPENLLYLTEAADSQLVLGDFGIAKELKNDDELIHKAAGSMGYVAP 217

Query: 538 ELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKK--ILQDPLVFPDGF---- 591
           E++   G+ K  D W+LGV+ Y +L G  P+  E+V    ++  I + P+ F   +    
Sbjct: 218 EVVTTSGHGKPCDIWSLGVVTYTLLCGYSPFVAESVEGFLEECTIGRTPVTFHKPYWSNI 277

Query: 592 DRDAKDLLIGLLSRDPQRR 610
             +AKD ++  L+ +P  R
Sbjct: 278 SNEAKDFILRALTVNPHDR 296

>KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235.1
           Kluyveromyces lactis putative kinase, start by
           similarity
          Length = 602

 Score =  133 bits (335), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 79/247 (31%), Positives = 139/247 (56%), Gaps = 5/247 (2%)

Query: 367 IDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLA-ERTVLARI 425
           I  + ++K +G+GSFGKV       T +  ALK I K  +++KS++   +  E + L  +
Sbjct: 32  IGKYQIIKTLGEGSFGKVKLAYHISTGQKVALKIINKK-VLAKSDMQGRIEREISYLRLL 90

Query: 426 DCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLH 485
             P I+ L    +S++++ +V+    G ELF ++ +  +     +R +  +++ A+D  H
Sbjct: 91  RHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMPEQEARRFFQQIISAVDYCH 149

Query: 486 KMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGY 545
           +  +++RDLKPEN+LLD   ++ + DFGL  + M D +   T CG+P Y APE++ G+ Y
Sbjct: 150 RHKIVHRDLKPENLLLDEHLNVKIADFGLSNI-MTDGNFLKTSCGSPNYAAPEVISGKLY 208

Query: 546 SK-VVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLLIGLLS 604
           +   VD W+ GV+LY ML    P+ DE++P ++K I       P+   + A  L+  +L 
Sbjct: 209 AGPEVDVWSSGVILYVMLCRRLPFDDESIPVLFKNISNGVYTIPNFLSQGAASLIKKMLI 268

Query: 605 RDPQRRL 611
            +P  R+
Sbjct: 269 VNPVNRI 275

>KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication, start by similarity
          Length = 708

 Score =  134 bits (336), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 78/246 (31%), Positives = 128/246 (52%), Gaps = 5/246 (2%)

Query: 369 DFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCP 428
           D+     +G+G F +  Q+ K D  K++A K + K  I S+      L+E  +   +  P
Sbjct: 89  DYHRGHFLGEGGFARCFQM-KDDKGKVFAAKTVAKLSIKSEKTRRKLLSEIQIHKSMKHP 147

Query: 429 FIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMD 488
            IV     F+    +Y++L     G +   L++         RF   +++ A+  +H   
Sbjct: 148 NIVQFTDCFEDDTNVYILLEICPNGSVMELLRQRKHLTEPEVRFCMIQIIGAIRYMHSRR 207

Query: 489 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQ--GYS 546
           VI+RDLK  NI  D + ++ + DFGL  +   D+++  T CGTP Y+APE+L G+  G+S
Sbjct: 208 VIHRDLKLGNIFFDKEYNLKIGDFGLAAVLANDKERKYTICGTPNYIAPEVLTGKHTGHS 267

Query: 547 KVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDG--FDRDAKDLLIGLLS 604
             VD W++GV+LY +L G PP+  + V  +Y++I     +FP       DAK+L+  LL 
Sbjct: 268 YEVDIWSIGVMLYALLFGKPPFQAKEVETIYERIKCRDFIFPADKPVSSDAKNLISHLLQ 327

Query: 605 RDPQRR 610
            +P  R
Sbjct: 328 LNPAAR 333

>CAGL0M08910g complement(887703..889541) highly similar to sp|Q00372
           Saccharomyces cerevisiae YDR477w carbon catabolite
           derepressing ser/thr protein kinase, hypothetical start
          Length = 612

 Score =  132 bits (333), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 78/248 (31%), Positives = 139/248 (56%), Gaps = 5/248 (2%)

Query: 367 IDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLA-ERTVLARI 425
           + ++ ++K +G+GSFGKV       T +  ALK I K  +++KS++   +  E + L  +
Sbjct: 36  VGNYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKK-VLAKSDMQGRIEREISYLRLL 94

Query: 426 DCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLH 485
             P I+ L    +S++++ +V+    G ELF ++ +  +     +R +  +++ A++  H
Sbjct: 95  RHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRNKMSEQEARRFFQQIISAVEYCH 153

Query: 486 KMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGY 545
           +  +++RDLKPEN+LLD   ++ + DFGL  + M D +   T CG+P Y APE++ G+ Y
Sbjct: 154 RHKIVHRDLKPENLLLDEHLNVKIADFGLSNI-MTDGNFLKTSCGSPNYAAPEVISGKLY 212

Query: 546 SK-VVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLLIGLLS 604
           +   VD W+ GV+LY ML    P+ DE++P ++K I       P      A DL+  +L 
Sbjct: 213 AGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGASDLIKRMLI 272

Query: 605 RDPQRRLG 612
            +P  R+ 
Sbjct: 273 VNPLNRIS 280

>Scas_660.28
          Length = 623

 Score =  132 bits (333), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 78/247 (31%), Positives = 139/247 (56%), Gaps = 5/247 (2%)

Query: 367 IDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLA-ERTVLARI 425
           I ++ ++K +G+GSFGKV       T +  ALK I K  +++KS++   +  E + L  +
Sbjct: 43  IGNYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKK-VLAKSDMQGRIEREISYLRLL 101

Query: 426 DCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLH 485
             P I+ L    +S++++ +V+    G ELF ++ +  +     +R +  +++ A++  H
Sbjct: 102 RHPHIIKLYDVIKSKDEIIMVMEYA-GNELFDYIVQRDKMSEDEARRFFQQIISAVEYCH 160

Query: 486 KMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGY 545
           +  +++RDLKPEN+LLD   ++ + DFGL  + M D +   T CG+P Y APE++ G+ Y
Sbjct: 161 RHKIVHRDLKPENLLLDEHLNVKIADFGLSNI-MTDGNFLKTSCGSPNYAAPEVISGKLY 219

Query: 546 SK-VVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLLIGLLS 604
           +   VD W+ GV+LY ML    P+ DE++P ++K I       P    + A  L+  +L 
Sbjct: 220 AGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNINNGVYTIPKFLSQGASTLIKKMLI 279

Query: 605 RDPQRRL 611
            +P  R+
Sbjct: 280 VNPLNRI 286

>ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH]
           complement(344395..346521) [2127 bp, 708 aa]
          Length = 708

 Score =  133 bits (334), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 77/246 (31%), Positives = 128/246 (52%), Gaps = 5/246 (2%)

Query: 369 DFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCP 428
           D+     +G+G F +  Q+ K D+ K++A K + K  I S+      L+E  +   +  P
Sbjct: 72  DYHRGMFLGEGGFARCFQM-KDDSGKVFAAKTVAKISIKSEKTRKKLLSEIQIHKSMKHP 130

Query: 429 FIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMD 488
            IV     F+    +Y++L     G L   L++  +      RF+  +++ A+  +H   
Sbjct: 131 NIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPEVRFFTTQIVGAIKYMHSRR 190

Query: 489 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQ--GYS 546
           +I+RDLK  NI  D   ++ + DFGL  +   D ++  T CGTP Y+APE+L G+  G+S
Sbjct: 191 IIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIAPEVLTGKHTGHS 250

Query: 547 KVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDG--FDRDAKDLLIGLLS 604
             VD W++GV++Y +L G PP+  + V  +Y++I      FP       +AK L+  +LS
Sbjct: 251 FEVDIWSIGVMIYALLIGKPPFQAKEVNTIYERIKVCDFSFPKDKPISSEAKVLIKDILS 310

Query: 605 RDPQRR 610
            DP  R
Sbjct: 311 LDPLER 316

>AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH]
           complement(198401..200227) [1827 bp, 608 aa]
          Length = 608

 Score =  131 bits (330), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 84/278 (30%), Positives = 151/278 (54%), Gaps = 7/278 (2%)

Query: 338 NHHWVELRDGLGKINISVDYKPSRNKPLS--IDDFDLLKVIGKGSFGKVMQVRKKDTKKI 395
           NHH  + +   G  N+        + P+   I  + ++K +G+GSFGKV       T + 
Sbjct: 5   NHHHQQQKMYTGGRNMPHGMHRPGSIPIGQRIGKYQVIKTLGEGSFGKVKLAHHVSTGQK 64

Query: 396 YALKAIRKSYIVSKSEVTHTLA-ERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGE 454
            ALK I K  +++KS++   +  E + L  +  P I+ L    +S++++ +V+    G E
Sbjct: 65  VALKIINKK-VLAKSDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNE 122

Query: 455 LFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGL 514
           LF ++ +  +   + +R +  +++ A++  H+  +++RDLKPEN+LLD   ++ + DFGL
Sbjct: 123 LFDYIVQRDKMSENEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGL 182

Query: 515 CKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSK-VVDWWTLGVLLYEMLTGLPPYYDENV 573
             + M D +   T CG+P Y APE++ G+ Y+   VD W+ GV+LY ML    P+ DE++
Sbjct: 183 SNI-MTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDESI 241

Query: 574 PKMYKKILQDPLVFPDGFDRDAKDLLIGLLSRDPQRRL 611
           P ++K I       P    + A +L+  +L  +P  R+
Sbjct: 242 PVLFKNISNGVYSIPKFLSQGAANLIKRMLIVNPLNRI 279

>YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine
           protein kinase essential for derepression of
           glucose-repressed genes, acts in concert with Snf4p,
           involved in aging [1902 bp, 633 aa]
          Length = 633

 Score =  131 bits (330), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 78/248 (31%), Positives = 138/248 (55%), Gaps = 5/248 (2%)

Query: 367 IDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLA-ERTVLARI 425
           I ++ ++K +G+GSFGKV       T +  ALK I K  +++KS++   +  E + L  +
Sbjct: 52  IGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKK-VLAKSDMQGRIEREISYLRLL 110

Query: 426 DCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLH 485
             P I+ L    +S++++ +V+    G ELF ++ +  +     +R +  +++ A++  H
Sbjct: 111 RHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEARRFFQQIISAVEYCH 169

Query: 486 KMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGY 545
           +  +++RDLKPEN+LLD   ++ + DFGL  + M D +   T CG+P Y APE++ G+ Y
Sbjct: 170 RHKIVHRDLKPENLLLDEHLNVKIADFGLSNI-MTDGNFLKTSCGSPNYAAPEVISGKLY 228

Query: 546 SK-VVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLLIGLLS 604
           +   VD W+ GV+LY ML    P+ DE++P ++K I       P      A  L+  +L 
Sbjct: 229 AGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGAAGLIKRMLI 288

Query: 605 RDPQRRLG 612
            +P  R+ 
Sbjct: 289 VNPLNRIS 296

>CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces
           cerevisiae YHR102w NRK1 ser/thr protein kinase, start by
           similarity
          Length = 1072

 Score =  131 bits (329), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 97/309 (31%), Positives = 145/309 (46%), Gaps = 21/309 (6%)

Query: 370 FDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARI-DCP 428
           F   +VIG+G FG V +     TK++YA+K +  +   S+ EV     E   LA +   P
Sbjct: 16  FKRTEVIGRGKFGIVYKGYHVKTKQVYAIKVL--NLDSSEDEVEDVQREIQFLASLKQIP 73

Query: 429 FIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMD 488
            I     S+     L++++    GG L   L R G+ D         ELL AL  +HK +
Sbjct: 74  NITRYYGSYLRGTSLWIIMEYCAGGSL-RSLLRPGKIDEKYIGVIMRELLVALKVIHKDN 132

Query: 489 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLL-GQGYSK 547
           VI+RD+K  N+L+  +G + LCDFG+     +   +  T  GTP ++APE+++ G  Y  
Sbjct: 133 VIHRDIKAANVLITNEGQVKLCDFGVAAQLNQTSLRRQTMAGTPYWMAPEVIMEGVYYDT 192

Query: 548 VVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQD--PLVFPDGFDRDAKDLLIGLLSR 605
            VD W+LG+  YE+ TG PPY D    +  + I++   P +    +    K+ +   L  
Sbjct: 193 KVDIWSLGITAYEIATGNPPYCDVEALRAMQLIIKSKPPRLEERNYTPQLKEFIALCLDE 252

Query: 606 DPQRRLGYNGADE------IKNH-----PFFSQLSWKRLLMKGYIPPYKPPVTSATDTSN 654
           DPQ RL    A+E      IK H         +L  + LL +     YK     A D  N
Sbjct: 253 DPQERL---SAEELLKTKFIKTHKATPTTILKELISRYLLFRDKNKSYKDSAYLADDIPN 309

Query: 655 FDQEFTREK 663
              E T E+
Sbjct: 310 AKAELTNEE 318

>Scas_564.7
          Length = 1210

 Score =  131 bits (329), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 99/337 (29%), Positives = 158/337 (46%), Gaps = 48/337 (14%)

Query: 366 SIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIR---KSYIVSKSEVTHTLAERTVL 422
           S+ D+D L+ +G GS GKV   R   TK+I A+K +    K+++  +  +     E+ VL
Sbjct: 158 SLGDWDFLETVGAGSMGKVKLARHHQTKEICAIKIVNRAMKAFLHKEQSMPPPRTEQEVL 217

Query: 423 AR-----------------------IDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHL 459
            R                       +  P I  L          Y++   ++GG+L  ++
Sbjct: 218 ERQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 277

Query: 460 QREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNM 519
            + G      +R +A  +  AL+ +H  ++++RDLK ENI++   G I + DFGL   N+
Sbjct: 278 IQHGSLREHHARKFARGIASALEYIHANNIVHRDLKIENIMISTSGEIKIIDFGLS--NV 335

Query: 520 KDEDKT-DTFCGTPEYLAPELLLGQGYS-KVVDWWTLGVLLYEMLTGLPPYYDENVPKMY 577
            D  K   TFCG+  + APELL    Y+   VD W+ GV+LY ++ G  P+ DEN   ++
Sbjct: 336 FDRKKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSVLH 395

Query: 578 KKILQDPLVFPDGFDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQLSWKRLLMKG 637
           +KI Q  + +P+    +   LL  +L  DP RR       ++  HP      W   + +G
Sbjct: 396 EKIKQGKVDYPNHLSIEVISLLSKMLVVDPLRRASL---KQVVEHP------W---MTRG 443

Query: 638 Y---IPPYKP---PVTSATDTSNFDQEFTREKPIDSV 668
           Y    P Y P   P+T     +N  +E  R + ID V
Sbjct: 444 YDYPPPSYVPRRIPMTPEIIDNNVIREMFRLEFIDGV 480

>CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4 ser/thr protein kinase or
           tr|Q03002 Saccharomyces cerevisiae YPL141c, start by
           similarity
          Length = 661

 Score =  129 bits (325), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 87/287 (30%), Positives = 148/287 (51%), Gaps = 28/287 (9%)

Query: 375 VIGKGSFGKVM-----------QVRKKDTKKIYALKAIRKSYIVSKSEVTHTL-AERTVL 422
            +G+G FGKV            + R   +K++ A+K IR+  IV  SE    +  E   L
Sbjct: 49  TLGEGEFGKVKLGWTRTPSTGPEQRPAVSKQV-AIKLIRRDTIVKNSEKEIKIYREINAL 107

Query: 423 ARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALD 482
             +  P +V L+   Q+ + + +VL   +GGE + ++QR+ R   S +    A+L+  + 
Sbjct: 108 KHLTHPNVVRLEEVLQNSKYIGIVLEYASGGEFYKYIQRKRRLKESTACRLFAQLISGVT 167

Query: 483 TLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLG 542
            +H  ++++RDLK EN+LLD   ++ + DFG     + D +   T CG+P Y APEL++ 
Sbjct: 168 YMHSKNLVHRDLKLENLLLDKNENLVITDFGFVNEFLPDNEYMKTSCGSPCYAAPELVIS 227

Query: 543 QG--YSKVVDWWTLGVLLYEMLTGLPPYYD-------ENVPKMYKKILQDPLVFPDGFDR 593
                ++  D W+ G++LY ML G  P+ D       +++ K+Y+ I + PL FP+    
Sbjct: 228 TRPYVARKADVWSCGIILYAMLAGYLPWDDDSTNPEGDDIGKLYQYITRTPLKFPEYITP 287

Query: 594 DAKDLLIGLLSRDPQRRLGY---NGADEIKNH-PFF--SQLSWKRLL 634
             +DLL  +L  DP +R+     +  + +K H PF   S   W +L+
Sbjct: 288 IPRDLLRKILVPDPNKRVNMQYIHRHEWLKPHRPFLAVSTSQWDKLI 334

>AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W
           (KCC4) - SH] (1721689..1725117) [3429 bp, 1142 aa]
          Length = 1142

 Score =  130 bits (327), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 84/277 (30%), Positives = 148/277 (53%), Gaps = 20/277 (7%)

Query: 367 IDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKS---------EVTHTLA 417
           I  + L + +G GS GKV+  +  +T +I A+K I KS   ++          +V     
Sbjct: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGI 75

Query: 418 ERTV--LARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAA 475
           ER +  +  ++ P ++ L   +++ + LY+VL  +  GELF  L + G    + +  +  
Sbjct: 76  EREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFR 135

Query: 476 ELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYL 535
           +++  +   H + +++RDLKPEN+LLD++ +I L DFG+  L  KD+   +T CG+P Y 
Sbjct: 136 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDK-LLETSCGSPHYA 194

Query: 536 APELLLGQGYSKV-VDWWTLGVLLYEMLTGLPPYYDE--NVPKMYKKILQDPLVFP--DG 590
           APE++ G  Y     D W+ GV+LY +LTG  P+ +E  N+  +  K+       P  D 
Sbjct: 195 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDE 254

Query: 591 FDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQ 627
              +A+DL++ +L+ +P++R+      EI  HP   +
Sbjct: 255 ISPEARDLIVQILTVEPEQRIKTR---EILKHPLLQK 288

>Scas_693.17
          Length = 1049

 Score =  130 bits (327), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 84/289 (29%), Positives = 139/289 (48%), Gaps = 36/289 (12%)

Query: 366 SIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIR--------KSYIVSKSEVTHTLA 417
           S+ D+D ++ +G GS GKV   + + T ++ A+K +         K Y    +  T  L+
Sbjct: 67  SLGDWDFVETVGAGSMGKVKLAKNRRTNEVCAIKIVNRATKIFLSKEYAAKHNGYTIPLS 126

Query: 418 ERTVLAR-----------------------IDCPFIVPLKFSFQSQEKLYLVLACINGGE 454
           E+ V+ R                       +  P I  L          Y++   ++GG+
Sbjct: 127 EKEVIERQKNLEKEASRDKRTVREASLGQILYHPHICRLYEMHTLSNHFYMLFEYVSGGQ 186

Query: 455 LFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGL 514
           L  ++ + G    SR+R +  ++  AL  LH  ++++RDLK ENI++   G+I L DFGL
Sbjct: 187 LLDYIIQHGSLKESRARTFTRQICSALKYLHSHNIVHRDLKIENIMISKDGNIKLIDFGL 246

Query: 515 CKLNMKDEDKTDTFCGTPEYLAPELLLGQGY-SKVVDWWTLGVLLYEMLTGLPPYYDENV 573
             L  K  +K  T+CG+  + APELL    Y    +D W+ GV+LY ++ G  P+ DEN 
Sbjct: 247 SNLYDKC-NKLKTYCGSLYFAAPELLKATPYIGPEIDVWSFGVVLYVLVCGKVPFDDENS 305

Query: 574 PKMYKKILQDPLVFPDGFDRDAKDLLIGLLSRDPQRRLGYNGADEIKNH 622
             +++KI Q  + +P     +   LL  +L  DP +R      D++ NH
Sbjct: 306 NVLHEKIKQGKVFYPQFLSIEVISLLSKMLVVDPFKRATL---DQVMNH 351

>Kwal_56.22476
          Length = 697

 Score =  129 bits (323), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 87/269 (32%), Positives = 136/269 (50%), Gaps = 8/269 (2%)

Query: 369 DFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCP 428
           D+     +G+G F +  Q+ K D  KI+A K + K  I S+      L+E  +   +   
Sbjct: 78  DYHRGHFLGEGGFARCFQI-KDDGGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMRHT 136

Query: 429 FIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMD 488
            IV     F+    +Y++L     G L   L+R         RF+  +++ A+  +H   
Sbjct: 137 NIVQFVDCFEDDTNVYILLEICPNGSLMDLLKRRKMLTEPEVRFFTTQIVGAVKYMHSRR 196

Query: 489 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQ--GYS 546
           VI+RDLK  NI  D   ++ + DFGL  +   D ++  T CGTP Y+APE+L G+  G+S
Sbjct: 197 VIHRDLKLGNIFFDKHYNLKVGDFGLAAVLANDRERKYTVCGTPNYIAPEVLTGKHTGHS 256

Query: 547 KVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFP-DGF-DRDAKDLLIGLLS 604
             VD W+ GV++Y +L G PP+  + V  +Y++I     VFP D F   +A  L+  +LS
Sbjct: 257 YEVDIWSCGVMIYALLIGKPPFQAKEVNIIYERIKCGDFVFPKDKFISPEALVLIKDILS 316

Query: 605 RDPQRRLGYNGADEIKNHPFFSQLSWKRL 633
            DP  R      DEI ++ +F  L   R+
Sbjct: 317 IDPLER---PSLDEIIDYVWFRGLFPSRI 342

>KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, start by similarity
          Length = 427

 Score =  125 bits (315), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 78/252 (30%), Positives = 132/252 (52%), Gaps = 10/252 (3%)

Query: 369 DFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLA-ERTVLARIDC 427
           D+   K +G G+FG V Q R   + +  A+K + K  +  +S     L  E ++L +++ 
Sbjct: 45  DYIFGKTLGAGTFGVVRQARCISSGENVAVKILLKKALKGQSVQLQMLYDELSILQQLNH 104

Query: 428 PFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKM 487
           P IV  K  F+S+EK Y+V     GGELF  +  +G+F    + F   ++L  +  LH+ 
Sbjct: 105 PNIVRFKDWFESKEKFYIVTQLATGGELFDRILEKGKFCEVDAVFIVKQILQGVQYLHQR 164

Query: 488 DVIYRDLKPENILLDYQGH---IALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQG 544
           ++++RDLKPENIL   +     + + DFG+ K    D +      G+  Y+APE+L   G
Sbjct: 165 NIVHRDLKPENILYLNKSDDSPLVIGDFGIAKELKDDNELIHKAAGSMGYVAPEVLTSSG 224

Query: 545 YSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKIL--QDPLVFP----DGFDRDAKDL 598
           + K  D W++GV+ Y +L G  P+  E+     ++    Q P+VF     +   + AK+ 
Sbjct: 225 HGKPCDIWSIGVITYTLLCGYSPFLAESADGFIEECTSGQYPVVFHKPYWNNVSKTAKEF 284

Query: 599 LIGLLSRDPQRR 610
           ++  L+  P+RR
Sbjct: 285 ILWALTVSPKRR 296

>ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023)
           [2556 bp, 851 aa]
          Length = 851

 Score =  129 bits (324), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 83/261 (31%), Positives = 137/261 (52%), Gaps = 13/261 (4%)

Query: 367 IDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARID 426
           + ++ ++K +G+GSFGKV     K T +   LK   KS      EV +         + +
Sbjct: 34  VGNYRIVKQVGEGSFGKVYLATHKLTHQKVVLKTGAKSDPNVVREVFYH-------RQFE 86

Query: 427 CPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHK 486
            PFI  L     ++ ++++ L    G EL+ +L  + R  L  +R   A+++ A+   H 
Sbjct: 87  YPFITKLYEVIVTETRVWMALEYCPGNELYDYLLLKQRIPLDETRRLFAQIVSAVFYAHS 146

Query: 487 MDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYS 546
           +  ++RDLK ENILLD  G+  L DFG  +     + + +T CGT  Y+APEL+  + Y 
Sbjct: 147 LQCVHRDLKLENILLDKNGYAMLTDFGFTR-ECATKTQLETVCGTTVYMAPELIKREAYD 205

Query: 547 KV-VDWWTLGVLLYEMLTGLPPYYDENVPKMYKKIL-QDPLVFPDGFDRDAKDLLIGLLS 604
              VD W+LG++LY ML G  P+ +++  +   KI+ ++P V  +     AKDL++ LL 
Sbjct: 206 GYKVDTWSLGIILYTMLHGYMPFDEDDTVRTGLKIMHEEPAVLDEYTSPQAKDLIVRLLD 265

Query: 605 RDPQRRLGYNGADEIKNHPFF 625
           ++  +R   N   E+  HPF 
Sbjct: 266 KNAAQRPNLN---EVLQHPFL 283

>Scas_618.8
          Length = 427

 Score =  125 bits (315), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 77/252 (30%), Positives = 131/252 (51%), Gaps = 10/252 (3%)

Query: 369 DFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAI-RKSYIVSKSEVTHTLAERTVLARIDC 427
           D++  K +G GSFG V +  KK   +  A+K + +K+   ++ ++     E T+L ++  
Sbjct: 26  DYEFGKTLGAGSFGVVREATKKSNNEEVAIKILLKKALEGNQVQLQMLYDELTILKKLHH 85

Query: 428 PFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKM 487
           P IV  K  F++ +K+Y+V     GGELF  + ++GRF    +     ++L A++ +H  
Sbjct: 86  PNIVEFKNWFETDDKIYIVTQLATGGELFDRIIKKGRFSEDDAVKILIQILSAVEYIHSR 145

Query: 488 DVIYRDLKPENILL---DYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQG 544
           D+++RDLKPEN+L         + + DFG+ K   K E       G+  Y+APE+L   G
Sbjct: 146 DIVHRDLKPENLLYLTEKEDSELVIADFGIAKELKKGEQLIFKAAGSLGYVAPEVLTVDG 205

Query: 545 YSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQD--PLVFP----DGFDRDAKDL 598
           + K  D W++GV+ Y +L+G   +  E V     +      P+ F     D    DAK+ 
Sbjct: 206 HGKPCDIWSIGVITYTLLSGYAAFVAETVEGFLDECTSGDYPVKFHKPYWDNISDDAKNF 265

Query: 599 LIGLLSRDPQRR 610
           ++  L  +PQ+R
Sbjct: 266 ILKALDLNPQKR 277

>Scas_613.5
          Length = 517

 Score =  127 bits (319), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 97/299 (32%), Positives = 143/299 (47%), Gaps = 34/299 (11%)

Query: 358 KPSRNKPLSI-DDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTL 416
           K  R K LS  D + L K +G G +  V +   K T +  A+K         + +     
Sbjct: 191 KIVRTKQLSFFDKYVLGKDLGSGHYATVKEGINKVTGQTVAVKIFHPQQNDDEKKSKQFR 250

Query: 417 AERTVLARIDCPFIVPLKFSF-----QSQEKLYLVLACINGGELFYHLQREGRFDLSRSR 471
            E  +L RI  P IV L   F     +SQ + YLVL  I+ GELF  + ++       ++
Sbjct: 251 EETNILMRIHHPNIVNLLDFFIEPVSKSQIQKYLVLDKIDDGELFERIVKKTCLRQDETK 310

Query: 472 FYAAELLCALDTLHKMDVIYRDLKPENILLDYQG-------------------HIALCDF 512
               ++L  L  LH+ ++I+RD+KPENILL+                       + + DF
Sbjct: 311 AIFNQILMGLKHLHQQNIIHRDIKPENILLNITRRTNPEQKQLGPWDEDEIDIQVKIADF 370

Query: 513 GLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDE- 571
           GL K    +   T+T CGTP Y+APE+L  +GY+  VD W+ GV+LY  L G PP+ ++ 
Sbjct: 371 GLAKFT-GEMQFTNTLCGTPSYVAPEVLTKKGYTSKVDMWSAGVILYVCLCGFPPFSEQL 429

Query: 572 NVPKMYKKILQDPLVFP----DGFDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFS 626
             P + ++ILQ    F     D  D +   L+  LL  D   R  Y+  D I NHP+F+
Sbjct: 430 GPPSLKEQILQAKFAFYTPYWDNIDDNVLHLISHLLVLDADAR--YSVEDTI-NHPWFN 485

>CAGL0K05709g complement(555903..559214) similar to sp|Q12263
           Saccharomyces cerevisiae YDR507c GIN4, start by
           similarity
          Length = 1103

 Score =  129 bits (325), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 89/280 (31%), Positives = 146/280 (52%), Gaps = 26/280 (9%)

Query: 367 IDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIV------SKSEVTHTL---- 416
           I  + L + +G GS GKV+    + TK+  A+K I K+         S  + T+ L    
Sbjct: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNI 76

Query: 417 -AERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAA 475
             E  ++  ++ P ++ L   +++   LYLVL     GELF  L   G    + +     
Sbjct: 77  EQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFR 136

Query: 476 ELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDK-TDTFCGTPEY 534
           +++  +   H + V++RDLKPEN+LLD + +I + DFG+  L  + EDK  +T CG+P Y
Sbjct: 137 QIIIGISYCHSLGVVHRDLKPENLLLDNKLNIKIADFGMAAL--ESEDKLLETSCGSPHY 194

Query: 535 LAPELLLG---QGYSKVVDWWTLGVLLYEMLTGLPPYYDE--NVPKMYKKILQDPLVFPD 589
            APE++ G   +G+S   D W+ GV+L+ +LTG  P+ +E  N+  +  K+ +     PD
Sbjct: 195 AAPEIISGLPYEGFSS--DVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPD 252

Query: 590 G--FDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQ 627
                ++A+DLL  LL+ DP +R+      EI  HP   +
Sbjct: 253 DDEITKEAQDLLARLLTVDPSKRITIR---EILKHPLLQK 289

>Kwal_26.8709
          Length = 829

 Score =  129 bits (323), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 85/274 (31%), Positives = 142/274 (51%), Gaps = 16/274 (5%)

Query: 354 SVDYKPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKK------DTKKIYALKAIRKSYIV 407
           S  Y   + K ++   + +   +G+G FGKV     K      D  K  A+K IR+  I 
Sbjct: 24  STSYSTQKRKHVTFGPYIVGSTLGEGEFGKVKLGWSKTSNSSMDVPKQVAIKLIRRDTIP 83

Query: 408 SKSEVTHTL-AERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFD 466
             SE    +  E   L  ++ P IV L+   Q+ + + +VL   +GGE + ++Q++ R  
Sbjct: 84  KNSEKEIKIYREINALKHLNHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLK 143

Query: 467 LSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTD 526
              +    A+L+  +  +H   +++RDLK EN+LLD   ++ + DFG     + + +   
Sbjct: 144 EGPACRLFAQLISGVYYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFLPENELMK 203

Query: 527 TFCGTPEYLAPELLL-GQGY-SKVVDWWTLGVLLYEMLTGLPPYYD-------ENVPKMY 577
           T CG+P Y APEL++  + Y ++  D W+ GV+LY ML G  P+ D       +++ K+Y
Sbjct: 204 TSCGSPCYAAPELVVTARPYEARKADVWSCGVILYAMLAGYLPWDDDPENPDGDDIGKLY 263

Query: 578 KKILQDPLVFPDGFDRDAKDLLIGLLSRDPQRRL 611
           + I + PL FPD      +DLL  +L  DP+RR+
Sbjct: 264 RYITRTPLKFPDYIAPVPRDLLREILIPDPKRRI 297

>Kwal_26.8796
          Length = 796

 Score =  128 bits (321), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 85/269 (31%), Positives = 140/269 (52%), Gaps = 26/269 (9%)

Query: 374 KVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLA-ERTVLARIDCPFIVP 432
           +V+G+G+F  V +  ++ T K +A+K I K  +V    V   +A E  VL R+D P IV 
Sbjct: 192 EVVGQGAFATVKKAIERKTGKTHAVKIISKRKVVG---VMDGVARELEVLQRLDHPRIVS 248

Query: 433 LKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYR 492
           LK  ++ ++  YLV+  ++GG+L   +   G       R    ++L A+  +H M + +R
Sbjct: 249 LKGFYEDKDSHYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVKYIHSMGISHR 308

Query: 493 DLKPENILLDYQGH--IALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQG------ 544
           DLKP+NIL++      + + DFGL K+   +     TFCGT  Y+APE++ G+       
Sbjct: 309 DLKPDNILIERDDPVLVKITDFGLAKIQ-GNGTFMKTFCGTLAYVAPEVISGKNSGEKEG 367

Query: 545 --YSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDG------FDRDAK 596
             YS +VD W++G L+Y +LTG  P+       +YK+I      + +G         DA+
Sbjct: 368 NTYSSLVDMWSIGCLVYVILTGHLPFSGSTQNDLYKQITAGS--YHEGPLKDYRISDDAR 425

Query: 597 DLLIGLLSRDPQRRLGYNGADEIKNHPFF 625
           D +   L  DP+ R+    A++   HP+ 
Sbjct: 426 DFIESFLQVDPRNRM---TAEQALRHPWI 451

>CAGL0M02233g complement(267332..269635) highly similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, hypothetical start
          Length = 767

 Score =  127 bits (320), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 91/318 (28%), Positives = 155/318 (48%), Gaps = 43/318 (13%)

Query: 343 ELRDGLGKINISVDYKPSRN---------KPLSIDDFDLLKVIGKGSFGKVMQVRKKDTK 393
           E+R  L    + V  K + N         K  SI+D    +V+G G+F  V +  +++T 
Sbjct: 156 EVRQELSSQGLKVSSKSNANPNINLTGIYKDFSIND----EVVGTGAFATVKKAVERNTG 211

Query: 394 KIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGG 453
           K +A+K I K  +V   +      E  VL +++ P IV LK  ++ +   Y+V+  I+GG
Sbjct: 212 KTFAVKIINKRKVVGNMDGVSR--ELEVLQKLNHPRIVSLKAFYEDEANYYMVMEFISGG 269

Query: 454 ELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQG--HIALCD 511
           +L   +   G       R  + ++L A+  +H   + +RDLKP+NIL++      + + D
Sbjct: 270 DLMDFVAAHGAVGEEAGREISRQILEAIQYIHSKGISHRDLKPDNILIEQDDPVLVKITD 329

Query: 512 FGLCKLNMKDEDKTDTFCGTPEYLAPELLLG--------------QGYSKVVDWWTLGVL 557
           FGL K+   +     TFCGT  Y+APE++ G                YS +VD W++G L
Sbjct: 330 FGLAKV-QGNGSIMKTFCGTLAYVAPEVIGGFTGATGEEETEEERIEYSSLVDMWSMGCL 388

Query: 558 LYEMLTGLPPYYDENVPKMYKKILQDPLVFPDG------FDRDAKDLLIGLLSRDPQRRL 611
           ++ +LTG  P+      ++Y++I +    + +G         +A+D + GLL  D  +R+
Sbjct: 389 VFVILTGHLPFSGSTQEQLYEQIRKGS--YHEGPLKDFRISDEARDFIDGLLQVDQSKRM 446

Query: 612 GYNGADEIKNHPFFSQLS 629
                D+  NHP+  Q S
Sbjct: 447 ---TVDDALNHPWIKQCS 461

>Scas_644.15
          Length = 726

 Score =  126 bits (316), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 73/246 (29%), Positives = 127/246 (51%), Gaps = 5/246 (2%)

Query: 369 DFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCP 428
           D+     +G+G F +  Q+ K ++ KI+A K + K  I ++      L+E  +   +  P
Sbjct: 91  DYRRGHFLGEGGFARCFQI-KDESGKIFAAKTVAKISIKTEKTKKKLLSEIQIHKSMKHP 149

Query: 429 FIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMD 488
            IV     F+    +Y++L   + G L   +++         RF+  ++  A+  +H   
Sbjct: 150 NIVHFVDCFEDDTNVYILLEICSNGSLMDLMKKRKTLTEPEVRFFTTQICGAVKYMHSRR 209

Query: 489 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQ--GYS 546
           VI+RDLK  NI  D   ++ + DFGL  +   + ++  T CGTP Y+APE+L+G+  G+S
Sbjct: 210 VIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANNRERKYTVCGTPNYIAPEVLMGKHAGHS 269

Query: 547 KVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDG--FDRDAKDLLIGLLS 604
             VD W++GV++Y +L G PP+  ++V  +Y +I      +P       +AK L+  +L 
Sbjct: 270 FEVDIWSIGVMIYALLVGKPPFQAKDVNVIYDRIKACQYGYPKDKYVSSEAKTLIADILC 329

Query: 605 RDPQRR 610
            DP  R
Sbjct: 330 VDPVER 335

>Scas_700.34
          Length = 864

 Score =  125 bits (315), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 98/333 (29%), Positives = 159/333 (47%), Gaps = 35/333 (10%)

Query: 349 GKINISVDYKPSRNKPL------SIDDFDLLKVIGKGSFGKVMQVRKK----------DT 392
           GK+  + D  P RN PL      +   + +   +G+G FGKV     K          D 
Sbjct: 22  GKVPPARDDTP-RNIPLEKRKHVTFGPYIIGSTLGEGEFGKVKLGWPKNSLPSSSSGIDV 80

Query: 393 KKIYALKAIRKSYIVS-KSEVTHTLAERTVLARIDCPFIVPLKFSFQSQEKLYLVLACIN 451
            K  A+K IR+  I    S+      E   L  +  P IV L+   Q+ + + +VL   +
Sbjct: 81  PKQVAIKLIRRDTISKDSSKEIKIYREINALKHLTHPNIVKLEEVLQNSKYIGIVLEYAS 140

Query: 452 GGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCD 511
           GGE + ++QR+ R     +    A+L+  +  +H   +++RDLK EN+LLD   ++ + D
Sbjct: 141 GGEFYKYIQRKKRLKEGPACRLFAQLINGVHYIHSKGLVHRDLKLENLLLDKHENLIITD 200

Query: 512 FGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQG--YSKVVDWWTLGVLLYEMLTGLPPYY 569
           FG         +   T CG+P Y APEL++      +K  D W+ GV+LY ML G  P+ 
Sbjct: 201 FGFVSEFYSHGELMKTSCGSPCYAAPELVVSTKPYEAKKADIWSCGVILYAMLAGYLPWD 260

Query: 570 D-------ENVPKMYKKILQDPLVFPDGFDRDAKDLLIGLLSRDPQRRLGYNGADE---I 619
           D       +++ ++Y  I Q PL FPD  +   +DLL  +L  DP+RR+     ++   +
Sbjct: 261 DDAGNPDGDDISRLYHYITQTPLKFPDYINPIPRDLLRRILISDPRRRITIKYIEKHEWL 320

Query: 620 KNHPFFSQLS---WKRLLMKGYIPPYKPPVTSA 649
           K H  F  ++   W  ++ K +  P + P + A
Sbjct: 321 KPHSAFLSITPEEWDTIMHKKF--PLRSPKSVA 351

>ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH]
           complement(597519..600032) [2514 bp, 837 aa]
          Length = 837

 Score =  125 bits (314), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 88/284 (30%), Positives = 146/284 (51%), Gaps = 36/284 (12%)

Query: 363 KPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVL 422
           K  SI+D    +V+G+G+F  V +  +++T K +A+K I K  ++    V     E  VL
Sbjct: 214 KDFSIND----EVVGQGAFATVKKAVERNTGKTFAVKIINKRKVMGN--VDGVTRELEVL 267

Query: 423 ARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALD 482
            R++ P IV LK  ++  E  YL++  ++GG+L   +   G       R    ++L A+ 
Sbjct: 268 RRLNHPRIVSLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVR 327

Query: 483 TLHKMDVIYRDLKPENILLDYQG--HIALCDFGLCKLNMKDEDKT---DTFCGTPEYLAP 537
            +H+  + +RDLKP+NIL++      + + DFGL K+    +D T    TFCGT  Y+AP
Sbjct: 328 YIHEQGISHRDLKPDNILIEQDDPVLVKITDFGLAKI----QDNTTFMKTFCGTLAYVAP 383

Query: 538 ELLLGQG----------YSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVF 587
           E++ G+           YS +VD W++G L+Y +LTG  P+      ++YK+I      +
Sbjct: 384 EVIGGKNPEGNGANGNLYSSLVDMWSIGCLVYVILTGHLPFSGSTQEQLYKQIANGS--Y 441

Query: 588 PDGFDRD------AKDLLIGLLSRDPQRRLGYNGADEIKNHPFF 625
            +G  +D      A+D +  LL  +P  RL    A+    HP+ 
Sbjct: 442 HEGPLKDYWISDEARDFIDSLLQINPVDRL---TAERALQHPWL 482

>Kwal_23.3590
          Length = 499

 Score =  123 bits (308), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 89/296 (30%), Positives = 135/296 (45%), Gaps = 33/296 (11%)

Query: 360 SRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAER 419
           +  +P   D +   K +G G +  V +   KD+  + A+K     +   + +      E 
Sbjct: 176 ANRRPSFFDRYIAGKELGSGHYAIVKEAIDKDSGDVVAVKIFHAQHNDDQKKTKQFREET 235

Query: 420 TVLARIDCPFIVPLKFSF-----QSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYA 474
            +L  I    IV L   F     ++Q + +LVL  ++ GELF  + R+ R     +    
Sbjct: 236 KILMSIQHKNIVKLIDRFVEPVSKAQIQTFLVLEKVSDGELFDRIVRKTRLREDETNAIF 295

Query: 475 AELLCALDTLHKMDVIYRDLKPENILLDYQGH-------------------IALCDFGLC 515
            ++L  L  LH  ++I+RD+KPENILL  +                     I + DFGL 
Sbjct: 296 KQILNGLRYLHAKNIIHRDIKPENILLSIRKRRHSDEQQLGPWDDDEIDITIKIADFGLA 355

Query: 516 KLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENV-P 574
           K  + +   T+T CGTP Y+APE+L   GY+  VD W+ GVLLY  L G PP+ ++   P
Sbjct: 356 KF-IGEMQFTNTLCGTPSYVAPEVLTKTGYTSRVDMWSAGVLLYVCLCGFPPFSEQLAPP 414

Query: 575 KMYKKILQDPLVFP----DGFDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFS 626
            M ++IL     F     D  D     L+  LL  +P  R       +  NHP+FS
Sbjct: 415 SMKEQILNGKFAFYSPYWDDIDDSCLHLISNLLVVNPAYRF---DVQKTINHPWFS 467

>CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces
           cerevisiae YDR122w KIN1 or sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2, hypothetical start
          Length = 944

 Score =  125 bits (314), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 90/306 (29%), Positives = 148/306 (48%), Gaps = 45/306 (14%)

Query: 366 SIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIR---KSYIVSKSEV---------- 412
           S+  +D ++ +G GS GKV   + K++ ++ A+K +    K+Y+    ++          
Sbjct: 63  SLSGWDFMETVGAGSMGKVKLAKNKNSNEVCAIKIVHRATKAYMHKAQQLPPPADENEAK 122

Query: 413 -------------THTLAERTVLARIDCPFIVPLKFSFQS-QEKLYLVLACINGGELFYH 458
                          T+ E ++   +  P +  L +  Q+     Y+    I+GG+L  +
Sbjct: 123 ERQKRLNKEISRDKRTVREASLGQILFHPNVCKL-YEMQTLSNHYYMFFEFISGGQLLDY 181

Query: 459 LQREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLN 518
           + + G    + +R  +  +L AL  LH  ++++RDLK ENI+L   G I L DFGL   N
Sbjct: 182 IIQHGSLKENHARKVSRGILSALQYLHANNIVHRDLKIENIMLSKTGEIKLIDFGLS--N 239

Query: 519 MKDEDKT-DTFCGTPEYLAPELLLGQGY-SKVVDWWTLGVLLYEMLTGLPPYYDENVPKM 576
           M D  K+  TFCG+  + APELL    Y    VD W+ GV+LY ++ G  P+ DEN   +
Sbjct: 240 MYDPRKSLQTFCGSLYFAAPELLKAHPYLGPEVDVWSFGVVLYVLVCGKVPFDDENSSAL 299

Query: 577 YKKILQDPLVFPDGFDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQLSWKRLLMK 636
           ++KI +  + +P     D   LL  +L  DPQ+R       ++ NH       W   ++K
Sbjct: 300 HEKIKKGKVTYPQFLSIDVISLLSKILVVDPQKRATLQ---QVVNH------QW---MLK 347

Query: 637 GY-IPP 641
           GY  PP
Sbjct: 348 GYDFPP 353

>CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, hypothetical start
          Length = 442

 Score =  122 bits (306), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 76/247 (30%), Positives = 130/247 (52%), Gaps = 10/247 (4%)

Query: 374 KVIGKGSFGKVMQVRKKDTKKIYALKAI-RKSYIVSKSEVTHTLAERTVLARIDCPFIVP 432
           K +G G+FG V Q R   T +  A+K + +K+   +  ++     E ++L  +  P IV 
Sbjct: 49  KTLGAGTFGVVRQARYSPTNEDVAVKILLKKALKGNDVQLQMLYDELSILQMLKHPNIVE 108

Query: 433 LKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYR 492
            K  F+S++K Y+V     GGELF  +  +G+F    +     ++L A+D +H  +V++R
Sbjct: 109 FKDWFESKDKFYIVTQLAVGGELFDRILAKGKFTERDAVSITMQILSAVDYMHSKNVVHR 168

Query: 493 DLKPENIL-LDYQ--GHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVV 549
           DLKPEN+L +D      + + DFG+ K    ++D      G+  Y+APE+L   G+ K  
Sbjct: 169 DLKPENVLYIDKSDDSQLVIADFGIAKQLQDNDDLIFKAAGSLGYVAPEVLTNNGHGKPC 228

Query: 550 DWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQD--PLVFP----DGFDRDAKDLLIGLL 603
           D W++GV++Y +L G   +  E V    ++  Q+  P+ F     D    +AK+ ++  L
Sbjct: 229 DIWSIGVIVYTLLCGYSAFVAETVDGFLEECTQNKYPVTFHKPYWDNISDEAKNFILRAL 288

Query: 604 SRDPQRR 610
           + DP  R
Sbjct: 289 TLDPAER 295

>AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W
           (KIN1) - SH] complement(823632..826847) [3216 bp, 1071
           aa]
          Length = 1071

 Score =  125 bits (313), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 95/325 (29%), Positives = 145/325 (44%), Gaps = 48/325 (14%)

Query: 366 SIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAI------------------------ 401
           S+ D+D L+ +G GS GKV   + + T ++ A+K +                        
Sbjct: 50  SLGDWDFLETVGAGSMGKVKLAKHRYTNELCAIKIVNRATKSFMHKQQLQGLPPPATEEE 109

Query: 402 ----RKSYIVSKSEVTHTLAERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFY 457
               RK      S    T+ E ++   +  P I  L          Y++   ++GG+L  
Sbjct: 110 LLERRKKLEKEVSRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLD 169

Query: 458 HLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKL 517
           ++ + G      +R +A  +  AL  LH  ++++RDLK ENI++   G I + DFGL   
Sbjct: 170 YIIQHGSLRERHARKFARGIASALQYLHLNNIVHRDLKIENIMISSSGEIRIIDFGLS-- 227

Query: 518 NMKDEDKT-DTFCGTPEYLAPELLLGQGYSK-VVDWWTLGVLLYEMLTGLPPYYDENVPK 575
           NM D  K   TFCG+  + APELL    Y+   VD W+ GV+LY ++ G  P+ DEN   
Sbjct: 228 NMYDPKKQLHTFCGSLYFAAPELLKAHPYTGPEVDIWSFGVVLYVLVCGKVPFDDENASV 287

Query: 576 MYKKILQDPLVFPDGFDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQLSWKRLLM 635
           +++KI Q  + +P     D   LL  +L  DP +R                Q+   + + 
Sbjct: 288 LHEKIKQGKVEYPQHLSIDVISLLSKMLVVDPYKRA------------TLKQVVHHQWMQ 335

Query: 636 KGY-IPP--YKPPVTSAT-DTSNFD 656
           KGY  PP  Y PP    T D  N D
Sbjct: 336 KGYDFPPPSYLPPCVPLTPDRINMD 360

>CAGL0K10604g complement(1029226..1030566) similar to sp|P27466
           Saccharomyces cerevisiae YFR014c CMK1
           Ca2+/calmodulin-dependent ser/thr protein kinase type I,
           hypothetical start
          Length = 446

 Score =  121 bits (304), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 79/261 (30%), Positives = 133/261 (50%), Gaps = 12/261 (4%)

Query: 374 KVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPFIVPL 433
           + +G GSFG V + ++  + +  A+K + K  +     +     E  ++  +D P IV  
Sbjct: 69  RTLGAGSFGVVKRAKQLHSDEDVAVKILLKRALEKNGGLEPIYDELNIIQHLDHPNIVKF 128

Query: 434 KFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYRD 493
           K  F+++ K Y+V    +GGELF  +  +G++    +     ++L A++ LH  ++I+RD
Sbjct: 129 KDWFETESKFYIVTQLASGGELFDRIMHDGKYTEEDAVNIVVQILKAVEYLHSQNIIHRD 188

Query: 494 LKPENIL-LDYQ--GHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVD 550
           LKPEN+L LD      I L DFG+ +    D+D      G+  Y+APE+    G+ K  D
Sbjct: 189 LKPENLLYLDKSKDSRIVLADFGIARQLENDDDVIYRPAGSLGYVAPEVFTSDGHGKPSD 248

Query: 551 WWTLGVLLYEMLTGLPPYYDENVPKMYKKILQD--PLVFP----DGFDRDAKDLLIGLLS 604
            W++GV+ Y +L G  P+  E+V     ++  D  P+ F     DG    AK+ ++ +L 
Sbjct: 249 IWSVGVITYTLLCGYSPFKAESVDGFLDEVTSDENPVKFQRPYWDGISELAKNFILRILD 308

Query: 605 RDPQRRLGYNGADEIKNHPFF 625
            DP  R     A E+ N P+ 
Sbjct: 309 LDPACR---PSATELLNDPWI 326

>AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH]
           (1769897..1771219) [1323 bp, 440 aa]
          Length = 440

 Score =  120 bits (302), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 83/265 (31%), Positives = 133/265 (50%), Gaps = 13/265 (4%)

Query: 370 FDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTV-LARIDCP 428
           +++L+ IG+G+FG V + R   + +I A+K +    +    E    LA+    L+ +  P
Sbjct: 20  YEILQCIGRGNFGDVYKARDLTSNEIVAIKVVN---LEDTDEPIDLLAQEIFFLSELRSP 76

Query: 429 FIVPLKFSFQSQEKLYLVLACINGGELFYHLQR--EGRFDLSRSRFYAAELLCALDTLHK 486
           +I   K +F     +++V+    GG     L+   E +    +  F  +E+L  LD LH 
Sbjct: 77  YITNYKTAFLVDVSMWIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVSEVLIGLDYLHS 136

Query: 487 MDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELL--LGQG 544
              I+RD+K  NILL   GH+ L DFG+    M    K DTF GTP ++APE++    QG
Sbjct: 137 QRKIHRDIKSANILLTDNGHVKLGDFGVSG-QMMVTRKRDTFVGTPFWMAPEVIDRNKQG 195

Query: 545 YSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKI-LQDPLVFPDGFDRDAKDLLIGLL 603
           Y+++ D W+LG+ + E+L G PP    +  K    I  +DP      F   A+D +   L
Sbjct: 196 YNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPKRDPPKLDKRFSSHARDFVAQCL 255

Query: 604 SRDPQRRLGYNGADEIKNHPFFSQL 628
            +DP +R     A E+  H F  ++
Sbjct: 256 IKDPSQR---PTAAELLKHRFVKRV 277

>CAGL0M02519g complement(290723..292993) highly similar to tr|Q03002
           Saccharomyces cerevisiae YPL141c or sp|Q01919
           Saccharomyces cerevisiae YOR233w KIN4, hypothetical
           start
          Length = 756

 Score =  123 bits (308), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 86/314 (27%), Positives = 148/314 (47%), Gaps = 42/314 (13%)

Query: 359 PSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDT--------------------KKIYAL 398
           P   K ++   + +   +G+G FGKV     K                       K  A+
Sbjct: 37  PKHRKHVTFGPYVIGATLGEGEFGKVKLAWSKSAYQQCDNTEGNAGNKPMTFKVPKQVAI 96

Query: 399 KAIRKSYIVSK-SEVTHTLAERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFY 457
           K I++ +I    S+ T    E   L  +  P IV L+   Q+ + + +VL    GGE + 
Sbjct: 97  KLIKRDFITKDPSKETKIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYAAGGEFYK 156

Query: 458 HLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKL 517
            +QR+ R   + +    ++L+ A+  +H   +++RDLK EN+LLD + ++ + DFG    
Sbjct: 157 FIQRKRRLKENHACRLFSQLISAVHYIHSKGLVHRDLKLENLLLDNEENLIITDFGFVNE 216

Query: 518 NMKDEDKTDTFCGTPEYLAPELLLG-QGY-SKVVDWWTLGVLLYEMLTGLPPYYDE---- 571
            ++      T CG+P Y APEL++  + Y ++  D W+ G++L+ ML G  P+ D+    
Sbjct: 217 FLRQNGMMKTSCGSPCYAAPELVVSNRPYDARKADTWSCGIILFAMLAGYLPWDDDPKNP 276

Query: 572 ---NVPKMYKKILQDPLVFPDGFDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQL 628
              ++ ++Y  IL  PL FP+  +   +DLL  +L  DP++R+       I+ HP+    
Sbjct: 277 DGHDISRLYNYILNTPLKFPEYINPVPRDLLRKILVIDPKKRINIRS---IEKHPWLESH 333

Query: 629 S---------WKRL 633
           S         W RL
Sbjct: 334 STFLSITPDEWDRL 347

>Kwal_33.13112
          Length = 505

 Score =  120 bits (302), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 81/267 (30%), Positives = 137/267 (51%), Gaps = 12/267 (4%)

Query: 370 FDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPF 429
           +D+ + +GKGSFG V +   K+T ++ A+K I      ++ ++     E   L+ +  PF
Sbjct: 36  YDIKECVGKGSFGDVYRAIDKETGEMVAVKIINLEE--TQDDIDVLAQEIYFLSELRAPF 93

Query: 430 IVPLKFSFQSQEKLYLVLACINGG---ELFYHLQREGRFDLSRSRFYAAELLCALDTLHK 486
           +     ++     +++V+    GG   +L  HL  E R   ++  +   E+L  L+ LH 
Sbjct: 94  VTTYYKTYVEDVSMWIVMEFCGGGSCADLLKHLP-EHRLPENKVAYIIREVLYGLEYLHS 152

Query: 487 MDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLL-GQGY 545
              I+RD+K  NILL  +G + L DFG+    M    K +TF GTP ++APE++    GY
Sbjct: 153 QRKIHRDVKAANILLTDEGEVKLGDFGVSGQIMATL-KRNTFVGTPYWMAPEIIARDNGY 211

Query: 546 SKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKI-LQDPLVFPDGFDRDAKDLLIGLLS 604
            +  D W+LG+   E+LTG PPY   +  K+   I L+ P      F   A+D +   L+
Sbjct: 212 DEKADIWSLGITAMELLTGQPPYAKYDPMKVLMNIPLRKPPRLQGRFTSSARDFIALCLT 271

Query: 605 RDPQRRLGYNGADEIKNHPFFSQLSWK 631
           +DP  R     A ++ +H F ++ +W+
Sbjct: 272 KDPALR---PTASDLLSHKFLNRPTWR 295

>YDR507C (GIN4) [1321] chr4 complement(1462346..1465774)
           Serine/threonine-protein kinase required for septin
           organization at the bud neck, has similarity to Ycl024p
           [3429 bp, 1142 aa]
          Length = 1142

 Score =  123 bits (309), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 83/283 (29%), Positives = 145/283 (51%), Gaps = 27/283 (9%)

Query: 366 SIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYI----VSKSEVTHTLA---- 417
           +I  + L + +G GS GKV   R   T +  A+K I K+      VS + +  +      
Sbjct: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDAL 74

Query: 418 ------ERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSR 471
                 E  ++  ++ P ++ L   +++   LYLVL     GELF  L   G      + 
Sbjct: 75  PYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAI 134

Query: 472 FYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGT 531
            +  +++  +   H + +++RDLKPEN+LLD++ +I + DFG+  L  + +   +T CG+
Sbjct: 135 RFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGK-LLETSCGS 193

Query: 532 PEYLAPELLLG---QGYSKVVDWWTLGVLLYEMLTGLPPYYDE--NVPKMYKKILQDPLV 586
           P Y APE++ G   QG++   D W+ GV+L+ +LTG  P+ +E  N+  +  K+ +    
Sbjct: 194 PHYAAPEIVSGIPYQGFAS--DVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFE 251

Query: 587 FP--DGFDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQ 627
            P  D   R+A+DL+  +L+ DP+RR+      +I  HP   +
Sbjct: 252 MPSDDEISREAQDLIRKILTVDPERRI---KTRDILKHPLLQK 291

>Scas_700.54
          Length = 698

 Score =  122 bits (305), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 84/286 (29%), Positives = 145/286 (50%), Gaps = 28/286 (9%)

Query: 363 KPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVL 422
           K  SI D    +V+G+G+F  V +  ++ T K +A+K I K  ++   E      E  VL
Sbjct: 220 KDFSIQD----EVVGQGAFATVKKAVERSTGKTFAVKIISKRKVMGNMEGVSR--ELEVL 273

Query: 423 ARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALD 482
            ++D P IV LK  ++ ++  Y+V+  ++GG+L   +   G       +  + ++L A+ 
Sbjct: 274 QQLDHPRIVRLKGFYEDKDSYYMVMEFVSGGDLMDFVAAHGAVGEEAGKEISRQILEAVK 333

Query: 483 TLHKMDVIYRDLKPENILLDYQG--HIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELL 540
            +H   + +RDLKP+NIL++      + + DFGL K+   +     TFCGT  Y+APE++
Sbjct: 334 YIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQ-GNGSFMKTFCGTLAYVAPEVI 392

Query: 541 LGQG--------YSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDG-- 590
            G+G        YS +VD W++G L+Y +LTG  P+      ++YK+I +    + +G  
Sbjct: 393 GGKGETNEERNEYSSLVDMWSMGCLVYVILTGHLPFSGSTQEQLYKQISRGS--YHEGPL 450

Query: 591 ----FDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQLSWKR 632
                  +A+  +  LL  +P  RL    A E   HP+     + +
Sbjct: 451 KDFRISDEARSFIDSLLQVNPGNRLTAARALE---HPWIKMAQYSQ 493

>YFR014C (CMK1) [1695] chr6 complement(172529..173869)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type I [1341 bp, 446 aa]
          Length = 446

 Score =  119 bits (298), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 76/247 (30%), Positives = 129/247 (52%), Gaps = 10/247 (4%)

Query: 374 KVIGKGSFGKVMQVRKKDTKKIYALKA-IRKSYIVSKSEVTHTLAERTVLARIDCPFIVP 432
           K +G G+FG V Q +  +T +  A+K  I+K+   +K ++     E  +L R+  P IV 
Sbjct: 41  KTLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLEALYDELDILQRLHHPNIVA 100

Query: 433 LKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYR 492
            K  F+S++K Y++     GGELF  + ++G+F    +     E+L A+  +H  ++++R
Sbjct: 101 FKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEEDAVRILVEILSAVKYMHSQNIVHR 160

Query: 493 DLKPENIL-LDY--QGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVV 549
           DLKPEN+L +D   +  + + DFG+ K    DE+      G+  Y+APE+L   G+ K  
Sbjct: 161 DLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELLYKPAGSLGYVAPEVLTQDGHGKPC 220

Query: 550 DWWTLGVLLYEMLTGLPPYYDENVPKMYKKIL--QDPLVFP----DGFDRDAKDLLIGLL 603
           D W++GV+ Y +L G   +  E V     +    + P+ F     D     AK  ++  L
Sbjct: 221 DIWSIGVITYTLLCGYSAFRAERVQDFLDECTTGEYPVKFHRPYWDSVSNKAKQFILKAL 280

Query: 604 SRDPQRR 610
           + DP +R
Sbjct: 281 NLDPSKR 287

>ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH]
           (157357..160200) [2844 bp, 947 aa]
          Length = 947

 Score =  122 bits (306), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 79/245 (32%), Positives = 122/245 (49%), Gaps = 7/245 (2%)

Query: 370 FDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARI-DCP 428
           F   +VIG+G FG V +     TK++YA+K +  +    + EV     E   LA +   P
Sbjct: 25  FKRTEVIGRGKFGVVYKAYHAKTKQVYAVKVL--NLDCPEDEVEDVQKEIQFLASLKQVP 82

Query: 429 FIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMD 488
            I     S+    KL++++    GG L   L R G+ D         +LL AL  +HK +
Sbjct: 83  NITRYYGSYLYDTKLWVIMEYCAGGSLRT-LLRPGKIDEKYLGVIVRKLLIALVYIHKDN 141

Query: 489 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLL-GQGYSK 547
           VI+RD+K  N+L+  +GH+ LCDFG+         K  T  GTP ++APE+++ G  Y+ 
Sbjct: 142 VIHRDIKAANVLITNEGHVKLCDFGVAAQLTAANHKRQTMAGTPYWMAPEVIMEGVYYNT 201

Query: 548 VVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQD--PLVFPDGFDRDAKDLLIGLLSR 605
             D W+LG+  YE+ TG PPY D    +  + I +   P +    +    K+ +   L  
Sbjct: 202 KADIWSLGITAYEIATGNPPYCDVEALRAMQLITKSKPPRLEGRNYSPLLKEFIALCLDE 261

Query: 606 DPQRR 610
           DP+ R
Sbjct: 262 DPEER 266

>KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces
           cerevisiae YDR507c GIN4 ser/thr protein kinase, start by
           similarity
          Length = 1112

 Score =  122 bits (307), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 82/278 (29%), Positives = 143/278 (51%), Gaps = 20/278 (7%)

Query: 366 SIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKS---------EVTHTL 416
           +I  + L   +G GS GKV+    +   +  A+K I KS   ++          +V    
Sbjct: 13  TIGPWKLGSTLGVGSTGKVVMAYNETKGQQAAVKIISKSIFNAQGSTMIGGNDPDVLPYG 72

Query: 417 AERTV--LARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYA 474
            ER +  +  ++ P ++ L   +++ + LY+VL  +  GELF  L   G    + +  + 
Sbjct: 73  IEREIIIMKLLNHPNVLRLYDVWETSKDLYMVLEYVEKGELFNLLVERGPLPENEAVRFF 132

Query: 475 AELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEY 534
            +++  +   H + +++RDLKPEN+LLD++ ++ L DFG+  L  KD+   +T CG+P Y
Sbjct: 133 RQIIIGISYCHALGIVHRDLKPENLLLDHKFNVKLADFGMAALESKDK-LLETSCGSPHY 191

Query: 535 LAPELLLGQGYSKV-VDWWTLGVLLYEMLTGLPPYYDE--NVPKMYKKILQDPLVFP--D 589
            APE++ G  Y     D W+ GV+LY +LTG  P+ +E  N+  +  K+       P  D
Sbjct: 192 AAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKFEMPGDD 251

Query: 590 GFDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQ 627
               +A+DL+  +L+ DP++R+      EI  HP   +
Sbjct: 252 EISSEAQDLIARILTVDPEQRI---KTREILKHPLLRK 286

>Scas_493.2
          Length = 1117

 Score =  122 bits (306), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 83/281 (29%), Positives = 141/281 (50%), Gaps = 23/281 (8%)

Query: 366 SIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSK--SEVTHTLA------ 417
           +I  + L + +G GS GKV     + T +  A+K I KS   +K  S  T  +A      
Sbjct: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSL 77

Query: 418 ------ERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSR 471
                 E  ++  +    ++ L   +++   LY++L     GELF  L  +G      + 
Sbjct: 78  PYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAV 137

Query: 472 FYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGT 531
            +  +++  +   H + +++RDLKPEN+LLD++ +I + DFG+  L  +D+   +T CG+
Sbjct: 138 RFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDK-LLETSCGS 196

Query: 532 PEYLAPELLLGQGYSKV-VDWWTLGVLLYEMLTGLPPYYDE--NVPKMYKKILQDPLVFP 588
           P Y APE++ G  Y     D W+ GV+L+ +LTG  P+ +E  N+  +  K+       P
Sbjct: 197 PHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP 256

Query: 589 DG--FDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQ 627
           D     RDA+DL+  +L+ DP +R+      EI  HP   +
Sbjct: 257 DDDEMSRDAQDLISRILTVDPTKRI---KTREILKHPLLQK 294

>KLLA0F11143g complement(1026129..1028570) similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, start by similarity
          Length = 813

 Score =  120 bits (302), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 76/268 (28%), Positives = 143/268 (53%), Gaps = 25/268 (9%)

Query: 375 VIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPFIVPLK 434
           ++G+G+F  V +  ++ T K +A+K I K  ++ K +      E  VL +++ P IV LK
Sbjct: 197 IVGQGAFATVKKAVERSTGKTFAVKIIHKRKVMDKFDGVKR--ELDVLQKLNHPRIVKLK 254

Query: 435 FSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDL 494
             F+  +  Y+++  ++GG+L   +   G       R    ++L A+  +H   + +RDL
Sbjct: 255 DFFEDNDNYYMLMEFVSGGDLMDFVAAHGTVGEDAGREITRQVLEAVKYMHDQGISHRDL 314

Query: 495 KPENILLDYQG--HIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQG-------- 544
           KP+NI+++      I + DFGL K+  ++    +TFCGT  Y+APE++ G+         
Sbjct: 315 KPDNIMIEQDDPVLIKITDFGLAKVQNQNT-FLNTFCGTLAYVAPEVIDGKNAEDKTNRD 373

Query: 545 -YSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDG------FDRDAKD 597
            YS +VD W++G L+Y +LTG  P+  ++  +++K+I +    + +G         +A++
Sbjct: 374 LYSSLVDMWSIGCLVYVILTGHLPFSGQSQNELFKQIKRGS--YHEGPLKDYRISEEARN 431

Query: 598 LLIGLLSRDPQRRLGYNGADEIKNHPFF 625
            +  LL+ DP+ R+    A +   HP+ 
Sbjct: 432 FIDCLLNVDPKERM---NAGKALQHPWM 456

>KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase, start by
           similarity
          Length = 1104

 Score =  120 bits (302), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 78/279 (27%), Positives = 134/279 (48%), Gaps = 31/279 (11%)

Query: 362 NKPL---SIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIR---KSYIVSKSEVTHT 415
           NKP    S+ D+D L+ +G GS GKV   + + T ++ A+K +    KSY+  ++++   
Sbjct: 87  NKPFHRKSLGDWDFLETVGAGSMGKVKLAKHRLTNEVCAIKIVNRAAKSYMHKQNQLPPP 146

Query: 416 LAERTVLAR-----------------------IDCPFIVPLKFSFQSQEKLYLVLACING 452
             E  ++ R                       +  P I  L          Y++   ++G
Sbjct: 147 KTEEELMERKKKLEKELSRDRRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSG 206

Query: 453 GELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDF 512
           G+L  ++ + G      +R +   +  AL  LH  ++++RDLK ENI++   G I + DF
Sbjct: 207 GQLLDYIIQHGSLRERHARKFVRGIASALQYLHLNNIVHRDLKIENIMISTSGEIKIIDF 266

Query: 513 GLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGY-SKVVDWWTLGVLLYEMLTGLPPYYDE 571
           GL  L   ++ +  TFCG+  + APELL    Y    VD W+ GV++Y ++ G  P+ DE
Sbjct: 267 GLSNL-YDNKKQLHTFCGSLYFAAPELLKANPYIGPEVDIWSFGVVIYVLVCGKVPFDDE 325

Query: 572 NVPKMYKKILQDPLVFPDGFDRDAKDLLIGLLSRDPQRR 610
           N   +++KI +  + +P     +   LL  +L  DP +R
Sbjct: 326 NASVLHEKIKKGKVEYPQHLSIECISLLSKMLVVDPLKR 364

>CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase,
           hypothetical start
          Length = 1192

 Score =  120 bits (300), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 79/290 (27%), Positives = 136/290 (46%), Gaps = 33/290 (11%)

Query: 366 SIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIR---KSYIVSKSEVTHTLAERTVL 422
           S+ D+D L+ +G GS GKV   + + T ++ A+K +    K+++  +      +  + ++
Sbjct: 104 SLGDWDFLETVGAGSMGKVKLAKHRRTGEVCAIKIVNRATKAFLHKEQNSPPPVNNQEIM 163

Query: 423 ARID-----------------------CPFIVPLKFSFQSQEKLYLVLACINGGELFYHL 459
            R                          P I  L          Y++   + GG+L  ++
Sbjct: 164 ERQKKLEKEISRDKRAIREASLGQIFYHPHICRLFEMCTMSNHFYMLFEYVAGGQLLDYI 223

Query: 460 QREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNM 519
            + G      +R +A  +  AL  LH  ++++RDLK ENI++   G I + DFGL   N+
Sbjct: 224 IQHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMISNSGEIKIIDFGLS--NV 281

Query: 520 KDEDKT-DTFCGTPEYLAPELLLGQGYS-KVVDWWTLGVLLYEMLTGLPPYYDENVPKMY 577
            D  K   TFCG+  + APELL    Y+   VD W+ GV+LY ++ G  P+ DEN   ++
Sbjct: 282 YDTRKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSVLH 341

Query: 578 KKILQDPLVFPDGFDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQ 627
           +KI +  + +P     +   LL  +L  DP RR       ++  HP+ ++
Sbjct: 342 EKIKRGKVEYPQHLSIEVMSLLSKMLVVDPSRRASLK---QVVEHPWMTK 388

>CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 893

 Score =  119 bits (299), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 82/261 (31%), Positives = 133/261 (50%), Gaps = 13/261 (4%)

Query: 367 IDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARID 426
           + ++ + K IG+GSFGKV     + TK+   LK   KS         + + E     + D
Sbjct: 39  VGNYKIQKQIGEGSFGKVYLATHRPTKQKVVLKTGDKS-------DPNVVREVFYHRQFD 91

Query: 427 CPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHK 486
            P+I  L     ++ K+++ L    G EL+ HL  + R          A++  A+   H 
Sbjct: 92  YPYITKLYEVIVTETKVWMALEYCPGKELYDHLLSKSRLPTLECAELFAQITGAVHYAHT 151

Query: 487 MDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYS 546
           ++ ++RDLK EN+LLD  G+  L DFG  + +M  +   +T CGT  Y+APE++  + Y 
Sbjct: 152 LNCVHRDLKLENVLLDKNGNAKLTDFGFTRESMT-KAVLETVCGTTVYMAPEMIQHKPYD 210

Query: 547 KV-VDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFD-RDAKDLLIGLLS 604
              VD W+LGV+LY +L G  P+ +++     +KI+ D  V  +     +A++L+  LLS
Sbjct: 211 GFKVDIWSLGVILYTLLCGCLPFDEDDDLLTKQKIINDTPVIDERITIPEAQNLIEQLLS 270

Query: 605 RDPQRRLGYNGADEIKNHPFF 625
           +DP  R   +    I  HPF 
Sbjct: 271 KDPTERPNTSA---ILLHPFL 288

>YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine
           protein kinase involved in regulation of cell wall beta
           1,6-glucan levels, interacts with Cdc31p [3243 bp, 1080
           aa]
          Length = 1080

 Score =  120 bits (300), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 77/246 (31%), Positives = 121/246 (49%), Gaps = 7/246 (2%)

Query: 370 FDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARI-DCP 428
           F   +VIG+G FG V +     T ++YA+K +  +      EV     E   LA +    
Sbjct: 23  FKRTEVIGRGKFGVVYKGYNVKTGRVYAIKVL--NLDSDSDEVEDVQREIQFLASLKQIS 80

Query: 429 FIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMD 488
            I     S+     L++++    GG L   L R G+ D         ELL AL  +HK +
Sbjct: 81  NITRYYGSYLKDTSLWIIMEHCAGGSL-RSLLRPGKIDEKYIGVIMRELLVALKCIHKDN 139

Query: 489 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLL-GQGYSK 547
           VI+RD+K  N+L+  +G++ LCDFG+     +   +  T  GTP ++APE+++ G  Y  
Sbjct: 140 VIHRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRRQTMAGTPYWMAPEVIMEGVYYDT 199

Query: 548 VVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQD--PLVFPDGFDRDAKDLLIGLLSR 605
            VD W+LG+  YE+ TG PPY D    +  + I++   P +    +    K+ +   L  
Sbjct: 200 KVDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPPRLEDRSYSTSLKEFIALCLDE 259

Query: 606 DPQRRL 611
           DP+ RL
Sbjct: 260 DPKERL 265

>Kwal_26.8751
          Length = 848

 Score =  119 bits (299), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 85/283 (30%), Positives = 139/283 (49%), Gaps = 18/283 (6%)

Query: 350 KINISVDYKP-----SRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKS 404
           K NIS  Y       S N+   + ++ +LK++G+GSFGKV       T +   LK     
Sbjct: 12  KANISASYNKLYGQFSLNELQEVGNYKILKIVGEGSFGKVYLASHCLTHQKVVLK----- 66

Query: 405 YIVSKSEVTHTLAERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGR 464
            + SK++  + + E     + D   I  L     ++  +++ L    G EL+ +L  +  
Sbjct: 67  -MGSKND-PNVVREVFYHRQFDYSHITKLYEVIVTENYVWMALEYCPGKELYEYLLAKKH 124

Query: 465 FDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDK 524
             L       ++++ A+   H M  ++RDLK ENILLD +GH  L DFG  +     +  
Sbjct: 125 IPLEECSELFSQIVGAVYYAHSMKCVHRDLKLENILLDKKGHAKLTDFGFTR-ECATKGI 183

Query: 525 TDTFCGTPEYLAPELLLGQGYSKV-VDWWTLGVLLYEMLTGLPPYYD-ENVPKMYKKILQ 582
            +T CGT  Y+APEL+  + Y    +D W+LG++LY M+ G  P+ + + V   YK +  
Sbjct: 184 LETICGTTVYMAPELIERKPYEGYKIDTWSLGIILYTMIHGTMPFDEVDEVKTKYKIVHY 243

Query: 583 DPLVFPDGFDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFF 625
           +P    D  D + K+L+  LL +DP +R       ++  HPF 
Sbjct: 244 NPTYDNDYIDSNGKELISQLLEKDPNQRPSLT---QVLQHPFL 283

>Kwal_47.17252
          Length = 872

 Score =  119 bits (299), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 87/307 (28%), Positives = 147/307 (47%), Gaps = 54/307 (17%)

Query: 361 RNKPLSIDDFDLLKV-IGKGSFGKVMQVR---KKDTKKIYALKAIRKSYIVSKSEVTHTL 416
           R  P+ I D  L++  IGKGSF  V + R    +D     A+KA+ +S + +K  + +  
Sbjct: 10  RAAPIMISDKYLVQQEIGKGSFATVYKGRIASNRDLNDFIAIKAVSRSKLKNKKLLENLE 69

Query: 417 AERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREG----RFDLSRSRF 472
            E  +L +I  P IV L    ++    +L++     G+L + +++ G    +  L R+ F
Sbjct: 70  IEIAILKKIKHPHIVGLMDCERTGADFFLIMEYCALGDLTFLIKKRGGLIEKHPLVRTMF 129

Query: 473 --------------------YAAELLCALDTLHKMDVIYRDLKPENILL-----DYQGH- 506
                               Y  +L  AL  L   ++++RD+KP+N+LL     +Y    
Sbjct: 130 EKYPPPSESHNGLNRVVVVSYLQQLSSALMFLRSKNLVHRDIKPQNLLLSTPLVNYSDRE 189

Query: 507 ---------------IALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVDW 551
                          + + DFG  +  + +    +T CG+P Y+APE+L  Q Y+   D 
Sbjct: 190 TFHKMGFVGIYNLPILKIADFGFARF-LPNTSLAETLCGSPLYMAPEILDYQKYNAKADL 248

Query: 552 WTLGVLLYEMLTGLPPYYDENVPKMYKKI--LQDPLVFPD--GFDRDAKDLLIGLLSRDP 607
           W++G +LYEM  G PP+   N  +++KKI    D + FP     D   ++L+ GLL+ DP
Sbjct: 249 WSVGTVLYEMCCGRPPFKASNHLELFKKIKRANDVISFPTHCKVDPQMRELICGLLTFDP 308

Query: 608 QRRLGYN 614
            +R+G+N
Sbjct: 309 SQRMGFN 315

>KLLA0F09020g 836287..839073 weakly similar to sp|P43565
           Saccharomyces cerevisiae YFL033c RIM15 protein kinase
           involved in expression of meiotic genes, start by
           similarity
          Length = 928

 Score =  119 bits (298), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 109/179 (60%), Gaps = 15/179 (8%)

Query: 356 DYKPSRNKPLS--------------IDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAI 401
           D    RN+PLS              I D+D++K I KG++G V   +K+ T + +A+K +
Sbjct: 674 DSNQHRNQPLSPLLLPTTGKSIIPSIRDYDVIKPISKGAYGSVYLAKKRVTGEYFAIKVL 733

Query: 402 RKSYIVSKSEVTHTLAERTVL-ARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQ 460
           +KS +++K++VT+  +ER ++  + D P++  L  +FQ++E L+LV+  ++GG++   ++
Sbjct: 734 KKSDMIAKNQVTNVKSERAIMMVQSDKPYVARLYATFQNKENLFLVMQYLSGGDMATLIK 793

Query: 461 REGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNM 519
             G      ++ Y  E++  +D +H+  +I+ DLKP+N+L+D  GHI L DFGL ++ +
Sbjct: 794 MMGNLPEKWAKQYICEVISGVDDMHQNGIIHHDLKPDNLLIDSLGHIKLTDFGLSRMGL 852

>AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..90211)
           [1419 bp, 472 aa]
          Length = 472

 Score =  117 bits (292), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 86/272 (31%), Positives = 121/272 (44%), Gaps = 30/272 (11%)

Query: 374 KVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPFIVPL 433
           K +G G +  V +   K T +  A+K           +      E  +L  ++   IV L
Sbjct: 159 KELGSGHYAIVKEAINKITGQSVAVKIFHPQKNDDAKKTRQFREETKILMGLNHENIVKL 218

Query: 434 KFSF-----QSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMD 488
              F     +SQ + YLVL  I  GELF  + R+ +     +R    ++L  L  LH  +
Sbjct: 219 LERFVEPLSKSQVQTYLVLEKIQDGELFDKIVRKTKLHQDETRALFKQILAGLKYLHDRN 278

Query: 489 VIYRDLKPENILLDYQGH-------------------IALCDFGLCKLNMKDEDKTDTFC 529
           +I+RD+KPENILL  +                     + + DFGL K    +   T T C
Sbjct: 279 IIHRDIKPENILLSIRRRTSPDQVQLGPWDEDELDITVKIADFGLAKFT-GEMQFTTTLC 337

Query: 530 GTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENV-PKMYKKILQDPLVFP 588
           GTP Y+A E+L   GY+  VD W+ GVLLY  L G PP+ D+   P M ++ILQ    F 
Sbjct: 338 GTPSYVAAEVLTKTGYTSKVDLWSAGVLLYVCLCGFPPFSDQLAPPSMKEQILQGKFAFY 397

Query: 589 ----DGFDRDAKDLLIGLLSRDPQRRLGYNGA 616
               D  D     L+  LL  DP +R     A
Sbjct: 398 SPYWDEIDDSVLHLISNLLVVDPAKRYSVRDA 429

>Scas_580.6
          Length = 1015

 Score =  119 bits (298), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 81/260 (31%), Positives = 127/260 (48%), Gaps = 10/260 (3%)

Query: 370 FDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARI-DCP 428
           F   +VIG+G FG V +     TK+IYA+K +  +    + EV     E   L+ +   P
Sbjct: 37  FRRTEVIGRGKFGIVYKGYHVRTKQIYAIKVL--NLDSDEDEVEDVQREVQFLSSLKQIP 94

Query: 429 FIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMD 488
            I     S+     L++++    GG L   L R G+ D         ELL AL  +HK +
Sbjct: 95  NITRYYGSYLKDTSLWIIMEYCAGGSL-RSLLRPGKIDEKYIGVIMRELLVALKYIHKDN 153

Query: 489 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLL-GQGYSK 547
           VI+RD+K  N+L+  +G + LCDFG+     +   +  T  GTP ++APE+++ G  Y  
Sbjct: 154 VIHRDIKAANVLITNEGSVKLCDFGVAAQLNQSTLRRQTMAGTPYWMAPEVIMEGVYYDT 213

Query: 548 VVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQD--PLVFPDGFDRDAKDLLIGLLSR 605
            VD W+LG+  YE+ TG PPY +    +  + I +   P +    +    K+ +   L  
Sbjct: 214 KVDIWSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPRLESRSYTPLLKEFIALCLDE 273

Query: 606 DPQRRLGYNGADEIKNHPFF 625
           DP+ RL    A+E+    F 
Sbjct: 274 DPKERL---SAEELSKTKFI 290

>CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces
           cerevisiae YFL033c RIM15 protein kinase involved in
           expression of meiotic genes, hypothetical start
          Length = 1682

 Score =  119 bits (298), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 60/163 (36%), Positives = 104/163 (63%), Gaps = 3/163 (1%)

Query: 360 SRNKPL--SIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLA 417
           S+ KPL  SI D+D++K I KG++G V   RKK T   +A+K +RKS +++K++VT+  +
Sbjct: 770 SQMKPLTPSIKDYDIIKPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTNVKS 829

Query: 418 ERTVL-ARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAE 476
           ER ++  + D P++  L  +FQ+++ L+LV+  + GG+L   L+  G       + Y +E
Sbjct: 830 ERAIMMVQSDKPYVARLYATFQNKDNLFLVMEYLPGGDLATLLKMMGCLPDEWVKQYLSE 889

Query: 477 LLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNM 519
           ++  ++ +H   +I+ DLKPEN+L+D  GH+ L DFGL +  +
Sbjct: 890 IIIGVEDMHNNGIIHHDLKPENLLIDVSGHLKLTDFGLSRAGL 932

 Score =  115 bits (287), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 94/172 (54%), Gaps = 17/172 (9%)

Query: 514  LCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENV 573
            L   N +D  +   F GTP+YLAPE + G G     DWW++G +L+EM+ G PP++ E  
Sbjct: 1089 LILFNPEDSKQDKRFFGTPDYLAPETIEGTGEDNQCDWWSVGCILFEMVFGYPPFHAETP 1148

Query: 574  PKMYKKILQDPLVFP--DGFDR-------DAKDLLIGLLSRDPQRRLGYNGADEIKNHPF 624
             ++++ IL+  + +P  D  +        +AKDL++  L  DP +RLGYNG +EIKNHP+
Sbjct: 1149 DQVFRNILEGKIDWPIFDSIEEEREYISPEAKDLIMKFLITDPHKRLGYNGTEEIKNHPY 1208

Query: 625  FSQLSWKRLLMKGYIPPYKPPVTSATDTSNFD------QEFTREKPIDSVVD 670
            F  + W  +  +     Y P +    DT  FD      Q+F  +   D+V++
Sbjct: 1209 FKDVKWDHVYDE--TASYVPNIEDPEDTDYFDLRGATLQDFGDDNDEDAVLE 1258

>YFL033C (RIM15) [1651] chr6 complement(69113..74425)
           Serine/threonine protein kinase, positive regulator of
           IME2 expression and of sporulation [5313 bp, 1770 aa]
          Length = 1770

 Score =  119 bits (298), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 57/155 (36%), Positives = 100/155 (64%), Gaps = 1/155 (0%)

Query: 366 SIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVL-AR 424
           SI D+D+LK I KG++G V   RKK T   +A+K +RKS +++K++VT+  +ER ++  +
Sbjct: 790 SIKDYDILKPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTNVKSERAIMMVQ 849

Query: 425 IDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTL 484
            D P++  L  SFQ+++ L+LV+  + GG+L   ++  G      ++ Y  E++  ++ +
Sbjct: 850 SDKPYVARLFASFQNKDNLFLVMEYLPGGDLATLIKMMGYLPDQWAKQYLTEIVVGVNDM 909

Query: 485 HKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNM 519
           H+  +I+ DLKPEN+L+D  GH+ L DFGL +  +
Sbjct: 910 HQNGIIHHDLKPENLLIDNAGHVKLTDFGLSRAGL 944

 Score = 99.4 bits (246), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 52/146 (35%), Positives = 81/146 (55%), Gaps = 12/146 (8%)

Query: 521  DEDKTDTFCGTPEYLAPELLLGQGY-SKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKK 579
            D  +   F GTP+YLAPE + G+G  +K  DWW++G + +E+L G PP++ E    ++KK
Sbjct: 1140 DSKQNKKFFGTPDYLAPETIEGKGEDNKQCDWWSVGCIFFELLLGYPPFHAETPDAVFKK 1199

Query: 580  ILQDPLVFPDGFDR---------DAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQLSW 630
            IL   + +P+  +          +AKDL+  LL  DP +RLG  G  EIK+HP+F  + W
Sbjct: 1200 ILSGVIQWPEFKNEEEEREFLTPEAKDLIEKLLVVDPAKRLGAKGIQEIKDHPYFKNVDW 1259

Query: 631  KRLLMKGYIPPYKPPVTSATDTSNFD 656
              +  +     + P + +  DT  FD
Sbjct: 1260 DHVYDEE--ASFVPTIDNPEDTDYFD 1283

>Scas_700.28
          Length = 896

 Score =  118 bits (296), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 80/261 (30%), Positives = 131/261 (50%), Gaps = 13/261 (4%)

Query: 367 IDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARID 426
           + ++ +L  IG+GSFGKV   + + T     LK+       S     + + E     + D
Sbjct: 35  VGNYKILDQIGEGSFGKVYLAQHRPTHTKVVLKS-------SDKNDPNIVREVFYHRQFD 87

Query: 427 CPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHK 486
            P+I  L     ++ K+++ L    G EL+  +    R          A+++  +   H 
Sbjct: 88  YPYITKLYEVIITETKVWMALEYCPGKELYDRVLSMHRVPTDECVQLFAQIVGGVHYAHS 147

Query: 487 MDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYS 546
           ++ ++RDLK ENILLD  G   L DFG  +  M  +   +T CGT  Y+APEL+  + Y 
Sbjct: 148 LNCVHRDLKLENILLDKSGDAKLTDFGFTRECMT-KTTLETICGTTVYMAPELIERKSYD 206

Query: 547 KV-VDWWTLGVLLYEMLTGLPPYYDENVPKMYKKIL-QDPLVFPDGFDRDAKDLLIGLLS 604
              +D W+LGV+LY M+ G  P+ +++  K   KI+ Q P +  +    DAKDL++ LL+
Sbjct: 207 GFKIDIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQLNENIVTADAKDLILRLLA 266

Query: 605 RDPQRRLGYNGADEIKNHPFF 625
           ++P  R      ++I  HPF 
Sbjct: 267 KNPNDRP---TVEQILKHPFL 284

>Scas_640.14*
          Length = 728

 Score =  118 bits (295), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 86/294 (29%), Positives = 144/294 (48%), Gaps = 35/294 (11%)

Query: 360 SRNKP--LSIDDFDLLKVIGKGSFGKVMQ----------VRKKDTKKIYALKAIRKSYIV 407
           SRNK   +    + +   +G+G FGKV               +D+K++ A+K IR+ +I 
Sbjct: 26  SRNKKSHMKFGPYIVGATLGEGEFGKVKMGWSTTSSSSGKITEDSKQV-AIKLIRRDFIK 84

Query: 408 SKSEVTHTL-AERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFD 466
             SE    +  E   L  +  P IV L+   Q+ + + +VL   +GGE + ++QR+ R  
Sbjct: 85  KGSEKEMKIFREINSLKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYVQRKRRLK 144

Query: 467 LSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTD 526
            + +    A+L+  +  +H   +++RDLK EN+LLD   ++ + DFG       D +   
Sbjct: 145 EATACRLFAQLISGVSYMHSKGIVHRDLKLENLLLDKHENLIITDFGFVNEFYADNELMK 204

Query: 527 TFCGTPEYLAPELLLGQG--YSKVVDWWTLGVLLYEMLTGLPPYYD-------ENVPKMY 577
           T CG+P Y APEL++      ++  D W+ G++LY ML G  P+ D       E++ ++Y
Sbjct: 205 TSCGSPCYAAPELVITTEPYKARKADIWSCGIILYGMLAGYLPWDDDKQNPNGEDIVRLY 264

Query: 578 KKILQDPLVFPDGFDRDAKDLLIGLLSR-----DPQRRLGYNGADEIKNHPFFS 626
             I + PL FP    R      +G+  R     +P RR+    +  IK H + S
Sbjct: 265 HYITKTPLKFP----RIHYTTFLGICLRHILVSNPVRRM---SSRHIKKHEWLS 311

>CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces
           cerevisiae YBR274w CHK1 regulats inhibitory Cdk
           phosphorylation of PDS1, start by similarity
          Length = 528

 Score =  116 bits (291), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 90/285 (31%), Positives = 145/285 (50%), Gaps = 35/285 (12%)

Query: 367 IDDFDLLKVIGKGSFGKVMQVRKK-DTKKIYALKAIR---------KSYIVSKSEVTHTL 416
           I D +L   IG+GSFG V   R K D+  + A+K +              VS+  V H+ 
Sbjct: 11  IKDVELGGTIGEGSFGCVRSARLKFDSSVVVAVKFVHLPTCAESGLSQKDVSREVVLHSK 70

Query: 417 AER--TVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYA 474
             +   VL  IDC             E L+++L   +GG+LF  ++ +   D   ++FY 
Sbjct: 71  CSKHANVLRVIDCNV---------GGEYLWIMLEMADGGDLFDKIEPDVGVDPDVAQFYF 121

Query: 475 AELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFC----G 530
            +L+ AL+ LH + V +RD+KPENILLD +G++ L DFGL     + +D T        G
Sbjct: 122 QQLIRALNYLHDVGVAHRDIKPENILLDKKGNLKLADFGLAS-QFRRKDGTLRVSTDQRG 180

Query: 531 TPEYLAPELLLGQG-YSKVVDWWTLGVLLYEMLTG-----LPPYYDENVPKMYKKILQDP 584
           +P Y+APE+L  QG Y+ + D W+ GVLL+ +LTG     +P   D+N         +  
Sbjct: 181 SPPYMAPEILSSQGYYANITDIWSAGVLLFVLLTGEIPWSIPAKEDDNYEWFVNNEGKVS 240

Query: 585 LVFPDGFDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQLS 629
           L   +  +    +LL  +L  DP++R+     +++++HP+ +  S
Sbjct: 241 LGPWERVELRQMNLLRKILQPDPRKRVSL---EKLRHHPWLTSRS 282

>YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protein
           kinase involved in septin organization and cell cycle
           control [3114 bp, 1037 aa]
          Length = 1037

 Score =  117 bits (294), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 85/282 (30%), Positives = 141/282 (50%), Gaps = 18/282 (6%)

Query: 360 SRNKPLS-IDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLA- 417
           S  KP S I  + L + +G GS GKV   + + T    A+K I KS   +    ++  + 
Sbjct: 10  SAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSV 69

Query: 418 -------ERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRS 470
                  E  ++  +  P ++ L   +++   LYL+L     GELF  L   G      +
Sbjct: 70  LPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREA 129

Query: 471 RFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCG 530
                +++  +   H + +++RDLKPEN+LLD   +I + DFG+  L   D D  +T CG
Sbjct: 130 INCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQT-DADLLETSCG 188

Query: 531 TPEYLAPELLLGQGYSKVV-DWWTLGVLLYEMLTGLPPYYDE--NVPKMYKKILQDPLVF 587
           +P Y APE++ G  Y     D W+ GV+L+ +LTG  P+ +E  NV  +  K+ +     
Sbjct: 189 SPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEM 248

Query: 588 PDGFD--RDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQ 627
           P+  +  RDA+DL+  +L  DP++R+      +I +HP   +
Sbjct: 249 PNDTEISRDAQDLIGKILVVDPRQRIKIR---DILSHPLLKK 287

>ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -
           SH] complement(560761..563556) [2796 bp, 931 aa]
          Length = 931

 Score =  116 bits (290), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 82/266 (30%), Positives = 136/266 (51%), Gaps = 15/266 (5%)

Query: 360 SRNKPLSIDDFDLLKVIGKGSFGKVM----QVRKKDTKKIYALKAIRKSYIVSKSEVTHT 415
           S+ K ++   + +   +G+G FGKV     + R     +  A+K IR+  +   SE    
Sbjct: 35  SKKKQVTFGPYIIGPTLGEGEFGKVKLGWSKARLDGDSRNVAIKLIRRDTVPKNSEKEIK 94

Query: 416 L-AERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYA 474
           +  E   L  +  P IV L+   Q+ + + +VL   +GGE + ++Q++ R     +    
Sbjct: 95  IYRELNALKLLSHPNIVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRLKEPPACRLF 154

Query: 475 AELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEY 534
           A+L+  +  +H   + +RDLK EN+LLD   ++ + DFG      K+ D   T CG+P Y
Sbjct: 155 AQLISGVHYIHYKGLAHRDLKLENLLLDEHENLIITDFGFVNEFHKN-DLMRTSCGSPCY 213

Query: 535 LAPELLL-GQGYS-KVVDWWTLGVLLYEMLTGLPPYYD-------ENVPKMYKKILQDPL 585
            APEL++  + YS +  D W+ GV+LY ML G  P+ D       E++ K+Y+ I    L
Sbjct: 214 AAPELVVSSKPYSAQKADVWSCGVILYAMLAGYLPWDDDPENPEGEDIAKLYQYITHTSL 273

Query: 586 VFPDGFDRDAKDLLIGLLSRDPQRRL 611
            FP+      +DLL  +L  +P+ RL
Sbjct: 274 KFPEYIKPIPRDLLKRILVSNPEVRL 299

>ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH]
           complement(731433..736142) [4710 bp, 1569 aa]
          Length = 1569

 Score =  116 bits (290), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 101/155 (65%), Gaps = 1/155 (0%)

Query: 366 SIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVL-AR 424
           SI D+D++K I KG++G V    K+ T + +A+K +RKS +++K++VT+  +ER ++  +
Sbjct: 678 SIKDYDIIKPISKGAYGSVYLAYKRITGEYFAIKVLRKSDMIAKNQVTNVKSERVIMMVQ 737

Query: 425 IDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTL 484
            + P++  L  +FQ++E L+LV+  ++GG+L   ++  G      ++ Y  E++  +D +
Sbjct: 738 SEKPYVAKLYATFQNKENLFLVMEYLSGGDLATLIKMMGNLPDKWAKQYITEVIIGVDDM 797

Query: 485 HKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNM 519
           H   +I+ DLKP+N+L+D  GH+ L DFGL ++ +
Sbjct: 798 HMSGIIHHDLKPDNLLIDSNGHVKLTDFGLSRIGL 832

 Score =  114 bits (285), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 97/175 (55%), Gaps = 15/175 (8%)

Query: 521  DEDKTDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKI 580
            DED +  F GTP+YL+PE +LG G S   DWW++G +L+E L G PP++   V  ++K I
Sbjct: 994  DEDGSRRFFGTPDYLSPETILGTGESGASDWWSVGCILFEFLLGYPPFHASTVEDVFKNI 1053

Query: 581  LQDPLVFPDGFDR---------DAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQLSWK 631
            L   + +P   ++         +AKDL++ LL  +P+ RLG NGA EIK HP+F  ++W 
Sbjct: 1054 LSGQIDWPSFPNKETELEYLSPEAKDLILKLLESNPEERLGANGAQEIKEHPYFKGINWS 1113

Query: 632  RLLMKGYIPPYKPPVTSATDTSNFDQEFTREKPIDSVV-DEYLSESVQKQFGGWT 685
            ++  +     + P V +  DT  FD    R   +D ++ D Y  + +Q   G  T
Sbjct: 1114 KVYDEEA--SFVPTVDNPEDTDYFD---LRGADLDELLRDNYGEDDLQSTSGMHT 1163

>KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062
           Saccharomyces cerevisiae YPL141c, start by similarity
          Length = 909

 Score =  115 bits (289), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 77/264 (29%), Positives = 129/264 (48%), Gaps = 13/264 (4%)

Query: 361 RNKPLSIDDFDLLKVIGKGSFGKVM---QVRKKDTKKIYALKAIRKSYIVSKSEV-THTL 416
           R + ++   + +   +G+G FGKV         D  K  A+K IR+  I   SE      
Sbjct: 47  RRRQVTFGPYIIGPTLGEGEFGKVKLGWSKSNSDESKNVAIKLIRRDTIPKNSEKEVKIY 106

Query: 417 AERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAE 476
            E   L  +  P IV L+   Q+ + + +VL   +GGE + ++Q++ R     +    A+
Sbjct: 107 REINALKHLAHPNIVTLEEVLQNSKYIGIVLHYASGGEFYKYIQKKRRLKEPAACRLFAQ 166

Query: 477 LLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLA 536
           L+  +  +H   + +RDLK EN+LLD   ++ + DFG         D   T CG+P Y A
Sbjct: 167 LISGVHYMHHKGLAHRDLKLENLLLDEHENLIITDFGFVNEFSSRNDLMKTSCGSPCYAA 226

Query: 537 PELLL-GQGY-SKVVDWWTLGVLLYEMLTGL-------PPYYDENVPKMYKKILQDPLVF 587
           PEL++  + Y ++  D W+ GV+LY ML G             +++ K+Y  I +  L F
Sbjct: 227 PELVVTTKAYEARKADVWSCGVILYAMLAGYLPWDDDPDNPDGDDIAKLYNYITKTSLKF 286

Query: 588 PDGFDRDAKDLLIGLLSRDPQRRL 611
           P+  +   +D+L  +L  DP +R+
Sbjct: 287 PEYINPIPRDILRRILVSDPSKRI 310

>Scas_201.1*
          Length = 274

 Score =  109 bits (272), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 72/230 (31%), Positives = 124/230 (53%), Gaps = 10/230 (4%)

Query: 380 SFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLA-ERTVLARIDCPFIVPLKFSFQ 438
           +FG V Q R+  +++  A+K + K+ +         L  E ++L R+  P IV  K  F+
Sbjct: 45  TFGVVRQARQFFSQEAVAVKILLKNALKGNDVQLQMLYDELSILQRLHHPNIVAFKDWFE 104

Query: 439 SQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPEN 498
           S++K Y+V     GGELF  + ++G+F    +     +LL A+  +H  ++++RDLKPEN
Sbjct: 105 SRDKFYIVTQLATGGELFDRIIKKGKFTEVDAVNIMVQLLDAVKYIHSQNIVHRDLKPEN 164

Query: 499 IL-LD--YQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVDWWTLG 555
           +L LD   +  + + DFG+ K    ++D      G+  Y+APE+L  +G+ K  D W+LG
Sbjct: 165 VLYLDPSDESQLVIADFGIAKELKSNDDLIFKGAGSLGYVAPEVLTKEGHGKPCDIWSLG 224

Query: 556 VLLYEMLTGLPPYYDENVPKMYKKILQD--PLVFP----DGFDRDAKDLL 599
           V+ Y +L+G  P+  E+V    ++  +   P+ F     D    +AKD +
Sbjct: 225 VITYTLLSGYSPFIAESVEGFLEECTRSRYPVQFHKPYWDSISDEAKDFI 274

>YDR523C (SPS1) [1335] chr4 complement(1485554..1487026)
           Serine/threonine protein kinase involved in middle/late
           stage of meiosis [1473 bp, 490 aa]
          Length = 490

 Score =  113 bits (282), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 82/262 (31%), Positives = 128/262 (48%), Gaps = 22/262 (8%)

Query: 360 SRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAER 419
           SR  P  +  + +   IG+G+FG V +   + T++I A+K +   +  S  ++     E 
Sbjct: 10  SRTPPSKL--YSIQSCIGRGNFGDVYKAVDRVTQEIVAIKVVNLEH--SDEDIELLAQEI 65

Query: 420 TVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSR--FYAAEL 477
             LA +  P I     +      +++V+    GG     L+R     L   +  F   E+
Sbjct: 66  FFLAELKSPLITNYIATMLEDVSMWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEV 125

Query: 478 LCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAP 537
              L  LH+   I+RD+K  NILL+ +G + L DFG+   +++   K DTF GTP ++AP
Sbjct: 126 TLGLKYLHEQRKIHRDIKAANILLNEEGMVKLGDFGVSG-HIRSTLKRDTFVGTPYWMAP 184

Query: 538 ELLLGQ--GYSKVVDWWTLGVLLYEMLTGLPPY--YD-----ENVPKMYKKILQDPLVFP 588
           E++  +  GY++  D W+LG+  YE+L GLPP   YD      N+PK     LQ P    
Sbjct: 185 EVVCCEVDGYNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGP---- 240

Query: 589 DGFDRDAKDLLIGLLSRDPQRR 610
             F   AKD + G L + P  R
Sbjct: 241 --FSDAAKDFVAGCLVKTPADR 260

>YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine protein
           kinase, related to Kin2p and S. pombe KIN1 [3195 bp,
           1064 aa]
          Length = 1064

 Score =  114 bits (286), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 77/273 (28%), Positives = 133/273 (48%), Gaps = 30/273 (10%)

Query: 366 SIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIR---KSYIVSKSEVTHTLAERTVL 422
           S+ D++ ++ +G GS GKV   + + T ++ A+K +    K+++  +  +     E+ VL
Sbjct: 116 SLGDWEFVETVGAGSMGKVKLAKHRYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVL 175

Query: 423 AR-----------------------IDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHL 459
            R                       +  P I  L          Y++   ++GG+L  ++
Sbjct: 176 ERQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYI 235

Query: 460 QREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNM 519
            + G     ++R +A  +  AL  LH  ++++RDLK ENI++     I + DFGL   N+
Sbjct: 236 IQHGSIREHQARKFARGIASALIYLHANNIVHRDLKIENIMISDSSEIKIIDFGLS--NI 293

Query: 520 KDEDKT-DTFCGTPEYLAPELLLGQGYSK-VVDWWTLGVLLYEMLTGLPPYYDENVPKMY 577
            D  K   TFCG+  + APELL    Y+   VD W+ GV+L+ ++ G  P+ DEN   ++
Sbjct: 294 YDSRKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSVLH 353

Query: 578 KKILQDPLVFPDGFDRDAKDLLIGLLSRDPQRR 610
           +KI Q  + +P     +   LL  +L  DP+RR
Sbjct: 354 EKIKQGKVEYPQHLSIEVISLLSKMLVVDPKRR 386

>Scas_707.3
          Length = 1598

 Score =  114 bits (284), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 101/161 (62%), Gaps = 1/161 (0%)

Query: 360 SRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAER 419
           ++N   +I D+ +LK I KG++G V   RKK T   +A+K ++KS +++K++VT+  +ER
Sbjct: 689 TKNLTPTIKDYTILKPISKGAYGSVYLARKKITGDYFAIKVLKKSDMIAKNQVTNVKSER 748

Query: 420 TVL-ARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELL 478
            ++  + D P++  L  +FQ++E L+LV+  + GG+L   ++  G       + Y  E++
Sbjct: 749 AIMMVQSDKPYVARLFATFQNKENLFLVMEYLPGGDLATLIKMMGYLPDQWVKQYLTEII 808

Query: 479 CALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNM 519
             +D +H+  +I+ DLKP+N+L+D  GH+ L DFGL +  +
Sbjct: 809 VGVDDMHRNWIIHHDLKPDNLLIDNLGHVKLTDFGLSRAGL 849

 Score =  110 bits (275), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 95/170 (55%), Gaps = 17/170 (10%)

Query: 521  DEDKTDT-FCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKK 579
            D+ K D  F GTP+YLAPE + G G     DWW++G +++E+L G PP++      +++K
Sbjct: 997  DDSKQDKKFFGTPDYLAPETIEGTGEGDQCDWWSVGCIMFELLFGYPPFHTNTPEGVFRK 1056

Query: 580  ILQDPLVFPDGFDR----------DAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQLS 629
            IL   + +P  FD           +AKDL++ LL  DP +RLG NGADEIK HP+F  ++
Sbjct: 1057 ILSGKIEWPQ-FDSIEEEREILSPEAKDLIMKLLVVDPSKRLGANGADEIKQHPYFKDVN 1115

Query: 630  WKRLLMKGYIPPYKPPVTSATDTSNFDQEFTREKPIDSVVDEYLSESVQK 679
            W  +  +     + P V +  DT  FD   TR   +++  D+Y  + + K
Sbjct: 1116 WDHVYDEEA--SFVPTVENPEDTDYFD---TRGAVLENFGDDYEDKEIPK 1160

>Kwal_55.21545
          Length = 865

 Score =  113 bits (282), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 77/245 (31%), Positives = 122/245 (49%), Gaps = 7/245 (2%)

Query: 370 FDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARI-DCP 428
           F   +VIG+G FG V +     TK++ A+K +  +   +  EV     E   L+ +   P
Sbjct: 19  FKRTEVIGRGKFGVVYKGYYTKTKQVCAIKVL--NLDSADDEVEDVQKEIQFLSSLKQVP 76

Query: 429 FIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMD 488
            I     S+ +  KL++++    GG L   L R G+           ELL AL  +HK  
Sbjct: 77  NITHYYGSYLNDTKLWVIMEYCAGGSL-RTLLRPGKIGEQYIGVIMRELLTALMHIHKDG 135

Query: 489 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLL-GQGYSK 547
           VI+RD+K  N+L+   GHI LCDFG+     + + +  T  GTP ++APE+++ G  Y  
Sbjct: 136 VIHRDIKAANVLITNDGHIKLCDFGVAAQLSQTKIRRQTMAGTPYWMAPEVIMEGVYYDT 195

Query: 548 VVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDA--KDLLIGLLSR 605
            VD W+LG+  YE+ TG PPY +    +  + I +      +G    +  K+++   L  
Sbjct: 196 KVDIWSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPRLEGRQHSSALKEIIALCLDE 255

Query: 606 DPQRR 610
           DP+ R
Sbjct: 256 DPKER 260

>KLLA0E21780g complement(1936438..1939488) similar to sp|P38692
           Saccharomyces cerevisiae YHR102w NRK1 ser/thr protein
           kinase that interacts with CDC31P, start by similarity
          Length = 1016

 Score =  112 bits (281), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 74/245 (30%), Positives = 121/245 (49%), Gaps = 7/245 (2%)

Query: 370 FDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARI-DCP 428
           F   ++IG+G FG V +     T+++YA+K +      ++ EV     E   L+ +   P
Sbjct: 16  FKRKEIIGRGKFGVVYKAFHVKTQQVYAIKVLNLDN--TEDEVEDIRKEIQFLSSLKQTP 73

Query: 429 FIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMD 488
            I     S+    KL++++    GG L   L R G  +         E+L AL ++H+ +
Sbjct: 74  NITHYYGSYLIDTKLWVIMEYCAGGSLRT-LLRPGIIEEKYIGVIMREILVALISIHRDN 132

Query: 489 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLL-GQGYSK 547
           VI+RD+K  NIL+   G + LCDFG+     +   K  T  GTP ++APE+++ G  Y  
Sbjct: 133 VIHRDIKAANILIANNGSVKLCDFGVAAQLSQSMLKRQTMAGTPYWMAPEVIMEGVYYDT 192

Query: 548 VVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQD--PLVFPDGFDRDAKDLLIGLLSR 605
            VD W+LG+  YE+ TG PPY      +  + I +   P +    + +  K+ +   L  
Sbjct: 193 KVDIWSLGITAYEIATGNPPYCHMEAIRAMQMITKSKPPRLEGREYSQPLKEFIALCLDE 252

Query: 606 DPQRR 610
           DP+ R
Sbjct: 253 DPKER 257

>Scas_713.7
          Length = 983

 Score =  112 bits (280), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 79/269 (29%), Positives = 135/269 (50%), Gaps = 15/269 (5%)

Query: 359 PSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAE 418
           P++NK +    + L +VIGKGS+G V +   K T +I A+K +      +  E+   + E
Sbjct: 18  PNKNKSVQ---YQLKQVIGKGSYGVVYKAVNKKTLQIVAIKEVNYD---NDDELIEIMTE 71

Query: 419 RTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQ--REGRFDLSRSRFYAAE 476
             +L  ++   IV      Q    LY++L   + G L   L   ++G  +L  ++ Y  +
Sbjct: 72  IDLLKNLNHVNIVKYHGFIQKSSNLYIILEFCSKGSLKNLLTGYKDGIPELD-AKVYIRQ 130

Query: 477 LLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLA 536
            L  L  LH+  VI+RD+K  N+LLD    + L DFG+   + K  +   T  G+  +++
Sbjct: 131 TLNGLVYLHEQGVIHRDIKAANLLLDSNDVVKLADFGV---STKVSNTAMTLAGSLHWMS 187

Query: 537 PELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAK 596
           PE++  +G S + D W+LG  + E++TG PP+Y      +Y  I  DP + P+    +AK
Sbjct: 188 PEIIGNRGASTLSDIWSLGATVVELVTGNPPFYKLVDVNIYYAIENDPFIPPEFLSNEAK 247

Query: 597 DLLIGLLSRDPQRRLGYNGADEIKNHPFF 625
           D L     ++  +R     A ++  HP+ 
Sbjct: 248 DFLKKCFQKNMYKR---PTAKKLLKHPWL 273

>Kwal_26.7355
          Length = 1446

 Score =  112 bits (281), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 88/281 (31%), Positives = 141/281 (50%), Gaps = 20/281 (7%)

Query: 360  SRNKPLSIDDFDLLK--VIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTL- 416
            S+N      +F  +K  +IGKGSFG V       T ++ A+K +      S+ E T ++ 
Sbjct: 1134 SKNSNGEYKEFAWIKGEMIGKGSFGSVFLGLNVTTGEMIAVKQVEVPRYGSQDETTLSVL 1193

Query: 417  ----AERTVLARIDCPFIVPLKFSFQSQEKLY-LVLACINGGELFYHLQREGRFDLSRSR 471
                +E   L  +D   IV     F+++  +Y L L  + GG +   ++  G+FD +  R
Sbjct: 1194 EALRSEVATLKDLDHTNIVQY-LGFENKNYVYSLFLEYVAGGSVGSLIRLYGKFDENLIR 1252

Query: 472  FYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTD-TFCG 530
            F A ++L  L  LH   +++RD+K +N+LLD  G   + DFG+ K +      +D T  G
Sbjct: 1253 FLAVQVLRGLSYLHSKKILHRDMKADNLLLDVDGICKISDFGISKKSNNIYSNSDMTMRG 1312

Query: 531  TPEYLAPELL-LGQGYSKVVDWWTLGVLLYEMLTGLPPYYD-ENVPKMYK--KILQDPLV 586
            T  ++APE++   QGYS  VD W+LG ++ EM  G  P+ + E V  M+K  K    P +
Sbjct: 1313 TVFWMAPEMVDTKQGYSAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKFKSAPPI 1372

Query: 587  FPDG---FDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPF 624
              D       + K+ L      +P++R     ADE+ +HPF
Sbjct: 1373 PEDTQKIISAEGKEFLDACFEINPEKRP---TADELLSHPF 1410

>CAGL0C05005g complement(467626..470856) similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15, hypothetical
           start
          Length = 1076

 Score =  112 bits (280), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 70/241 (29%), Positives = 118/241 (48%), Gaps = 6/241 (2%)

Query: 370 FDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPF 429
           + L ++IG+GS+G V +   K T +  A+K +         E+   ++E  +L  ++   
Sbjct: 22  YQLRQIIGRGSYGVVYKATNKKTAQEVAIKEVNYQ---DDDELVDIMSEIDLLKNLNHIN 78

Query: 430 IVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDV 489
           IV      Q Q  LY++L     G L   + R        ++ Y  + L  L+ LH+  V
Sbjct: 79  IVKYHGFIQKQHNLYIILEYCAKGSLKNLISRNRPMSEHEAKPYVRQTLNGLNYLHEQGV 138

Query: 490 IYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVV 549
           I+RD+K  NILLD +  + L DFG   ++ K  +   T  G+  ++APE++  +G S + 
Sbjct: 139 IHRDIKAANILLDSENVVKLADFG---VSTKVNNTAMTLAGSLNWMAPEIIGNRGASTLS 195

Query: 550 DWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLLIGLLSRDPQR 609
           D W+LG  + E+LTG PP+++     +Y  I  D    P      AKD L    +++  +
Sbjct: 196 DIWSLGATVVELLTGNPPFHNLIDMNIYYAIENDSYFPPSSLSSGAKDFLQQCFAKNMYK 255

Query: 610 R 610
           R
Sbjct: 256 R 256

>Kwal_14.1159
          Length = 1521

 Score =  111 bits (278), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 49/155 (31%), Positives = 103/155 (66%), Gaps = 1/155 (0%)

Query: 366 SIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVL-AR 424
           SI D+D++K I KG++G V   +++ T + +A+K ++KS +++K++VT+  +ER ++  +
Sbjct: 673 SIKDYDVIKPISKGAYGSVFLAKRRITGEYFAIKVLKKSDMIAKNQVTNVKSERAIMMVQ 732

Query: 425 IDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTL 484
            + P++  L  +FQ++  L+LV+  ++GG+L   ++  G       + Y +E++  ++ +
Sbjct: 733 SNKPYVAKLYATFQNRGNLFLVMEYLSGGDLGTLIKMMGSLPDQWVKQYISEVIYGVEDM 792

Query: 485 HKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNM 519
           H+  +I+ DLKP+N+L+D +GH+ L DFGL ++ +
Sbjct: 793 HQSGIIHHDLKPDNLLIDQRGHLKLTDFGLSRMGL 827

 Score = 99.8 bits (247), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 73/122 (59%), Gaps = 9/122 (7%)

Query: 521  DEDKTDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKI 580
            ++ K   F GTP+YLAPE + G G +   DWW++G +L+E + G PP++   V +++  I
Sbjct: 951  EDSKNKKFFGTPDYLAPETIEGTGETDSSDWWSVGCMLFEFVFGYPPFHASTVEEVFSNI 1010

Query: 581  LQ---DPLVFPD-GFDR-----DAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQLSWK 631
            L    D   FPD   +R     +A+DL+  LL  DP +RLG NGA+EI  HP+F  + W+
Sbjct: 1011 LAGNIDWPAFPDEATEREYISPEARDLIEKLLVVDPDKRLGANGAEEIFEHPYFQDVDWE 1070

Query: 632  RL 633
             L
Sbjct: 1071 NL 1072

>Scas_573.10
          Length = 569

 Score =  110 bits (274), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 87/314 (27%), Positives = 138/314 (43%), Gaps = 70/314 (22%)

Query: 365 LSIDDFDLLKVIGKGSFGKVMQVRKK---------DTKKIYALKAIRKSYIVS---KSEV 412
           + +  + L++ +G+G+F KV +   +         +  K  A+K I+K+ +V    K+++
Sbjct: 114 VELQGYTLIEKVGEGAFSKVFRAVPQRNGPTSFLCENYKEVAIKIIKKTALVGDDPKADI 173

Query: 413 ----------THTLAERTVLARID--------CPFIVPLKFSFQSQEKLYLVLACINGGE 454
                     + T ++  VL  +         CP IV      +S+   Y+V   I+GGE
Sbjct: 174 HVAESHNRKHSKTSSKEQVLKEVSLHKAVSSGCPQIVQFIDFQESKTYYYIVQELIHGGE 233

Query: 455 LFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLD------------ 502
           +F  + +   F    SR    +L  A+  LH + V++RD+KPEN+L +            
Sbjct: 234 IFGEIVKYTYFSEDLSRHVIKQLALAVQHLHSLGVVHRDIKPENLLFEPIEFIPSKEPKL 293

Query: 503 ----------------------YQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELL 540
                                   G + L DFGL K       KT   CGT  Y APE++
Sbjct: 294 RKSDDPSTKSDEGLFVPGVGGGGIGVVKLADFGLSKQIFATNTKTP--CGTVGYTAPEVV 351

Query: 541 LGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFP----DGFDRDAK 596
             + YS  VD W +G +LY ML G PP+YDE +  + +KI +    F     D     AK
Sbjct: 352 KDEHYSMKVDMWGVGCVLYTMLCGFPPFYDEKIDVLTEKISRGEYTFLRPWWDEISAGAK 411

Query: 597 DLLIGLLSRDPQRR 610
           + +I LL  DP +R
Sbjct: 412 NAVIRLLEVDPNKR 425

>Scas_711.25
          Length = 1515

 Score =  111 bits (277), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 89/286 (31%), Positives = 138/286 (48%), Gaps = 20/286 (6%)

Query: 355  VDYKPSRNKPLSIDDFDLLK--VIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSE- 411
            V    SRN      +F  +K  +IGKGSFG V       T ++ A+K +      S+ E 
Sbjct: 1197 VSINKSRNSKGEYKEFAWMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQDEA 1256

Query: 412  ----VTHTLAERTVLARIDCPFIVPLKFSFQSQEKLY-LVLACINGGELFYHLQREGRFD 466
                V    +E + L  +D   IV     F++++ +Y L L  + GG +   ++  GRFD
Sbjct: 1257 IISTVEALRSEVSTLKDLDHLNIVQY-LGFENKDNIYSLFLEYVAGGSVGSLIRMYGRFD 1315

Query: 467  LSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTD 526
                R    ++L  L  LH   +++RD+K +N+LLD  G   + DFG+ + +      +D
Sbjct: 1316 EPLIRHLNTQVLRGLAYLHSRGILHRDMKADNLLLDQDGVCKISDFGISRKSKDIYSNSD 1375

Query: 527  -TFCGTPEYLAPELL-LGQGYSKVVDWWTLGVLLYEMLTGLPPYYD-ENVPKMYK--KIL 581
             T  GT  ++APE++   QGYS  VD W+LG ++ EM  G  P+ + E V  M+K  K  
Sbjct: 1376 MTMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCIVLEMFAGKRPWSNYEVVAAMFKIGKSK 1435

Query: 582  QDPLVFPDGF---DRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPF 624
              P + PD      ++ +D L      DP  R     AD + +HPF
Sbjct: 1436 SAPPIPPDTLPLISQNGRDFLDACFEIDPDNRP---TADNLLSHPF 1478

>Kwal_56.23717
          Length = 858

 Score =  110 bits (275), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 74/236 (31%), Positives = 120/236 (50%), Gaps = 22/236 (9%)

Query: 443 LYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLD 502
            Y++   ++GG+L  ++ + G      +R +A  +  AL  LH  ++++RDLK ENI++ 
Sbjct: 8   FYMLFEYVSGGQLLDYIIQHGSLRERSARKFARGIASALQYLHMNNIVHRDLKIENIMIS 67

Query: 503 YQGHIALCDFGLCKLNMKDEDKT-DTFCGTPEYLAPELLLGQGYS-KVVDWWTLGVLLYE 560
             G I + DFGL   NM +  K   TFCG+  + APELL    Y+   VD W+ GV+L+ 
Sbjct: 68  TSGEIKIIDFGLS--NMYNPKKQLHTFCGSLYFAAPELLKACPYTGPEVDVWSFGVVLFV 125

Query: 561 MLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLLIGLLSRDPQRRLGYNGADEIK 620
           ++ G  P+ DEN   +++KI Q  + +P     +   LL  +L  DP +R       ++ 
Sbjct: 126 LVCGKVPFDDENSSVLHEKIKQGKVEYPQHLSIEVISLLSKMLVVDPTKRASLK---QVV 182

Query: 621 NHPFFSQLSWKRLLMKGY---IPPYKP---PVTSATDTSNFDQEFTREKPIDSVVD 670
           NH       W   + +GY    P Y P   P+T+    +   +E  R + ID VV+
Sbjct: 183 NH------QW---MQRGYDFPAPSYIPHRVPLTADALDATVIKEMYRLEFIDDVVE 229

>CAGL0L06006g complement(670707..673535) similar to sp|P53104
           Saccharomyces cerevisiae YGL180w APG1 essential for
           autophagocytosis, hypothetical start
          Length = 942

 Score =  110 bits (275), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 81/290 (27%), Positives = 141/290 (48%), Gaps = 51/290 (17%)

Query: 374 KVIGKGSFGKVMQVR-KKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPFIVP 432
           K IGKGSF  V +     D K   A+KA+ +S + +K  + +   E  +L +I  P IV 
Sbjct: 15  KEIGKGSFATVYRGHVTTDPKSHIAVKAVARSKLKNKKLLENLEIEIAILKKIKHPHIVG 74

Query: 433 LKFSFQSQEKLYLVLACINGGELFYHLQREGRFD----------------------LSRS 470
           L    ++    YLV+     G+L + +++    +                      L+R+
Sbjct: 75  LIDCERTTTDFYLVMDYCALGDLTFLIKKRKELENNHPLLQTVFNKYPPPSKEHNGLNRA 134

Query: 471 RF--YAAELLCALDTLHKMDVIYRDLKPENILL-----DYQ--------GHIAL------ 509
               Y  +L  AL  L   ++++RD+KP+N+LL     +Y+        G++ +      
Sbjct: 135 FVVCYLQQLASALKFLRSKNLVHRDIKPQNLLLATPLTNYRDSKTFHELGYVGIYNLPIL 194

Query: 510 --CDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPP 567
              DFG  +  +      +T CG+P Y+APE+L  Q Y+   D W++G +L+EM  G+PP
Sbjct: 195 KIADFGFARF-LPSTSLAETLCGSPLYMAPEILNYQKYNAKADLWSVGTVLFEMCCGVPP 253

Query: 568 YYDENVPKMYKKI--LQDPLVFPDGFDRD--AKDLLIGLLSRDPQRRLGY 613
           +   N  +++KKI    D + FP+  + +   K+L+  LL+ DP +R+G+
Sbjct: 254 FTASNHLELFKKIKRAHDEINFPEVCEVEDGLKELICSLLTFDPAKRIGF 303

>KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 483

 Score =  108 bits (269), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 95/345 (27%), Positives = 147/345 (42%), Gaps = 40/345 (11%)

Query: 365 LSIDDFDLLKVIGKGSFGKVMQVR----------KKDTKKI-YALKAIRKSYIVSKSEVT 413
           LS+  F LL+ +GKG+FG V               K  K +  A+K I   +  S   + 
Sbjct: 2   LSLQQFQLLECVGKGNFGDVYLAHYLGSNQEPTDPKIPKNVPLAIKCINLEH--SNEPID 59

Query: 414 HTLAERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFY 473
             L E   L+ + CP+I     +F     LY+V+   + G L   L+   R     + F 
Sbjct: 60  LLLKEIYFLSTLHCPYITHYYGTFTGDCNLYIVMEYCSNGSLLNLLRYYSRLTEQTTCFI 119

Query: 474 AAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLC---KLNMKDE--DKTDTF 528
             ++  AL+ LH+  +I+RDLK  NILL+  G + L D G+    K N         +TF
Sbjct: 120 ILQVCHALEYLHEKRLIHRDLKAANILLNDDGEVRLADLGVTGQLKFNSTRHGGKNLNTF 179

Query: 529 CGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFP 588
            GTP ++APE++  Q Y    D W+LG+   E+L G PP    ++  M K +++ P +  
Sbjct: 180 VGTPFWMAPEIIKNQSYDGKCDIWSLGITTLELLNGKPPM--SHLDSM-KALMRIPKLNA 236

Query: 589 DGFDRD------AKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQLSWKRLLMKGYIPPY 642
           D   R+       KD +   L +DP +R            P   QL   + L K  I   
Sbjct: 237 DSILRNMDISPLGKDFIRSCLQQDPNQR------------PTCKQLLQHKWLKKCSITNI 284

Query: 643 KPPVTSATDTSNFDQEFTRE-KPIDSVVDEYLSESVQKQFGGWTY 686
              +T         +E  R  KP   + D+    ++  Q   W +
Sbjct: 285 MEEITVMKTNQILSKEKPRSCKPRFPLSDKVYKTNLPNQLESWRF 329

>YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine
           protein kinase with similarity to Cmk1p, Cmk2p, and
           Cmk3p [1539 bp, 512 aa]
          Length = 512

 Score =  108 bits (269), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 86/308 (27%), Positives = 141/308 (45%), Gaps = 54/308 (17%)

Query: 352 NISVDYKPSRNK---PLSIDDFDLLKVIGKGSFGKVMQVR--KKDTKKIYALKAIRKSYI 406
           N S DY  S ++    L + ++ LL  IG+G+F +V +      D +   A+KAI K  I
Sbjct: 100 NKSTDYSSSNHQYPEQLELHNYKLLNKIGEGAFSRVFKAVGINTDDQAPVAIKAIIKKGI 159

Query: 407 VS--------------KSEVTHTLAERTVLARID--CPFIVPLKFSFQSQEKLYLVLACI 450
            S              + +V + +A   ++++ +  C   +  +   +S    YLV   +
Sbjct: 160 SSDAILKGNDRIQGSSRKKVLNEVAIHKLVSKNNPHCTKFIAFQ---ESANYYYLVTELV 216

Query: 451 NGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILL--------- 501
            GGE+F  + +   F    +R    ++  A+  +H M +++RD+KPEN+L          
Sbjct: 217 TGGEIFDRIVQLTCFSEDLARHVITQVAIAIKHMHYMGIVHRDVKPENLLFEPIPFYGLD 276

Query: 502 -DYQGH--------------IALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYS 546
            D Q                + L DFGL K    +  KT   CGT EY+A E+   + YS
Sbjct: 277 GDMQKEDEFTLGVGGGGIGLVKLMDFGLAKKLRNNTAKTP--CGTIEYVASEVFTSKRYS 334

Query: 547 KVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFP----DGFDRDAKDLLIGL 602
             VD W++G +L+ +L G PP+Y++N   + KKI +    F     D     AK+ +  L
Sbjct: 335 MKVDMWSIGCVLFTLLCGYPPFYEKNEKTLLKKISRGDYEFLAPWWDNISSGAKNAVTHL 394

Query: 603 LSRDPQRR 610
           L  DP +R
Sbjct: 395 LEVDPNKR 402

>ACL054W [995] [Homologous to ScYGL180W (APG1) - SH]
           complement(269703..272621) [2919 bp, 972 aa]
          Length = 972

 Score =  109 bits (273), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 86/306 (28%), Positives = 146/306 (47%), Gaps = 53/306 (17%)

Query: 360 SRNKPLSI--DDFDLLKVIGKGSFGKVMQVRKKDTKK-IYALKAIRKSYIVSKSEVTHTL 416
           S  +P++I  + + + K IG+GSF  V +    D+     A+KA+ +S + +K  + +  
Sbjct: 6   SGGRPVAIVAERYVVEKEIGRGSFAVVYKGHLADSSAGNVAIKAVSRSKLRNKKLLENLE 65

Query: 417 AERTVLARIDCPFIVPLKFSFQSQEKLYLVLA-CINGGELFYHLQREGRFD---LSRSRF 472
            E  +L +I  P IV L    ++    YL++  C  G   F+  +R    D   L R+ F
Sbjct: 66  IEIAILKKIKHPHIVGLLECERTGTDFYLMMEYCALGDLTFFIKKRRSLMDKHPLVRTLF 125

Query: 473 --------------------YAAELLCALDTLHKMDVIYRDLKPENILL-----DY---- 503
                               Y  +L  AL  L   ++++RD+KP+N+LL     DY    
Sbjct: 126 EKYPPPSEHHNGLNRVLVVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLSTPLVDYNDPA 185

Query: 504 ----QGHIAL--------CDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVDW 551
               +G + +         DFG  +  + +    +T CG+P Y+APE+L  Q Y+   D 
Sbjct: 186 EFHARGFVGIYNLPILKIADFGFARF-LPNTSLAETLCGSPLYMAPEILNYQKYNAKADL 244

Query: 552 WTLGVLLYEMLTGLPPYYDENVPKMYKKI--LQDPLVFPD--GFDRDAKDLLIGLLSRDP 607
           W++G +LYEM  G PP+   N  ++++KI    D + FP     +    DL+ GLL+ +P
Sbjct: 245 WSVGTVLYEMCCGKPPFKASNHLELFQKIKKANDVIQFPKHAALESAMVDLICGLLTFEP 304

Query: 608 QRRLGY 613
            +R+G+
Sbjct: 305 AKRMGF 310

>Kwal_0.155
          Length = 587

 Score =  108 bits (270), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 85/302 (28%), Positives = 132/302 (43%), Gaps = 58/302 (19%)

Query: 365 LSIDDFDLLKVIGKGSFGKVMQ-VRKKDTKKIY--------ALKAIRKSYIVS-----KS 410
           L + D+ L+  IG+G+F KV + V ++ + K +        A+K I K ++ S     KS
Sbjct: 152 LELQDYKLIAKIGEGAFSKVYRGVPQEHSSKSFLSRAFKQVAVKVISKKHLSSTHKDAKS 211

Query: 411 EVT---HTLAERTVLARIDCPFIVPLKFSFQSQEKLYLVL-ACINGGELFYHLQREGRFD 466
           + T     L E  +   +     V     FQ     Y ++   + GGE+F  + R   F 
Sbjct: 212 KATSREQVLKEVAIHRTVSASENVVSFVDFQESHNYYFIVQELLAGGEIFGEIVRLTYFS 271

Query: 467 LSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGH-------------------- 506
              SR    +L  A+  +H M +++RD+KPEN+L ++  +                    
Sbjct: 272 EDLSRHVIRQLALAVKHMHAMGIVHRDIKPENLLFEHVDYEPSPSPVLRKSDDPKAKQDE 331

Query: 507 --------------IALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVDWW 552
                         + L DFGL K       KT   CGT  Y APE++  + YS  VD W
Sbjct: 332 GIFRPGIGGGGIGTVKLADFGLSKQIYSTNTKTP--CGTVGYTAPEVVKDERYSMQVDMW 389

Query: 553 TLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFP----DGFDRDAKDLLIGLLSRDPQ 608
            +G +LY +L G PP+YDE +  + +KI +    F     D     AK+ +  LL  DP 
Sbjct: 390 GIGCVLYTVLCGFPPFYDEKIDVLTEKISRGEFTFLRPWWDEISDGAKNAVRRLLEVDPS 449

Query: 609 RR 610
           +R
Sbjct: 450 KR 451

>KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces
           cerevisiae YGL180w APG1 essential for autophagocytosis,
           start by similarity
          Length = 831

 Score =  108 bits (270), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 82/299 (27%), Positives = 144/299 (48%), Gaps = 52/299 (17%)

Query: 365 LSIDDFDLLKVIGKGSFGKVMQ-VRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLA 423
           L  +++ + K IGKGSF  V + +  +D + I A+KA+ +S + +K  + +   E  +L 
Sbjct: 16  LPTENYSVEKEIGKGSFAVVYKGLSLRDGRNI-AIKAVSRSKLKNKKLLENLEVEIAILK 74

Query: 424 RIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREG----RFDLSRSRF------- 472
           +I  P IV L    ++    YL++     G+L + +++      +  L ++ F       
Sbjct: 75  KIKHPHIVGLIDCERTSSDFYLIMEYCALGDLTFFIKKRKNLVLKHPLIKTVFEHYPPPS 134

Query: 473 -------------YAAELLCALDTLHKMDVIYRDLKPENILL-----DYQ--------GH 506
                        Y  +L  AL  L   ++++RD+KP+N+LL     DY         G 
Sbjct: 135 TEHNGLNRVLVVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLCTPLLDYNDPKTFHELGF 194

Query: 507 IAL--------CDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLL 558
           + +         DFG  +  + +    +T CG+P Y+APE+L  Q Y+   D W++G +L
Sbjct: 195 VGIYNLPILKIADFGFARF-LPNTSLAETLCGSPLYMAPEILNYQKYNAKADLWSVGTVL 253

Query: 559 YEMLTGLPPYYDENVPKMYKKI--LQDPLVFPDGFDRDAK--DLLIGLLSRDPQRRLGY 613
           YEM  G PP+   N  ++++KI    D +  P     + K  +L+ GLL+ DP  R+G+
Sbjct: 254 YEMCCGRPPFKASNHLELFQKIKKANDEITVPSNCYIEPKLFNLIRGLLTFDPDSRMGF 312

>KLLA0F09031g 839103..841004 similar to sp|P43565 Saccharomyces
           cerevisiae YFL033c RIM15 protein kinase involved in
           expression of meiotic genes, hypothetical start
          Length = 633

 Score =  107 bits (268), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 85/149 (57%), Gaps = 11/149 (7%)

Query: 517 LNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKM 576
           L++ + +++  F GTP+YLAPE + G G S   DWW++G + +E L G PP++   V ++
Sbjct: 52  LSLFNPNESKNFFGTPDYLAPETIKGTGESDTCDWWSVGCIFFEFLFGYPPFHGTTVDEV 111

Query: 577 YKKILQDPLVFPDGFDR---------DAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQ 627
           ++ I+   + +P+  D          DAKDL+I LL  DP +RLG +G+ EIK HP+F  
Sbjct: 112 FENIIGGVIRWPEFPDAETEMEYISPDAKDLVIKLLVLDPNKRLGASGSQEIKEHPYFKD 171

Query: 628 LSWKRLLMKGYIPPYKPPVTSATDTSNFD 656
           + W  +  +   P + P V    DT  FD
Sbjct: 172 VDWDHVYDEQ--PSFVPRVEHPEDTEYFD 198

>AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH]
           (1044971..1047679) [2709 bp, 902 aa]
          Length = 902

 Score =  108 bits (269), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 72/246 (29%), Positives = 121/246 (49%), Gaps = 9/246 (3%)

Query: 355 VDYKPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTH 414
           V+  P++        + L +VIGKG++G V +   + T ++ A+KAI         E   
Sbjct: 4   VNVTPAQRHTGQRKHYALKQVIGKGAYGVVYKAVNRATDQVIAIKAIEYENEEELHEHML 63

Query: 415 TLAERTVLARIDCPFIVPLKFSFQSQEKLYLVLA-CINGGELFYHLQREGRFDLSRSRFY 473
            +    +L  +    IV      QS  +LY++L  CI G      L ++     ++++ Y
Sbjct: 64  EI---DLLKNLKHENIVKYHGFIQSSHELYILLEYCIRGS--LRDLIKKEALSEAKAKTY 118

Query: 474 AAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPE 533
             + L  L  LH   VI+RD+K  N+LL   G + L DFG+   + +  +   T+ G+P 
Sbjct: 119 VRQTLRGLQYLHDQGVIHRDIKAANLLLTENGVVKLADFGV---STRVNNMAMTYAGSPN 175

Query: 534 YLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDR 593
           ++APE++LG+G S V D W+LG  + E+LTG PP+Y+         I+ D    P+    
Sbjct: 176 WMAPEVMLGKGASTVSDIWSLGATVVELLTGNPPFYNLVNEAACYAIVNDVYYPPEHLSA 235

Query: 594 DAKDLL 599
           + K  +
Sbjct: 236 ECKAFM 241

>YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine
           protein kinase involved in induction of autophagy after
           nutrient limitation [2694 bp, 897 aa]
          Length = 897

 Score =  108 bits (269), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 83/310 (26%), Positives = 142/310 (45%), Gaps = 53/310 (17%)

Query: 356 DYKPSRNKPL--SIDDFDLLKVIGKGSFGKVMQVR-KKDTKKIYALKAIRKSYIVSKSEV 412
           D+  S N  L  S  ++   K IGKGSF  V +     D  +  A+K + ++ + +K  +
Sbjct: 8   DHTTSVNHNLMASAGNYTAEKEIGKGSFATVYRGHLTSDKSQHVAIKEVSRAKLKNKKLL 67

Query: 413 THTLAERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRF----DLS 468
            +   E  +L +I  P IV L    ++    YL++     G+L + L+R         L 
Sbjct: 68  ENLEIEIAILKKIKHPHIVGLIDCERTSTDFYLIMEYCALGDLTFLLKRRKELMENHPLL 127

Query: 469 RSRF--------------------YAAELLCALDTLHKMDVIYRDLKPENILLD-----Y 503
           R+ F                    Y  +L  AL  L   ++++RD+KP+N+LL      Y
Sbjct: 128 RTVFEKYPPPSENHNGLHRAFVLSYLQQLASALKFLRSKNLVHRDIKPQNLLLSTPLIGY 187

Query: 504 QGH----------------IALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSK 547
                              + + DFG  +  + +    +T CG+P Y+APE+L  Q Y+ 
Sbjct: 188 HDSKSFHELGFVGIYNLPILKIADFGFARF-LPNTSLAETLCGSPLYMAPEILNYQKYNA 246

Query: 548 VVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKI--LQDPLVFPD--GFDRDAKDLLIGLL 603
             D W++G +++EM  G PP+   N  +++KKI    D + FP     + + K+L+  LL
Sbjct: 247 KADLWSVGTVVFEMCCGTPPFRASNHLELFKKIKRANDVITFPSYCNIEPELKELICSLL 306

Query: 604 SRDPQRRLGY 613
           + DP +R+G+
Sbjct: 307 TFDPAQRIGF 316

>CAGL0L05632g 610481..612514 similar to sp|P08018 Saccharomyces
           cerevisiae YJL128c PBS2, hypothetical start
          Length = 677

 Score =  107 bits (268), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 87/321 (27%), Positives = 155/321 (48%), Gaps = 29/321 (9%)

Query: 341 WVELRDG----LGKINIS---VDYKPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTK 393
           +V+++ G     GK+++S   +D+    +  +++D+   ++ +G G++G V +V  K   
Sbjct: 333 YVDIKSGSLNFAGKLSLSSRGIDFSNGSSSRITLDELQFIEELGHGNYGTVSKVLHKPNN 392

Query: 394 KIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGG 453
            + A+K +R    + +S+    L E  VL + + PFIV    +F  +  +Y+ +  ++GG
Sbjct: 393 VLMAMKEVR--LELDESKFRQILMELEVLHKCNSPFIVDFYGAFFIEGAVYMCMEYMDGG 450

Query: 454 EL--FYHLQRE-GRFDLSRSRFYAAELLCALDTLHKM-DVIYRDLKPENILLDY-QGHIA 508
            L   Y    E G  D  +  F    ++  L  L ++ +VI+RD+KP NIL    QG + 
Sbjct: 451 SLDKIYDENPEMGGIDEPQLAFITNAVIQGLRELKEVHNVIHRDVKPTNILCSAKQGTVK 510

Query: 509 LCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLG-----QGYSKVVDWWTLGVLLYEMLT 563
           LCDFG+    +    KT+  C +  Y+APE +         Y+   D W+LG+ + EM  
Sbjct: 511 LCDFGVSGNLVASLAKTNIGCQS--YMAPERIKSLNPDRGTYTVQSDIWSLGLSILEMAL 568

Query: 564 GLPPYYDENVPKMYKKILQ-----DPLVFPDGFDRDAKDLLIGLLSRDPQRRLGYNGADE 618
           G  PY  E    ++ ++        P +  D F  +A+D +   L + P RR  Y+   E
Sbjct: 569 GRYPYPPETFDNIFSQLSAIVDGPPPKLPADKFSDEAQDFVSLCLQKIPDRRPNYSNLYE 628

Query: 619 IKNHPFFSQLSWKRLLMKGYI 639
              HP+ ++     + M  YI
Sbjct: 629 ---HPWLAKYRSIDVQMGPYI 646

>KLLA0C04191g 384198..386591 weakly similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15 protein kinase of
           the MAP kinase kinase kinase family, hypothetical start
          Length = 797

 Score =  108 bits (269), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 74/259 (28%), Positives = 127/259 (49%), Gaps = 10/259 (3%)

Query: 370 FDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPF 429
           + L +VIG+G++G V +  K+ T K  A+K I       +SE+   + E  +L  +    
Sbjct: 10  YALKQVIGRGAYGVVYRAVKRGTNKPCAIKQIE---FEDESELNEHMLEIDLLKNLRHQN 66

Query: 430 IVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDV 489
           IV  +   Q   +LY++L     G L   + + G      +  Y  + L  L  LH+  V
Sbjct: 67  IVEYRGFIQKAHELYIILEYCARGSL-RDILKHGPLLEDDTVNYVTQTLYGLQYLHEQGV 125

Query: 490 IYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVV 549
           I+RD+K  N+LL  +G + L DFG+   + +      T+ G+P ++APE++ GQG S V 
Sbjct: 126 IHRDIKAANLLLTEEGIVKLADFGV---STRINRMAMTYAGSPNWMAPEVMTGQGASTVS 182

Query: 550 DWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLLIGLLSRDPQR 609
           D W+LG  + E+LTG PP+++         I+ +  + P     + KD L     ++  +
Sbjct: 183 DIWSLGATVVELLTGNPPFHNLVNESACYAIVNEEYIPPLTLSAECKDFLSRCFQKNMFK 242

Query: 610 RLGYNGADEIKNHPFFSQL 628
           R     A E+  H +  ++
Sbjct: 243 R---ATAQELLAHIWLKKI 258

>YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase
           kinase kinase essential for late nuclear division [2925
           bp, 974 aa]
          Length = 974

 Score =  107 bits (267), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 74/254 (29%), Positives = 119/254 (46%), Gaps = 10/254 (3%)

Query: 370 FDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPF 429
           + L +VIG+GS+G V +   K T ++ A+K +      +  E+   +AE ++L  ++   
Sbjct: 25  YHLKQVIGRGSYGVVYKAINKHTDQVVAIKEVVYE---NDEELNDIMAEISLLKNLNHNN 81

Query: 430 IVPLKFSFQSQEKLYLVLACINGGELFYHLQREGR-FDLSRSRFYAAELLCALDTLHKMD 488
           IV      +   +LY++L     G L   + R       + S+ Y  + L  L  LH   
Sbjct: 82  IVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEG 141

Query: 489 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKV 548
           VI+RD+K  NILL     + L DFG+  +         T  GT  ++APE+L  +G S +
Sbjct: 142 VIHRDIKAANILLSADNTVKLADFGVSTI---VNSSALTLAGTLNWMAPEILGNRGASTL 198

Query: 549 VDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLLIGLLSRDPQ 608
            D W+LG  + EMLT  PPY++     +Y  +  D    P  F    KD L     ++  
Sbjct: 199 SDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSSFSEPLKDFLSKCFVKNMY 258

Query: 609 RRLGYNGADEIKNH 622
           +R     AD++  H
Sbjct: 259 KR---PTADQLLKH 269

>Kwal_27.9763
          Length = 868

 Score =  107 bits (266), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 73/259 (28%), Positives = 125/259 (48%), Gaps = 10/259 (3%)

Query: 355 VDYKPSRNKPLS---IDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSE 411
           V+  P++  P +      + L +V+GKG++G V +   + T K  A+K I       +  
Sbjct: 5   VNLTPAQKVPSTGSNTHHYALKQVVGKGAYGIVYRAINRQTHKQVAIKVIEYD--EEEEL 62

Query: 412 VTHTLAERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSR 471
             H L E  +L  +    IV      Q   +L+++L   + G L   L + G  +  + +
Sbjct: 63  NEHML-EIDLLKNLKHENIVKYHGFIQKSHQLFILLEYCSQGSL-RDLIKRGPVEEQQCK 120

Query: 472 FYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGT 531
            Y  + L  L  LH   VI+RD+K  N+LLD Q  + L DFG+   + +  +   T+ G+
Sbjct: 121 TYIRQTLHGLKYLHDQGVIHRDIKAANLLLDAQNVVKLADFGV---STRVNNLAMTYAGS 177

Query: 532 PEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGF 591
           P ++APE+++GQG S V D W+LG  + E+LTG PP+++         I+ D  + P   
Sbjct: 178 PNWMAPEVMMGQGASTVSDIWSLGATVVEILTGNPPFHNLVNEAACYAIVHDVYIPPSTL 237

Query: 592 DRDAKDLLIGLLSRDPQRR 610
               +  L     ++  +R
Sbjct: 238 SSSCRKFLRSCFQKNMFKR 256

>Scas_582.1
          Length = 638

 Score =  105 bits (261), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 84/307 (27%), Positives = 149/307 (48%), Gaps = 29/307 (9%)

Query: 341 WVELRDG----LGKINIS---VDYKPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTK 393
           +V+++ G     GK+++S   +D+    +  +++ + + ++ +G G++G V +V  K T 
Sbjct: 294 YVDIKSGSLNFAGKLSLSSKGIDFSNGSSSRITLAELEFIEELGHGNYGNVSKVLHKPTN 353

Query: 394 KIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGG 453
            I A+K ++    + +++    L E  VL +   P+IV    +F  +  +Y+ +  ++GG
Sbjct: 354 VIMAMKEVKLE--LDEAKFRQILMELEVLHKCKSPYIVDFYGAFFIEGAVYMCMEYMDGG 411

Query: 454 EL--FYHLQRE-GRFDLSRSRFYAAELLCALDTLHKM-DVIYRDLKPENILLDY-QGHIA 508
            L   Y    E G  D  +    A  ++  L  L  +  +I+RD+KP NIL    QG I 
Sbjct: 412 SLDKIYDQDPEIGGIDEPQLAVIATAVIRGLKVLKDVHHIIHRDVKPTNILCSAKQGTIK 471

Query: 509 LCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLG-----QGYSKVVDWWTLGVLLYEMLT 563
           LCDFG+    +    KT+  C +  Y+APE +         Y+   D W+LG+ + EM  
Sbjct: 472 LCDFGVSGNLVASMAKTNIGCQS--YMAPERIKSLNPDIATYTVQSDIWSLGLSILEMAL 529

Query: 564 GLPPYYDENVPKMYKKILQ----DPLVFPDG-FDRDAKDLLIGLLSRDPQRRLGYNGADE 618
           G  PY  E    ++ ++       P   P G F ++A+D +   L + P+RRL Y    E
Sbjct: 530 GRYPYPPETFDNIFSQLSAIVDGPPPKLPAGKFSKEAQDFVSLCLQKVPERRLNYTALLE 589

Query: 619 IKNHPFF 625
              HP+ 
Sbjct: 590 ---HPWL 593

>Scas_673.20*
          Length = 758

 Score =  104 bits (260), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 76/252 (30%), Positives = 118/252 (46%), Gaps = 25/252 (9%)

Query: 373 LKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPFIVP 432
           LK IG+G+ G V    +  T    A+K I    +  +  +     E  VL     P I+ 
Sbjct: 484 LKRIGEGASGIVYTAYEIGTDISVAIKQID---LKIQPRLQMIWTEMLVLKEYQHPNIIN 540

Query: 433 LKFSFQSQEKLYLVLACINGGEL-----FYHLQREGRFDLSRSRFYAAELLCALDTLHKM 487
              S+   + L++V+  ++GG L     F+    E    + R      E L  L+ LH  
Sbjct: 541 FINSYLLHDTLWIVMEYMDGGSLADIVSFFTPTEEQMATICR------ETLFGLNFLHSR 594

Query: 488 DVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSK 547
            +++RD+K +NILL   G I + DFG C    +   K  T  GTP ++APE++  + Y  
Sbjct: 595 GIVHRDIKSDNILLSMNGDIKITDFGFCGQLTESNTKRTTMVGTPYWMAPEVIASKEYGP 654

Query: 548 VVDWWTLGVLLYEMLTGLPPYYDEN-VPKMY------KKILQDPLVFPDGFDRDAKDLLI 600
            VD W+LG+++ EM+ G PPY  E  V  +Y      K IL++    P+      K+ + 
Sbjct: 655 KVDVWSLGIMIIEMIEGEPPYLHETPVRALYLITTNGKPILKE----PEKVGPVLKNFMD 710

Query: 601 GLLSRDPQRRLG 612
             L  DP+ RL 
Sbjct: 711 ECLRVDPEARLS 722

>Kwal_23.6325
          Length = 1542

 Score =  104 bits (259), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 82/274 (29%), Positives = 130/274 (47%), Gaps = 22/274 (8%)

Query: 374  KVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAER-TVLARIDCPFIVP 432
            + +G G+FG V      DT +I A+K I+     S  +V   + E  +VL  ++ P +V 
Sbjct: 1253 QFVGGGAFGTVFSAVNLDTGEILAVKEIKIQDRKSMKQVFPAIKEEMSVLEMLNHPNVVQ 1312

Query: 433  LKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYR 492
                   ++K+ L +    GG L   L+     D   ++ YA ++L  L  LH+  V++R
Sbjct: 1313 YYGVEVHRDKVNLFMEYCEGGSLAQLLEHGRIEDEMVTQIYALQMLEGLAYLHQSSVVHR 1372

Query: 493  DLKPENILLDYQGHIALCDFGLCKL---------NMKDEDKTD---TFCGTPEYLAPELL 540
            D+KPENILLD+ G I   DFG  +          N+  E K D   +  GTP Y++PE +
Sbjct: 1373 DIKPENILLDFNGVIKYVDFGAARSLAANGTKAPNVGAEGKADGVNSMMGTPMYMSPESI 1432

Query: 541  LG--QGYSKVVDWWTLGVLLYEMLTGLPPYY--DENVPKMYKKILQDPLVFP--DGFDRD 594
             G  +G     D W+LG ++ EM+TG  P++  D     MY          P  +     
Sbjct: 1433 TGAKKGKFGSGDIWSLGCVILEMVTGRRPWFNLDNEWAIMYHVAAGHVPQLPTKEELSPQ 1492

Query: 595  AKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQL 628
              D L+  L +DP +R   + A E+  HP+  ++
Sbjct: 1493 GIDFLLRCLKQDPNKR---STAMELLLHPWMIEI 1523

>Scas_675.2
          Length = 527

 Score =  102 bits (255), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 84/279 (30%), Positives = 143/279 (51%), Gaps = 26/279 (9%)

Query: 367 IDDFDLLKVIGKGSFGKVMQVR-KKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARI 425
           I D  L   IG+GSFG VM      D   I A+K +       K+ +T     R VL   
Sbjct: 12  IKDVVLGDTIGQGSFGCVMNAHLAVDPSVIIAVKYVHIP-TCKKNGLTEKDISREVLLHS 70

Query: 426 DC---PFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALD 482
            C   P ++ L     +++ +++++   +GG+LF  ++ +   D   ++FY  +L+ A+ 
Sbjct: 71  RCSKNPNVLRLIDCNIAKDYMWMIMEMADGGDLFDKIEPDVGVDSEVAQFYFQQLVRAIS 130

Query: 483 TLHK-MDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFC----GTPEYLAP 537
            LH+   V +RD+KPENILLD  G++ L DFGL     + +D T        G+P Y+AP
Sbjct: 131 YLHEECGVAHRDIKPENILLDKNGNLKLADFGLSS-QYRRKDGTLRISTDQRGSPPYMAP 189

Query: 538 ELLLGQG-YSKVVDWWTLGVLLYEMLTGLPPYYDENVPKM-YKKILQD-------PLVFP 588
           E+L  +G Y+   D W++G+LL+ +LTG  P+    + ++ +   LQ+       P    
Sbjct: 190 EILHSRGYYAHSTDIWSIGILLFVLLTGETPWELPVIEELNFASFLQNNGNLNLGPWAKI 249

Query: 589 DGFDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQ 627
           + F     +LL  +L  DP++R        +++HP+F++
Sbjct: 250 EFFHL---NLLRKILQPDPKKRATLK---ILRSHPWFTK 282

>KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces
            cerevisiae YNR031c SSK2 MAP kinase kinase kinase of the
            high osmolarity signal transduction pathway, start by
            similarity
          Length = 1551

 Score =  103 bits (258), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 82/271 (30%), Positives = 126/271 (46%), Gaps = 27/271 (9%)

Query: 321  QLPVNLLIDSAATIRLYNHHWVELRDGLGKINISVDYKPSRNKPL--SIDDFDLL----K 374
            ++ +N + D    +++  H+ V      GK+    D +    K L  SI +  +      
Sbjct: 1210 EMRMNAITDMEKVVKVKRHYSV------GKVIDDTDNQSKLLKSLASSISNLSIRWQKRS 1263

Query: 375  VIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERT-VLARIDCPFIVPL 433
             IG GSFG V      DT  I A+K I+     S  ++  +L E   V+  ++ P IV  
Sbjct: 1264 FIGSGSFGTVYSAVNLDTGDILAVKEIKIQDAKSMKQIFPSLKEEMRVMEILNHPNIVQY 1323

Query: 434  KFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYRD 493
                  ++K+ + +    G  L   L+     D   ++ Y  +LL  L  LH+  V++RD
Sbjct: 1324 YGVEVHRDKVNIFMEFCEGSSLASLLEHGRIEDEMVTQVYTLQLLEGLACLHQSGVVHRD 1383

Query: 494  LKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTF------------CGTPEYLAPELLL 541
            +KPENILLD  G I   DFG  KL  K+  K  +              GTP Y+APE + 
Sbjct: 1384 IKPENILLDRNGVIKYVDFGAAKLIAKNGSKRISLDANNKSTGGKDMIGTPMYMAPETVT 1443

Query: 542  GQGYSKVV--DWWTLGVLLYEMLTGLPPYYD 570
            GQG+ K    D W+LG ++ EM+TG  P+ +
Sbjct: 1444 GQGHGKFGSDDIWSLGCVVLEMVTGRRPWAN 1474

>Scas_707.36
          Length = 915

 Score =  102 bits (255), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 86/327 (26%), Positives = 147/327 (44%), Gaps = 60/327 (18%)

Query: 353 ISVDYKPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAI----RKSYIVS 408
           IS+ Y P  +K   ++ ++++K +G G  GKV   +     ++ A+K +    +K+Y   
Sbjct: 77  ISLSYDPV-SKTQILNHYEIVKELGNGQHGKVKLAKDIRANQLVAIKMVNRYEKKTYFAG 135

Query: 409 --KSEVTHTLAERTVLARIDCPFIVPLKFSFQ--SQEKLYLVLACINGGELFY----HLQ 460
             +++      E  ++ + +   +V L       S  K+YLVL     G + +     L+
Sbjct: 136 PKRNDPNKIKKEIAIMKKCNNKHVVKLIEILDDLSSRKIYLVLEYCEKGPILWCPRDQLE 195

Query: 461 REGR----FDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCK 516
            + R        R+R    +++  L+ LH   +I+RD+KP N+L+D  G + + DFG+  
Sbjct: 196 IDSRGPPQLSFQRAREIFRDVILGLEYLHSQGIIHRDIKPANLLMDKNGVVKISDFGVSL 255

Query: 517 LNMKDEDKTD------TFCGTPEYLAPELLLGQG-----------------YSKVVDWWT 553
               + D  D         GTP + APE+ LG                    S  +D W 
Sbjct: 256 AANGNIDTNDDELELTKTVGTPVFYAPEICLGAAAMERFNLDKDELFNGSCISFKIDIWA 315

Query: 554 LGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDR----------------DAKD 597
           LG+ LY +L G+ P+  E   K+++KI+ + L FP  F+                  AKD
Sbjct: 316 LGITLYCLLFGMLPFVSEFELKLFEKIVNEKLRFP-TFETLQDNHISEISHIREFVHAKD 374

Query: 598 LLIGLLSRDPQRRLGYNGADEIKNHPF 624
           LL  LL ++P +R+      +IK HPF
Sbjct: 375 LLNKLLEKNPAKRISI---PDIKVHPF 398

>CAGL0K02167g complement(191468..194956) similar to sp|P38990
           Saccharomyces cerevisiae YER129w
           Serine/threonine-protein kinase, start by similarity
          Length = 1162

 Score =  102 bits (254), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 92/335 (27%), Positives = 150/335 (44%), Gaps = 67/335 (20%)

Query: 353 ISVDYKPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAI-------RKSY 405
           IS+ Y P   + + ++ ++++K +G G  GKV   R   TK++ A+K +       RK +
Sbjct: 125 ISLTYDPVSKRKV-LNTYEIIKELGHGQHGKVKLGRDLVTKRLVAIKIVDRHEKKERKFF 183

Query: 406 IV---SKSEVTHTLAERTVLARIDCPFIVPLKFSFQ--SQEKLYLVLACINGGELFYH-- 458
                 K+E      E  ++ +     +V L          K+YLVL   + GE+ +   
Sbjct: 184 SFKKPGKTENDKIKREIAIMKKCHHKHVVKLIEVLDDLKSRKIYLVLEYCSRGEVKWCPP 243

Query: 459 --LQREGRFDLSRSRFYAAELL----CALDTLHKMDVIYRDLKPENILLDYQGHIALCDF 512
             L+ E +     S  +  E+L      L+ LH   +I+RD+KP N+LL   G + + DF
Sbjct: 244 DCLETEAKGPSPLSFQFTREILRGVVLGLEYLHYQGIIHRDIKPANLLLSETGIVKISDF 303

Query: 513 GLC----KLNMKDEDKT------DTFCGTPEYLAPELLLGQ-GYSKV------------- 548
           G+       N+   D+T          GTP + APE+ LG+  + K              
Sbjct: 304 GVSLAASSSNVDGSDETIDELELAKTAGTPAFFAPEICLGEDAFEKYQLDREELFKGSCI 363

Query: 549 ---VDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFD------------- 592
              +D W LGV LY ++ G+ P+      ++++KI+ DP+ FP   D             
Sbjct: 364 SFKIDIWALGVTLYCLVFGMLPFVSSFELELFEKIVNDPVKFPKYSDMLKNNQVLQMTEE 423

Query: 593 ---RDAKDLLIGLLSRDPQRRLGYNGADEIKNHPF 624
                AKDLL  LL ++P +R+     +EIK HPF
Sbjct: 424 AEYEAAKDLLTRLLEKNPIKRINI---EEIKRHPF 455

>CAGL0K02673g complement(240509..243256) similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20
           Serine/threonine-protein kinase, hypothetical start
          Length = 915

 Score =  101 bits (252), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 78/266 (29%), Positives = 125/266 (46%), Gaps = 19/266 (7%)

Query: 371 DLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPFI 430
           DL+K IG+G+ G V      +++   A+K +       K  +   L E  V+       I
Sbjct: 622 DLIK-IGQGASGGVYIAHDTESEDSVAIKQMNLEKQPKKELI---LNEILVMRESKHSNI 677

Query: 431 VPLKFSFQSQEKLYLVLACINGGELF----YHLQREGRFDLSRSRFYAAELLCALDTLHK 486
           V    S+ ++  L++V+  + GG L     + L  EG+           E L  L  LH 
Sbjct: 678 VNFIDSYLAKGDLWIVMEYMEGGSLTDVVTHCLLSEGQIGA-----VCRETLKGLQFLHS 732

Query: 487 MDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYS 546
             V++RD+K +NILL  +G+I L DFG C    ++  K  T  GTP ++APE++  + Y 
Sbjct: 733 KGVLHRDIKSDNILLSLKGNIKLTDFGFCAQINENNLKRTTMVGTPYWMAPEVVSRKEYG 792

Query: 547 KVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQD---PLVFPDGFDRDAKDLLIGLL 603
             VD W+LG+++ EM+ G PPY +E   +    I  +    L  P+         L   L
Sbjct: 793 PKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPEALSDTLTKFLDWCL 852

Query: 604 SRDPQRRLGYNGADEIKNHPFFSQLS 629
             DP  R     A E+ + PF ++++
Sbjct: 853 KVDPSERA---TATELLDDPFITEIA 875

>AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C
            (SSK2) - SH] (1120017..1124468) [4452 bp, 1483 aa]
          Length = 1483

 Score =  102 bits (253), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 79/252 (31%), Positives = 123/252 (48%), Gaps = 18/252 (7%)

Query: 376  IGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLA-ERTVLARIDCPFIVPLK 434
            IG GSFG V      DT  I A+K I+ +   +  +V  ++  E TVL  ++ P +V   
Sbjct: 1197 IGGGSFGSVYSAVNLDTGDILAVKEIKFNDRKTIKQVFPSIRDEMTVLEMLNHPNVVQYY 1256

Query: 435  FSFQSQEKLYLVLACINGGELFYHLQREGRF-DLSRSRFYAAELLCALDTLHKMDVIYRD 493
                 ++++ + +    GG L   L   GR  D   ++ Y+ ++L  L  LH+  V +RD
Sbjct: 1257 GVEVHRDRVNIFMEYCEGGSL-ASLLAHGRIEDEMVTQVYSLQMLEGLAYLHESGVDHRD 1315

Query: 494  LKPENILLDYQGHIALCDFGLC---------KLNMKDEDKTDTFCGTPEYLAPELLLGQG 544
            +KPENILLD+ G I   DFG           KLN++   + +   GTP Y++PE + G G
Sbjct: 1316 IKPENILLDFNGIIKYVDFGAAKVLASNGSKKLNLEQHMEGEKMIGTPMYMSPEAISGTG 1375

Query: 545  YSKVV--DWWTLGVLLYEMLTGLPPY--YDENVPKMYKKILQDPLVFP--DGFDRDAKDL 598
            Y K    D W+LG ++ EM+TG  P+   D     +Y+       +FP  +   +     
Sbjct: 1376 YGKFGSDDIWSLGCVILEMVTGRRPWANLDNQWAIIYQVAAGQIPMFPSKNEMSQAGIKF 1435

Query: 599  LIGLLSRDPQRR 610
            L   L +DP +R
Sbjct: 1436 LSRCLIQDPNQR 1447

>CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomyces
           cerevisiae YHR030c SLT2, hypothetical start
          Length = 488

 Score = 99.8 bits (247), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 86/319 (26%), Positives = 147/319 (46%), Gaps = 67/319 (21%)

Query: 362 NKPLSIDD-FDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVT-HTLAER 419
           N+  +ID  F+L+K IG G++G V   R  +  +   +   + + I SK+ +   +L E 
Sbjct: 12  NQDFTIDKRFELIKEIGHGAYGIVCSARFTEASEETTVAIKKVTNIFSKTLLCKRSLREL 71

Query: 420 TVLAR------IDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRS--- 470
            +L        I C + + + F              ING  L+  L       + +S   
Sbjct: 72  KLLRHFRGHKNITCLYDMDIVFYPD---------GSINGLYLYEELMECDMHQIIKSGQA 122

Query: 471 ------RFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDK 524
                 + +  ++LC L  +H  DV++RDLKP N+L++    + +CDFGL +   ++ ++
Sbjct: 123 LTDAHYQSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPEE 182

Query: 525 TDTF----CGTPEYLAPELLLG-QGYSKVVDWWTLGVLLYEMLTGLPPYY---------- 569
            + F      T  Y APE++L  QGY+K +D W+ G +L E L G P +           
Sbjct: 183 NNQFLTEYVATRWYRAPEIMLSYQGYTKAIDIWSTGCILAEFLGGKPLFKGKDYVDQLNR 242

Query: 570 ---------DENVPKMYKKILQDPL-------------VFPDGFDRDAKDLLIGLLSRDP 607
                    DE + ++  K +QD +             +FP+  + DA DLL G+L+ DP
Sbjct: 243 ILQVLGTPPDETLRRVGSKNVQDYIHQLGYIQKIPFSELFPNA-NEDALDLLEGMLAFDP 301

Query: 608 QRRLGYNGADEIKNHPFFS 626
           Q+R+  + A E   HP+ +
Sbjct: 302 QKRITVDKALE---HPYLT 317

>Kwal_47.17263
          Length = 1127

 Score =  101 bits (251), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 86/330 (26%), Positives = 149/330 (45%), Gaps = 62/330 (18%)

Query: 353 ISVDYKPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAI--------RKS 404
           IS++Y P   + + ++ ++++  +G+G  GKV   R   TK++ A+K +        R S
Sbjct: 89  ISLEYDPISKRKV-LNTYEIIGELGQGQHGKVKLARDLVTKQLVAIKIVDRNGGKSNRFS 147

Query: 405 YIVSKSEVTHTLAERTVLARIDCPFIVPLK--FSFQSQEKLYLVLACINGGELFY----H 458
           +  + +       E  ++ +     +V L       +  K+YLVL   + GE+ +     
Sbjct: 148 FKKNTNGSDKIKREIAIMKKCHHEHVVKLVEVLDDSTSRKIYLVLEYCSKGEVKWCPGDQ 207

Query: 459 LQREGR----FDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGL 514
           L+ E R        R+R     ++  L+ LH   +I+RD+KP N+L+   G + + DFG+
Sbjct: 208 LETEARGPPLLTFQRAREIFRGVVLGLEYLHYQGIIHRDIKPANLLISESGTVKISDFGV 267

Query: 515 CKLNMK--------DEDKTDTFCGTPEYLAPELLLGQGYSKV-----------------V 549
                K        DE +     GTP + APE+ LG   S+                  +
Sbjct: 268 SFAASKSGAGYGSLDELELAKTAGTPAFFAPEICLGHEASERFAPDRPSSDHGSIISYNI 327

Query: 550 DWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVF-------PDGFDR--------D 594
           D W +GV L+ +L G+ P++ E   +++ KI+   LV         +G  +         
Sbjct: 328 DIWAIGVTLHCLLFGMLPFFSEFELELFDKIINQELVLKTYEEMASNGISKISNQEEYEA 387

Query: 595 AKDLLIGLLSRDPQRRLGYNGADEIKNHPF 624
           AKDLL  LL+++P +R+      EIK HPF
Sbjct: 388 AKDLLGRLLTKNPFKRIKI---AEIKKHPF 414

>CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces
           cerevisiae YLR248w RCK2 Ca/calmodulin-dependent or
           sp|P38622 Saccharomyces cerevisiae YGL158w RCK1,
           hypothetical start
          Length = 514

 Score = 99.8 bits (247), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 87/324 (26%), Positives = 142/324 (43%), Gaps = 67/324 (20%)

Query: 367 IDDFDLLKVIGKGSFGKVMQVRKKDTK----KIYALKAIRKS----YIVSKSEVTHTLAE 418
           ++++ ++  IG+G+F +V +           K  A+K + K     + + K+    TL E
Sbjct: 64  LNNYRIISKIGEGAFSRVFKAVPLHNNLALPKFVAIKVVPKEDFHDHNLKKTSKLQTLNE 123

Query: 419 RTV---LARIDCPFIVPLKFSFQ-SQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYA 474
             +   L + + P +V L   FQ S++  Y +   I GGE+F  + +   F    +R   
Sbjct: 124 LNIHLKLTKANVPNVVKL-LEFQVSKKYYYFIQEYIEGGEIFNQIVKYTYFSEDLTRHVI 182

Query: 475 AELLCALDTLHKMDVIYRDLKPENILLD----------YQG------------------- 505
            ++  A+  LH+ ++I+RD+KPEN++ +          YQ                    
Sbjct: 183 RQVATAVKGLHENNIIHRDIKPENLIFEPIIKEQTIHRYQKLRKSDDPKTKLDEGKFIPG 242

Query: 506 -------HIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELL---------LGQGYSKVV 549
                   + L DFGL +L    E    T CGT  YLAPE+L             YS  V
Sbjct: 243 IGGGGIGKVRLVDFGLSRLMDPAESGARTPCGTFGYLAPEVLNQYKVDPRTSNTSYSYKV 302

Query: 550 DWWTLGVLLYEMLTGLPPYYDENVPK--MYKKILQDPLVFP----DGFDRDAKDLLIGLL 603
           D W +G +LY ML G PP+Y++   K  +  KI +    F     D    +A+DL+  LL
Sbjct: 303 DIWAIGCILYTMLCGFPPFYEDEFSKESLGDKISRGNYKFLAPWWDEISIEAQDLIRNLL 362

Query: 604 SRDPQRRLGYNGADEIKNHPFFSQ 627
             DP +R      D++  HP+ + 
Sbjct: 363 QVDPAKRY---DIDQLLAHPWLNH 383

>Scas_685.24
          Length = 515

 Score = 99.4 bits (246), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 116/223 (52%), Gaps = 14/223 (6%)

Query: 351 INISVDYKPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKS 410
           ++I  +Y P  +K     ++ + + +G+G+FG V +   + T K+ A+K +    + + +
Sbjct: 6   LSIRREYTPRISKA---HNYIVKECVGRGNFGDVYRAIDRTTNKVVAIKVVD---LENTN 59

Query: 411 EVTHTLAERTV-LARIDCPFIVPLKFSFQSQEKLYLVLACINGG---ELFYHLQREGRFD 466
           E    LA+    LA +  P+I+    +      +++V+    GG   +L  +    G   
Sbjct: 60  ERLEVLAQEIFFLAELKSPYIINYITTLLEDASMWIVMEYCGGGSCSDLLKYYFNNG-LP 118

Query: 467 LSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTD 526
             +  +   E+L  L  LH+   I+RD+K  NILL  +GH+ L DFG+    +K   +  
Sbjct: 119 EKKVAYITREILKGLQYLHEQKKIHRDIKAANILLTEEGHVKLGDFGVSG-QLKSTLRRG 177

Query: 527 TFCGTPEYLAPELLLG--QGYSKVVDWWTLGVLLYEMLTGLPP 567
           T  GTP ++APE+     +GY + +D W+LG+ ++E+L G+PP
Sbjct: 178 TIVGTPYWMAPEVASQNIEGYDEKIDIWSLGITVFELLKGVPP 220

>CAGL0B03509g complement(349638..351431) similar to sp|P38623
           Saccharomyces cerevisiae YLR248w RCK2
           Ca/calmodulin-dependent or sp|P38622 Saccharomyces
           cerevisiae YGL158w RCK1, start by similarity
          Length = 597

 Score = 99.8 bits (247), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 65/222 (29%), Positives = 99/222 (44%), Gaps = 40/222 (18%)

Query: 427 CPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHK 486
           CP+IV      +++   YL+   ++GGE+F  + R        SR    ++  A+  +H 
Sbjct: 240 CPYIVGFIDFQETKHYYYLIQELLDGGEIFNEIVRLTYLSEDLSRHVIKQVALAVRHMHS 299

Query: 487 MDVIYRDLKPENILLDYQGHI----------------------------------ALCDF 512
           + +++RD+KPEN+L     +I                                   L DF
Sbjct: 300 LGIVHRDIKPENLLFKSIEYIPSKKRTFRKSDDPATKADEGVFIPTIGGGGIGIVKLADF 359

Query: 513 GLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEN 572
           GL K   +   KT   CGT  Y APE++  + YS  VD W +G +LY ML G PP+YDE 
Sbjct: 360 GLSKQIFQKNTKTP--CGTIGYTAPEVVKDEKYSMQVDMWGIGCVLYTMLCGFPPFYDEK 417

Query: 573 VPKMYKKILQDPLVFP----DGFDRDAKDLLIGLLSRDPQRR 610
           +  + +KI +    F     D     AK  +  LL  DP++R
Sbjct: 418 IDVLTEKISRGEYTFLEPWWDEISPGAKHCVKKLLEVDPRKR 459

>KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyveromyces
            lactis MAP kinase kinase kinase, start by similarity
          Length = 1338

 Score = 99.8 bits (247), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 93/311 (29%), Positives = 146/311 (46%), Gaps = 35/311 (11%)

Query: 335  RLYNHHWVELRDGLGKINISVDYKPSRNKPLSIDDFDLLK--VIGKGSFGKVMQVRKKDT 392
            +++    VE+ D   K  IS++   SRN      +F  +K  +IGKGSFG V       T
Sbjct: 1006 KMWGTKVVEITD---KRTISINK--SRNSRGEYKEFAWIKGEIIGKGSFGAVYLALNVTT 1060

Query: 393  KKIYALKAIRKSYIVSKSEVTHTLAER-----TVLARIDCPFIVPLKFSFQSQEKLY-LV 446
             ++ A+K +      S+ E   ++ E      + L  ++   IV     F+ +  +Y L 
Sbjct: 1061 GEMLAVKQVTVPEFSSQDESAISMVEALKSEVSTLKDLNHVNIVQY-LGFEEKNGIYSLF 1119

Query: 447  LACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGH 506
            L  + GG +   ++  GRFD    R    ++L  L  LH   +++RD+K +N+LLD  G 
Sbjct: 1120 LEYVAGGSVGSLIRMYGRFDDQLIRHLTKQVLEGLAYLHSKGILHRDMKADNLLLDNDGV 1179

Query: 507  IALCDFGLCKLNMKDEDKTD-TFCGTPEYLAPELL-LGQGYSKVVDWWTLGVLLYEMLTG 564
              + DFG+ + +      +D T  GT  ++APE++    GYS  VD W+LG ++ EM  G
Sbjct: 1180 CKISDFGISRKSNNIYSNSDMTMRGTVFWMAPEMVDTAHGYSAKVDIWSLGCVVLEMFAG 1239

Query: 565  LPPYYD-ENVPKMYK--KILQDPLVFPDGFDRDAKDL--------LIGLLSRDPQRRLGY 613
              P+ + E V  M++  K    P + PD    D KDL        L      DP+ R   
Sbjct: 1240 KRPWSNFEVVAAMFQIGKSKTAPPI-PD----DTKDLVSPAGQSFLDQCFEIDPEMRP-- 1292

Query: 614  NGADEIKNHPF 624
              AD +  HPF
Sbjct: 1293 -TADSLVGHPF 1302

>Kwal_33.14081
          Length = 580

 Score = 98.6 bits (244), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 89/320 (27%), Positives = 152/320 (47%), Gaps = 28/320 (8%)

Query: 341 WVELRDG----LGKINIS---VDYKPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTK 393
           +V+++ G     GK+++S   VD+    +  +++D+ + L+ +G G++G V +V  K T 
Sbjct: 238 YVDIKSGSLNFAGKLSLSSQGVDFSNGSSFRITLDELEFLEELGHGNYGNVSKVLHKPTN 297

Query: 394 KIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGG 453
            I A+K +R    + +S+ T  L E  VL +   P+IV    +F  +  +Y+ +  ++GG
Sbjct: 298 VIMAMKEVRLE--LDESKFTQILMELEVLHKCQSPYIVDFYGAFFIEGAVYMCMEYMDGG 355

Query: 454 EL--FYHLQREGRFDLSRSRFYAAELLCALDTLHKM-DVIYRDLKPENILLD-YQGHIAL 509
            L   Y     G  D     + A  ++  L  L  + ++I+RD+KP N+L    QG + L
Sbjct: 356 SLDKSYDSDVLGGIDEPELAYIANAIIQGLKELKDVHNIIHRDVKPTNVLCSAAQGTVKL 415

Query: 510 CDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLG-----QGYSKVVDWWTLGVLLYEMLTG 564
           CDFG+    +    KT+  C +  Y+APE +         Y+   D W+LG+ + EM  G
Sbjct: 416 CDFGVSGNLVASLAKTNIGCQS--YMAPERIKSFNPDKATYTVQSDIWSLGLSILEMAIG 473

Query: 565 LPPY----YDENVPKMYKKILQDPLVFPDG-FDRDAKDLLIGLLSRDPQRRLGYNGADEI 619
             PY    +D    ++   +   P   P G F   A+D +   L + P+RR  Y    E 
Sbjct: 474 TYPYPVETFDNIFSQLSAIVDSPPPQLPKGRFSPMAQDFVNMCLQKIPERRRNYAALLE- 532

Query: 620 KNHPFFSQLSWKRLLMKGYI 639
             HP+        + M  YI
Sbjct: 533 --HPWLKTHHLSEVNMSEYI 550

>CAGL0M10153g complement(1010688..1013291) some similarities with
           sp|Q03497 Saccharomyces cerevisiae YHL007c ser/thr
           protein kinase of the pheromone pathway, hypothetical
           start
          Length = 867

 Score = 99.4 bits (246), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 78/276 (28%), Positives = 130/276 (47%), Gaps = 31/276 (11%)

Query: 368 DDFDLLKVIGKGSFGKV-MQVRKKDTKKIYALKAI------RKSYIVSKSEVTHTLAERT 420
           D F+    IG+G+ G V +   + D  +  A+K +      +K  IV++  V  +   + 
Sbjct: 564 DKFETYLKIGQGASGGVYLSHSRSDKSQCVAIKQMNLEKQPKKELIVNEIMVMSSSKHQN 623

Query: 421 VLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELF----YHLQREGRFDLSRSRFYAAE 476
           ++  ID         S+ S   L++V+  + GG L     Y +  EG+           E
Sbjct: 624 IVNYID---------SYLSGLDLWVVMEYMEGGCLTDVVTYCVLTEGQIGA-----VCRE 669

Query: 477 LLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLA 536
           +L  L+ LH   V++RD+K +N+LL   G I L DFG C        K  T  GTP ++A
Sbjct: 670 VLQGLEFLHSKGVLHRDIKSDNVLLSMNGDIKLTDFGFCAQVNDTVIKRTTMVGTPYWMA 729

Query: 537 PELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQD--PLV-FPDGFDR 593
           PE++  + Y   VD W+LG+++ EM+ G PPY +E   +    I  +  P V  PD   +
Sbjct: 730 PEIVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGRPEVQEPDRLSK 789

Query: 594 DAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQLS 629
           D K+ +   L+     R     + E+  H F ++++
Sbjct: 790 DFKEFIDKCLAVTVSERA---ESSELLQHKFITEVA 822

>AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH]
            complement(595092..599363) [4272 bp, 1423 aa]
          Length = 1423

 Score = 99.8 bits (247), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 87/286 (30%), Positives = 136/286 (47%), Gaps = 20/286 (6%)

Query: 355  VDYKPSRNKPLSIDDFDLLK--VIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEV 412
            V    S+N      +F  +K  +IGKGSFG V       T ++ A+K +      S+ E 
Sbjct: 1107 VSINKSKNSKGEYREFAWIKGEMIGKGSFGAVYLGLNVTTGEMMAVKQVEVPKFGSQDET 1166

Query: 413  T-----HTLAERTVLARIDCPFIVPLKFSFQSQEKLY-LVLACINGGELFYHLQREGRFD 466
            T       ++E + L  +D   IV     F+++  +Y L L  + GG +   ++  G FD
Sbjct: 1167 TVNNAEALISEVSTLKDLDHLNIVQY-LGFENKNCIYSLFLEYVAGGSVGSLIRLYGHFD 1225

Query: 467  LSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLC-KLNMKDEDKT 525
                RF   ++L  L  LH   +++RD+K +N+LLD  G   + DFG+  K N    +  
Sbjct: 1226 EQLIRFLTTQVLEGLAYLHLRGILHRDMKADNLLLDNDGVCKISDFGISRKSNNIYSNSE 1285

Query: 526  DTFCGTPEYLAPELL-LGQGYSKVVDWWTLGVLLYEMLTGLPPYYD-ENVPKMYK--KIL 581
             T  GT  ++APE++   QGYS  VD W+LG ++ EM  G  P+ + E V  M++  K  
Sbjct: 1286 MTMRGTVFWMAPEMVDTTQGYSAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFQIGKSK 1345

Query: 582  QDPLVFPDGF---DRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPF 624
              P +  D      +D +  L      DP+ R     AD + +HPF
Sbjct: 1346 SAPPIPEDTLPHISQDGRAFLDDCFMIDPEERP---TADTLLSHPF 1388

>KLLA0E15378g 1362851..1365025 some similarities with sp|P08018
           Saccharomyces cerevisiae YJL128c PBS2 tyrosine protein
           kinase of the MAP kinase kinase family, hypothetical
           start
          Length = 724

 Score = 98.6 bits (244), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 93/322 (28%), Positives = 154/322 (47%), Gaps = 32/322 (9%)

Query: 341 WVELRDG----LGKINIS---VDYKPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTK 393
           +V ++ G     GK+++S   VD+    +  + +D+ + L+ +G G++G V +V  K T 
Sbjct: 382 YVNIKSGSLNFAGKLSLSSKGVDFSNGSSFRIKLDELEFLEELGHGNYGNVSKVLHKPTH 441

Query: 394 KIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGG 453
            I A+K +R    + +S+    L E  VL     P+IV    +F  +  +Y+ +  ++GG
Sbjct: 442 IIMAMKEVR--LELDESKFRQILMELEVLHNCQSPYIVDFYGAFFIEGAVYMCMEYMDGG 499

Query: 454 EL--FYHLQREGRFD---LSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDY-QGHI 507
            L   Y  ++ G  D   L+R      + L  L  +H  ++I+RD+KP NIL    QG I
Sbjct: 500 SLDKTYDDEQIGGIDEPQLARITSSVIQGLKELKDVH--NIIHRDVKPTNILCSASQGTI 557

Query: 508 ALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLG-----QGYSKVVDWWTLGVLLYEML 562
            LCDFG+    +    KT+  C +  Y+APE +         YS   D W+LG+ + EM 
Sbjct: 558 KLCDFGVSGNLVASLAKTNIGCQS--YMAPERIKSLNPDKSTYSVQSDIWSLGLSILEMA 615

Query: 563 TGLPPYYDENVPKMYKKILQ----DPLVFPDG-FDRDAKDLLIGLLSRDPQRRLGYNGAD 617
            G  PY  E    ++ ++       P   P+G F  DA++ +   L + P+RR  Y    
Sbjct: 616 LGAYPYPPETFDNIFSQLSAIVDGPPPKLPEGKFSADAQNFVSMCLQKIPERRPTYAALL 675

Query: 618 EIKNHPFFSQLSWKRLLMKGYI 639
           E   HP+  +     + M  YI
Sbjct: 676 E---HPWLKKYENVDVRMSEYI 694

>Scas_707.34
          Length = 905

 Score = 98.6 bits (244), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 82/313 (26%), Positives = 142/313 (45%), Gaps = 67/313 (21%)

Query: 368 DDFDLLKVIGKGSFGKVMQVR------------KKDTKKI-----YALKAIRKSYIVSKS 410
           D + + K IGKGSF  V +                D+  I     +A+K + +S + +K 
Sbjct: 36  DRYIVDKEIGKGSFATVHRAHLITPTSPHLHQSVVDSSSINNPTCFAIKIVPRSKLKNKK 95

Query: 411 EVTHTLAERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREG------- 463
            + +   E  +L +I  P IV L    ++ +  YL++   + G+L + +++         
Sbjct: 96  LLENLEIEIAILKKISHPHIVKLIDFERTSKDFYLIMEYCSLGDLTFLIKKRQQLIKNHP 155

Query: 464 --------------RFDLSRSRF---YAAELLCALDTLHKMDVIYRDLKPENILL----- 501
                         +++     F   Y  +L  AL  L   ++++RD+KP+N+LL     
Sbjct: 156 LLEKIFKKYPPPNEKYNGLHKAFILNYLQQLSSALKFLRSKNLVHRDIKPQNLLLSAPLI 215

Query: 502 DYQG----H------------IALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGY 545
           +Y      H            + + DFG  +  + +    +T CG+P Y+APE+L  Q Y
Sbjct: 216 NYNDPKSFHDLGFVGIYNLPILKIADFGFARF-LPNTSMAETLCGSPLYMAPEILNYQKY 274

Query: 546 SKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKI--LQDPLVFPD--GFDRDAKDLLIG 601
           +   D W++G +LYEM  G PP+   N  ++YKKI    D + FP     D + K L+  
Sbjct: 275 NAKADLWSVGTVLYEMCYGNPPFKASNHLELYKKIKKANDLIYFPTYIEIDNNLKSLISK 334

Query: 602 LLSRDPQRRLGYN 614
           LL+ DPQ R+ ++
Sbjct: 335 LLTFDPQERIEFD 347

>CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 521

 Score = 97.4 bits (241), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 74/254 (29%), Positives = 116/254 (45%), Gaps = 24/254 (9%)

Query: 370 FDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPF 429
           F +   IG+G+FG V + +     ++ A+K +      S+ EV     E   LA +  P+
Sbjct: 5   FVIENCIGRGNFGDVYKAKDTWLNEVVAVKVVNLEN--SEEEVELLAQEIFFLAELKSPY 62

Query: 430 IVPLKFSFQSQEKLYLVLACINGGE----LFYHLQREGRFDLSRSRFYAAELLCALDTLH 485
           +     +      +++ +    GG     L YH          ++RF   E+L  L  LH
Sbjct: 63  VTNYIATVVEDVSMWIAMEYCGGGSVGDLLKYHYT--SGLPEHKTRFITREILKGLSYLH 120

Query: 486 KMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLL--GQ 543
               I+RD+K  NILL  +G + L DFG+    +    + DTF GTP ++APE++    +
Sbjct: 121 SQRKIHRDIKAANILLTDEGKVKLSDFGVSG-KLLSSFRRDTFVGTPYWMAPEIVAHDSE 179

Query: 544 GYSKVVDWWTLGVLLYEMLTGLPPY--YD-----ENVPKMYKKILQDPLVFPDGFDRDAK 596
           GY +  D W+LG+ + EML G PP   YD      N+PK      + P      F  DAK
Sbjct: 180 GYDERADIWSLGITVIEMLRGSPPLSKYDPMKVIANLPK------RKPPKLHGDFSDDAK 233

Query: 597 DLLIGLLSRDPQRR 610
             +   L ++   R
Sbjct: 234 HFVALCLIKESAIR 247

>KLLA0D07304g 623352..624749 some similarities with sp|P32491
           Saccharomyces cerevisiae YPL140c MKK2 protein kinase of
           the map kinase kinase (MEK) family, hypothetical start
          Length = 465

 Score = 96.7 bits (239), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 65/207 (31%), Positives = 100/207 (48%), Gaps = 10/207 (4%)

Query: 368 DDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDC 427
           +  D L ++G+G+ G V + + ++  KI+ALK I  + I +         E         
Sbjct: 177 EQIDTLGILGEGTGGSVTKCKLRNGSKIFALKTI--ATIENDGSEKQIFRELQFNKSCKS 234

Query: 428 PFIVPLKFSFQSQEK--LYLVLACINGGEL---FYHL-QREGRFDLSRSRFYAAELLCAL 481
            FIV     F  +E   +++ +  + G  L   + HL  + GR         A  +L  L
Sbjct: 235 DFIVRYYGMFACEETSTIFIAMEYMGGRSLDSVYKHLLSKGGRIGEKVLGKIAESVLRGL 294

Query: 482 DTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLL 541
             LH+  +I+RD+KP+NIL +  G I LCDFG+    +       TF GT  Y+APE + 
Sbjct: 295 FYLHERKIIHRDIKPQNILFNEIGQIKLCDFGVSGEAV--NSLATTFTGTSYYMAPERIQ 352

Query: 542 GQGYSKVVDWWTLGVLLYEMLTGLPPY 568
           GQ YS   D W+LG+ L E+  G  P+
Sbjct: 353 GQPYSVTSDVWSLGLTLLEVAQGHSPF 379

>Scas_618.15
          Length = 620

 Score = 97.8 bits (242), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 91/347 (26%), Positives = 141/347 (40%), Gaps = 78/347 (22%)

Query: 370 FDLLKVIGKGSFGKVMQV--RKKDTKKIY--------ALKAIRK--------------SY 405
           + LL  IGKG+F  V +     ++ K  Y        A+K I+K              S+
Sbjct: 156 YKLLNKIGKGAFAVVYRAIPDPQNGKSSYFKEVCNEVAIKIIKKVDLSEDLKDHERDTSH 215

Query: 406 IVSKSEVTHTLAERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRF 465
           + S+ +V        V A  +C  +V      +++   Y+V   ++GGE++  + R   F
Sbjct: 216 VSSREQVLKEACLHKV-ASSECSEVVGFIDFVETKSYYYIVQEYLHGGEIYDQIVRLTYF 274

Query: 466 DLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHI------------------ 507
               +R    +L  A+  LH M +I+RD+KPEN+L +   HI                  
Sbjct: 275 SEDLTRHVIRQLAHAVKHLHSMGIIHRDIKPENLLFEPIQHIPSTHVKLRKTDNPFTKVD 334

Query: 508 ----------------ALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVDW 551
                            L DFGL K      + T+T CGT  Y APEL+    Y   +D 
Sbjct: 335 EGMFRPAIGGGGIGAVKLTDFGLSK--QLSTETTNTPCGTISYAAPELIRNHQYDNKIDL 392

Query: 552 WTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFP----DGFDRDAKDLLIGLLSRDP 607
           W +G +LY +L G PP+Y +    + +KI      F     D     AK+ +  LL  D 
Sbjct: 393 WGIGCVLYTLLCGFPPFYADQHKSVTRKIRHGEYHFLSPWWDEISSGAKNCVKHLLEVDV 452

Query: 608 QRRLGYNGADEIKNHPFFSQLSWKRLLMKGYIPPYKPPVTSATDTSN 654
            +R  YN  D++   P+ +  S           P  PP+ S    +N
Sbjct: 453 SKR--YN-IDDLLADPWLNMNS----------SPVNPPIKSIFSHTN 486

>Kwal_26.8703
          Length = 444

 Score = 96.3 bits (238), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 103/205 (50%), Gaps = 9/205 (4%)

Query: 375 VIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPFIVPL- 433
           V+G+G+ G V + + K    ++ALK I  +    +++    L E          +IV   
Sbjct: 162 VLGEGAGGSVTKCKLKGGSMVFALKTITTANSDPETQ-KQVLRELQFNRSCSSEYIVRYY 220

Query: 434 -KFSFQSQEKLYLVLACINGGEL---FYHL-QREGRFDLSRSRFYAAELLCALDTLHKMD 488
             F+ +S   +Y+ +  + G  L   + HL +R GR         A  +L  L  L +  
Sbjct: 221 GMFAEESTSSIYIAMEYMGGKSLDAIYKHLLERGGRIGEKVLGKIAESVLKGLSYLQERK 280

Query: 489 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKV 548
           +I+RD+KP+NILL+  G + LCDFG+  + +       TF GT  Y+APE + GQ YS  
Sbjct: 281 IIHRDIKPQNILLNEAGQVKLCDFGVSGVAV--NSLATTFTGTSFYMAPERIQGQPYSVT 338

Query: 549 VDWWTLGVLLYEMLTGLPPYYDENV 573
            D W+LG+ L E+  G  P+  +N+
Sbjct: 339 SDVWSLGLTLLEVAQGQFPFGSDNM 363

>CAGL0L03520g complement(401103..405446) similar to sp|Q01389
            Saccharomyces cerevisiae YJL095w BCK1, start by
            similarity
          Length = 1447

 Score = 98.2 bits (243), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 84/287 (29%), Positives = 133/287 (46%), Gaps = 20/287 (6%)

Query: 354  SVDYKPSRNKPLSIDDFDLLK--VIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSE 411
            +++   S+N      +F  +K  +IGKGSFG V       T ++ A+K +      +++E
Sbjct: 1133 TIEINKSKNARGEYKEFAWMKGEMIGKGSFGAVYLSLNITTGEMMAVKQVEVPKYGTQNE 1192

Query: 412  VTHTLAER-----TVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFD 466
            +   + E        L  +D   IV    S        L L  + GG +   ++  GRFD
Sbjct: 1193 LVKDMVEALKSEVATLKDLDHLNIVQYLGSEIRGNIYSLFLEYVAGGSVGSLIRLYGRFD 1252

Query: 467  LSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTD 526
                R    ++L  L  LH   +++RD+K +N+LLD  G   + DFG+ K +      +D
Sbjct: 1253 EKLIRHLNTQVLSGLKYLHSKGILHRDMKADNLLLDEDGICKISDFGISKKSKNIYSNSD 1312

Query: 527  -TFCGTPEYLAPELL-LGQGYSKVVDWWTLGVLLYEMLTGLPPYYD-ENVPKMYK--KIL 581
             T  GT  ++APE++   QGYS  VD W+LG ++ EM  G  P+ + E V  M++  K  
Sbjct: 1313 MTMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFQIGKSK 1372

Query: 582  QDPLVFPDG----FDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPF 624
              P + PD          KD L      DP++R     AD++  H F
Sbjct: 1373 SAPPI-PDDTIQLISSKGKDFLSKCFEIDPEKRP---TADDLLEHSF 1415

>KLLA0F23507g complement(2198603..2200066) similar to sp|P24719
           Saccharomyces cerevisiae YOR351c MEK1 ser/thr protein
           kinase, start by similarity
          Length = 487

 Score = 95.1 bits (235), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 67/225 (29%), Positives = 109/225 (48%), Gaps = 29/225 (12%)

Query: 374 KVIGKGSFGKVMQVRKKD--TKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPFIV 431
           +++G G+FG V+   K D   K+  A K +  +  V  +  T  + E T+L +++ P I+
Sbjct: 143 RIVGSGTFGHVLVAEKVDHNMKRQVAKKTVSYAVKVINTAKTRMVKEATILEKLNHPNII 202

Query: 432 PLKFS-FQSQEKLYLVLACINGGELFYHLQREGRF---DLSRSRFYAAELLCALDTLHKM 487
            +  S   +   +Y+    I+GG+LF +L +         + S     ++L AL  LH  
Sbjct: 203 RIHQSCVDALGNVYIFQDLISGGDLFSYLAKGDCLVPISETESLIIIYQILLALKFLHSN 262

Query: 488 DVIYRDLKPENILLDY---QGHIALCDFGLCK-LNMKDEDKTDTFCGTPEYLAPELLL-- 541
            +++RDLK +NILL        + L DFG+ K L+   +++  T  GTPEY APE+    
Sbjct: 263 GIVHRDLKLDNILLHTPEPCTKVVLADFGIAKELSQNTKERMHTVVGTPEYCAPEVGFKA 322

Query: 542 -----------------GQGYSKVVDWWTLGVLLYEMLTGLPPYY 569
                              GY    D W+LGV+ + MLTG+ P+Y
Sbjct: 323 DRNIYRSFSRTATLDPDNNGYDSKCDIWSLGVITHIMLTGISPFY 367

>KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces
           cerevisiae YLR248w RCK2 Ca/calmodulin-dependent ser/thr
           protein kinase, start by similarity
          Length = 546

 Score = 95.5 bits (236), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 84/308 (27%), Positives = 134/308 (43%), Gaps = 67/308 (21%)

Query: 367 IDDFDLLKVIGKGSFGKVMQ--------------VRKKDTKKIYALKAIRKSYIVSKSEV 412
           + D+ L++ IG+G+F KV +              V  +  K++ A+K I K  + + ++ 
Sbjct: 117 LKDYTLIQKIGEGAFSKVYRGIPSTSNCSNGASSVIAQQYKEV-AIKVIIKQQLPNTNKK 175

Query: 413 T-----HTLAERTVLARIDCPFIVP-----LKF-SFQSQEKLYLVL-ACINGGELFYHLQ 460
                  T     VL  I    IV      + F  FQ  EK Y ++   + GGE+F  + 
Sbjct: 176 GDEKNGKTSTAEQVLKEIAIHKIVSSGENIVSFIDFQESEKYYYIIQELLAGGEIFGEIV 235

Query: 461 REGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLD------------------ 502
           +   F    SR    +L  A+  +H++ +++RD+KPEN+L +                  
Sbjct: 236 KYTYFSEDLSRHVIRQLANAVKYMHQLGIVHRDIKPENLLFEPIDFIPNPKPKLRSSDDP 295

Query: 503 ----------------YQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYS 546
                             G + L DFGL K   +   KT   CGT  Y APE++  + YS
Sbjct: 296 STKLDEGVFRPGIGGGGIGVVKLADFGLSKQIYQTNTKTP--CGTVGYTAPEVVKDERYS 353

Query: 547 KVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFP----DGFDRDAKDLLIGL 602
             VD W +G +LY +L G PP++DE +  + +KI +    F     D     AK+ +  L
Sbjct: 354 MQVDMWGVGCVLYTVLCGFPPFFDEKIDVLTEKISRGEYTFLRPWWDQISDGAKNCVRKL 413

Query: 603 LSRDPQRR 610
           L  DP +R
Sbjct: 414 LEVDPAKR 421

>YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase,
           required for metaphase DNA-damage checkpoint [1584 bp,
           527 aa]
          Length = 527

 Score = 95.1 bits (235), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 73/229 (31%), Positives = 119/229 (51%), Gaps = 30/229 (13%)

Query: 360 SRNKPL-SIDDFDLLKVIGKGSFGKVMQVR-KKDTKKIYALKAIR----KSYIVSKSEVT 413
           S+  PL  I D  L   +G+G+F  V     + D   I A+K I     K   +S  ++T
Sbjct: 4   SQVSPLPHIKDVVLGDTVGQGAFACVKNAHLQMDPSIILAVKFIHVPTCKKMGLSDKDIT 63

Query: 414 HTLAERT-------VLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFD 466
             +  ++       VL  IDC           S+E ++++L   +GG+LF  ++ +   D
Sbjct: 64  KEVVLQSKCSKHPNVLRLIDCNV---------SKEYMWIILEMADGGDLFDKIEPDVGVD 114

Query: 467 LSRSRFYAAELLCALDTLH-KMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKT 525
              ++FY  +L+ A++ LH +  V +RD+KPENILLD  G++ L DFGL     + +D T
Sbjct: 115 SDVAQFYFQQLVSAINYLHVECGVAHRDIKPENILLDKNGNLKLADFGLAS-QFRRKDGT 173

Query: 526 DTFC----GTPEYLAPELLLGQG--YSKVVDWWTLGVLLYEMLTGLPPY 568
                   G+P Y+APE+L  +   Y+   D W++G+LL+ +LTG  P+
Sbjct: 174 LRVSMDQRGSPPYMAPEVLYSEEGYYADRTDIWSIGILLFVLLTGQTPW 222

>YHL007C (STE20) [2279] chr8 complement(95113..97932)
           Serine/threonine protein kinase of the pheromone
           response pathway, also participates in the filamentous
           growth and STE vegetative growth pathways [2820 bp, 939
           aa]
          Length = 939

 Score = 95.5 bits (236), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 101/204 (49%), Gaps = 20/204 (9%)

Query: 376 IGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPFIVPLKF 435
           IG+G+ G V    +  T    A+K +       K  +   + E  V+     P IV    
Sbjct: 626 IGQGASGGVYTAYEIGTNVSVAIKQMNLEKQPKKELI---INEILVMKGSKHPNIVNFID 682

Query: 436 SFQSQEKLYLVLACINGGELF----YHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIY 491
           S+  +  L++++  + GG L     + +  EG+           E L  L+ LH   V++
Sbjct: 683 SYVLKGDLWVIMEYMEGGSLTDVVTHCILTEGQIGA-----VCRETLSGLEFLHSKGVLH 737

Query: 492 RDLKPENILLDYQGHIALCDFGLC----KLNMKDEDKTDTFCGTPEYLAPELLLGQGYSK 547
           RD+K +NILL  +G I L DFG C    +LN+K      T  GTP ++APE++  + Y  
Sbjct: 738 RDIKSDNILLSMEGDIKLTDFGFCAQINELNLKRT----TMVGTPYWMAPEVVSRKEYGP 793

Query: 548 VVDWWTLGVLLYEMLTGLPPYYDE 571
            VD W+LG+++ EM+ G PPY +E
Sbjct: 794 KVDIWSLGIMIIEMIEGEPPYLNE 817

>AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W
           (SKM1) - SH] complement(246871..249252) [2382 bp, 793
           aa]
          Length = 793

 Score = 95.5 bits (236), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 97/203 (47%), Gaps = 13/203 (6%)

Query: 433 LKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRS-------RFYAAELLCALDTLH 485
           L+   ++++ L++V+  + GG L   ++     D S S        +   E    L  LH
Sbjct: 577 LEAYLKTEDDLWVVMEYMEGGSLTDVIENSIGSDASESPMTEPQIAYIVRETCQGLKFLH 636

Query: 486 KMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGY 545
              +I+RD+K +N+LLD  G + + DFG C        K  T  GTP ++APE++  + Y
Sbjct: 637 DKHIIHRDIKSDNVLLDTHGRVKITDFGFCAKLTDKRSKRATMVGTPYWMAPEVVKQREY 696

Query: 546 SKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQD---PLVFPDGFDRDAKDLLIGL 602
            + VD W+LG++  EML G PPY +E   K    I  +    L  P+    + K  L   
Sbjct: 697 DEKVDVWSLGIMTIEMLEGEPPYLNEEPLKALYLIATNGTPKLKHPELLSLEIKRFLSVC 756

Query: 603 LSRDPQRRLGYNGADEIKNHPFF 625
           L  D + R      +E+ +H FF
Sbjct: 757 LCVDVRYRA---STEELLHHSFF 776

>AFL217C [2978] [Homologous to ScYJL128C (PBS2) - SH] (30765..32840)
           [2076 bp, 691 aa]
          Length = 691

 Score = 95.1 bits (235), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 86/320 (26%), Positives = 152/320 (47%), Gaps = 28/320 (8%)

Query: 341 WVELRDG----LGKINIS---VDYKPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTK 393
           +V+++ G     GK+++S   VD+    +  +++D+ + L+ +G G++G V +V  K T 
Sbjct: 341 YVDIKSGSLNFAGKLSLSSQGVDFSNGSSFRITLDELEFLEELGHGNYGTVSKVLHKPTN 400

Query: 394 KIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGG 453
            + A+K +R    + +S+    L E  VL +   P+IV    +F  +  +Y+ +  ++GG
Sbjct: 401 IMMAMKEVR--LELDESKFRQILMELEVLHKCQSPYIVDFYGAFFIEGAVYMCMEFMDGG 458

Query: 454 EL--FYHLQREGRFDLSRSRFYAAELLCALDTLHKM-DVIYRDLKPENILLDY-QGHIAL 509
            L   Y     G  +  +       ++  L  L  + ++I+RD+KP NIL    QG + L
Sbjct: 459 SLDKSYDPHEIGGIEEPQLALITESVIRGLKELKDVHNIIHRDVKPTNILCSATQGTVKL 518

Query: 510 CDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLG-----QGYSKVVDWWTLGVLLYEMLTG 564
           CDFG+    +    +T+  C +  Y+APE +         YS   D W+LG+ + EM  G
Sbjct: 519 CDFGVSGNLVASLARTNIGCQS--YMAPERIKSLNPDKATYSVQSDIWSLGLSIVEMALG 576

Query: 565 LPPYYDENVPKMYKKILQ-----DPLVFPDGFDRDAKDLLIGLLSRDPQRRLGYNGADEI 619
             PY  E    ++ ++        P +  D F  DA+D +   L + P+RR  Y    E 
Sbjct: 577 AYPYPPETYDNIFSQLSAIVDGPPPRLPKDTFSSDAQDFVRLCLQKIPERRPTYASLLE- 635

Query: 620 KNHPFFSQLSWKRLLMKGYI 639
             HP+  +     + M  YI
Sbjct: 636 --HPWLKKYRGLDVHMSEYI 653

>CAGL0I04422g 394159..395427 some similarities with sp|P22209
           Saccharomyces cerevisiae YAR018c KIN3 ser/thr protein
           kinase, hypothetical start
          Length = 422

 Score = 92.8 bits (229), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 80/287 (27%), Positives = 131/287 (45%), Gaps = 69/287 (24%)

Query: 361 RNKP--LSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAE 418
           +N+P   +  D+ ++K IG+GSFG V +V    T+++   K I+  ++ SK E    +AE
Sbjct: 3   KNQPQHYARSDYQVVKEIGRGSFGSVHKVIHVPTQQVLVRKDIKYGHMNSK-ERQQLIAE 61

Query: 419 RTVLARIDCPFIVPLKFSF---QSQEKLYLVLACINGGEL---FYHLQREGRFDLSRSRF 472
            T+L+++    IV   +S+   + QE LYL +   + G+L     H ++E ++   +  +
Sbjct: 62  CTILSQLKHENIVEF-YSWDFNEQQEVLYLYMEYCSRGDLSGMIKHYKQEHKYIPEKVVW 120

Query: 473 -YAAELLCALDTLHKMD---------------------VIYRDLKPENILLDY------- 503
              A++L AL   H  +                     VI+RDLKP NI L Y       
Sbjct: 121 GILAQMLTALYKCHYGEELPSLTTIYDRMKPPSKGRNIVIHRDLKPGNIFLSYDDNSSDS 180

Query: 504 ------------------------------QGHIALCDFGLCKLNMKDEDKTDTFCGTPE 533
                                         Q  + + DFGL K      D   T+ GTP 
Sbjct: 181 TDKADIAQSNWYRKPNNRGGDESKLTTDYSQVVVKVGDFGLAKSLATSVDFATTYVGTPY 240

Query: 534 YLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKI 580
           Y++PE+L+ Q YS + D W+LG ++YEM +  PP+  +N  ++  KI
Sbjct: 241 YMSPEVLMDQPYSPLSDIWSLGCVIYEMCSLHPPFLAKNYLELQTKI 287

>KLLA0F01276g complement(120001..121560) similar to sp|P38147
           Saccharomyces cerevisiae YBR274w CHK1 regulats
           inhibitory Cdk phosphorylation of PDS1, start by
           similarity
          Length = 519

 Score = 93.6 bits (231), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 71/220 (32%), Positives = 111/220 (50%), Gaps = 28/220 (12%)

Query: 367 IDDFDLLKVIGKGSFGKVMQVR-KKDTKKIYALKAIR----KSYIVSKSEVTHTLAERT- 420
           ID   L + IGKGSF  V +   + D   + A+K I     +   +S+ +V   +   + 
Sbjct: 12  IDGLQLGRTIGKGSFAFVKRASLEVDPSTVIAVKFIHLPSCEKQGMSQEDVLREVKLHSR 71

Query: 421 ------VLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYA 474
                 VL  IDC    P          L++ +    GG+LF  ++ +   D   ++FY 
Sbjct: 72  CSNFVNVLKVIDCNLSDPF---------LWIAMELAEGGDLFDKIEPDIGVDSEVAQFYY 122

Query: 475 AELLCALDTLH-KMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFC---- 529
            +L+ A+  LH    V +RD+KPENILLD  G++ L DFGL  L  K +D +        
Sbjct: 123 KQLIKAISYLHDTCGVAHRDIKPENILLDKDGNLKLADFGLASL-FKRKDGSKRISRDQR 181

Query: 530 GTPEYLAPELLLGQG-YSKVVDWWTLGVLLYEMLTGLPPY 568
           G+  Y+APE++   G Y+ + D W++GVLL+ +LTG  P+
Sbjct: 182 GSLPYMAPEIIYCDGYYADMTDIWSIGVLLFVLLTGETPW 221

>KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20 ser/thr protein
           kinase of the pheromone pathway, hypothetical start
          Length = 989

 Score = 94.4 bits (233), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 103/211 (48%), Gaps = 25/211 (11%)

Query: 371 DLLKVIGKGSFGKVMQVRKKDTKKIYALKAI------RKSYIVSKSEVTHTLAERTVLAR 424
           +L+K IG+G+ G V    +  T    A+K +      +K  IV++  V        ++  
Sbjct: 700 NLIK-IGQGASGGVYTAYELGTNASVAIKQMNLEKQPKKELIVNEILVMKGSKHNNIVNF 758

Query: 425 IDCPFIVPLKFSFQSQEKLYLVLACINGGELF----YHLQREGRFDLSRSRFYAAELLCA 480
           ID         S+  +  L++V+  + GG L     + +  EG+         + E L  
Sbjct: 759 ID---------SYLFRGDLWVVMEYMEGGSLTDVVTHCILTEGQIGA-----VSRETLKG 804

Query: 481 LDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELL 540
           L  LH   VI+RD+K +NILL   G I L DFG C    +   K  T  GTP ++APE++
Sbjct: 805 LQFLHSKGVIHRDIKSDNILLSMNGDIKLTDFGFCAQINEVNLKRTTMVGTPYWMAPEVV 864

Query: 541 LGQGYSKVVDWWTLGVLLYEMLTGLPPYYDE 571
             + Y   VD W+LG+++ EM+ G PPY +E
Sbjct: 865 SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNE 895

>ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C
           (MKK2) - SH] complement(557738..559312) [1575 bp, 524
           aa]
          Length = 524

 Score = 93.2 bits (230), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 66/217 (30%), Positives = 102/217 (47%), Gaps = 13/217 (5%)

Query: 368 DDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDC 427
           D  + L V+G+G+ G V + + +   KI+ALK I  +    +        E         
Sbjct: 234 DQIEELGVLGEGAGGSVTKCKLRHGSKIFALKTI-TTLTTDQESQKQIFRELQFNKSCKS 292

Query: 428 PFIVPLKFSFQSQE--KLYLVLACINGGEL---FYHLQREG-RFDLSRSRFYAAELLCAL 481
            +IV     F  +E   +Y+ +  + G  L   + HL + G R         A  +L  L
Sbjct: 293 DYIVRYYGMFTDEEHSSIYIAMEYMGGRSLDAIYKHLLKHGGRVGEKVLGKIAESVLRGL 352

Query: 482 DTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLL 541
             LH+  +I+RD+KP+NILL+  G + LCDFG+    +       TF GT  Y+APE + 
Sbjct: 353 SYLHQRKIIHRDIKPQNILLNEAGQVKLCDFGVSGEAVN--SLATTFTGTSYYMAPERIQ 410

Query: 542 GQGYSKVVDWWTLGVLLYEMLTGLPPY----YDENVP 574
           GQ YS   D W+LG+ L E+     P+    +  N+P
Sbjct: 411 GQPYSVTSDVWSLGLTLLEVAQAHFPFDSGKFAANMP 447

>Scas_668.22
          Length = 893

 Score = 93.6 bits (231), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 69/242 (28%), Positives = 111/242 (45%), Gaps = 15/242 (6%)

Query: 376 IGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPFIVPLKF 435
           IG+G+ G V    +  + +  A+K +       K  +   + E  V+     P IV    
Sbjct: 617 IGQGASGGVYIANEIGSNESVAIKQMNLEKQPKKELI---INEILVMKGSRHPNIVNFID 673

Query: 436 SFQSQEKLYLVLACINGGELF----YHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIY 491
           S+     L++++  + GG L     + +  EG+           E L  L  LH   V++
Sbjct: 674 SYLLDGDLWVIMEYMEGGSLTDVVTHCILTEGQIGA-----VCRETLSGLQFLHSKGVLH 728

Query: 492 RDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVDW 551
           RD+K +NILL   G I L DFG C    +   K  T  GTP ++APE++  + Y   VD 
Sbjct: 729 RDIKSDNILLSISGDIKLTDFGFCAQINEINLKRTTMVGTPYWMAPEVVSRKEYGPKVDI 788

Query: 552 WTLGVLLYEMLTGLPPYYDENVPKMYKKILQD---PLVFPDGFDRDAKDLLIGLLSRDPQ 608
           W+LG+++ EM+ G PPY +E   +    I  +    L  P+      ++ L   L  DP+
Sbjct: 789 WSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPELKEPENLSAVLRNFLDWCLKVDPE 848

Query: 609 RR 610
           +R
Sbjct: 849 QR 850

>Scas_619.5*
          Length = 510

 Score = 92.4 bits (228), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 84/297 (28%), Positives = 144/297 (48%), Gaps = 55/297 (18%)

Query: 374 KVIGKGSFGKVMQVRKKD--------TKKIYALKAIR-KSYIVSKSEVTHTLAERTVLAR 424
           ++IG G+FG V+   KK         ++  +A+K I+ + Y V K        E  +L +
Sbjct: 172 RIIGNGTFGNVLVAFKKSEIVASDVYSRPNFAVKVIKLRKYKVDK--------EAKILLK 223

Query: 425 IDCPFIVPLKFSFQS--QEKLYLVLACINGGELFYHLQR-EGRFDLSRSR--FYAAELLC 479
           ++   I+ + ++F       LY+    I GG+LF +L + E    +S +       ++L 
Sbjct: 224 LNHANIIKIHYTFNDLMNNNLYIFQDLIPGGDLFSYLAKGECLTAISETETLIIVYQILK 283

Query: 480 ALDTLHKMDVIYRDLKPENILL---DYQGHIALCDFGLCK-LNMKDEDKTDTFCGTPEYL 535
           AL  +H   +++RDLK +NILL   +    I L DFG+ K L++K+  + +T  GTPEY 
Sbjct: 284 ALHYIHGRGIVHRDLKLDNILLCSPEPCTRIVLADFGIAKDLSLKNT-RMNTIVGTPEYC 342

Query: 536 APEL-------LLGQ-------------GYSKVVDWWTLGVLLYEMLTGLPPYY-DENVP 574
           APE+       ++ Q             GY    D W+LGV+ + MLTG+ P+Y D +  
Sbjct: 343 APEVGFKATRSIIDQSCSRANTIDQSMNGYDSKCDIWSLGVITHIMLTGISPFYGDGSEN 402

Query: 575 KMYKKILQDPLVFP----DGFDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQ 627
            + + + +  L F     +  + +AK  +  LL  D  +RL    + +   HP+ S+
Sbjct: 403 SIIQNVKRGKLDFSMKPWNNVNHNAKQFVEKLLEIDADKRL---DSKQSFQHPWISR 456

>CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces
           cerevisiae YOR231w MKK1 ser/thr protein kinase or
           sp|P32491 Saccharomyces cerevisiae YPL140c MKK2, start
           by similarity
          Length = 467

 Score = 92.0 bits (227), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 63/201 (31%), Positives = 98/201 (48%), Gaps = 11/201 (5%)

Query: 375 VIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLAR-IDCPFIVPL 433
           V+G+G+ G V + + +  KK++ALK I  + +    E    L       +     +IV  
Sbjct: 185 VLGEGAGGSVAKCKLRTGKKVFALKTI--NILNGDPEFQKQLLRELQFNKSFKSEYIVRY 242

Query: 434 --KFSFQSQEKLYLVLACINGG--ELFYH--LQREGRFDLSRSRFYAAELLCALDTLHKM 487
              F+ +    +Y+ +  + G   E  Y   L R GR         +  +L  L  LH+ 
Sbjct: 243 FGMFTDEQNSSIYIAMEYMGGKSLEAIYKELLSRGGRISEKVLGKISEAVLRGLSYLHEK 302

Query: 488 DVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSK 547
            VI+RD+KP+NILL+  G + LCDFG+    +       TF GT  Y+APE + GQ YS 
Sbjct: 303 KVIHRDIKPQNILLNEDGQVKLCDFGVSGEAVN--SLATTFTGTSYYMAPERIQGQPYSV 360

Query: 548 VVDWWTLGVLLYEMLTGLPPY 568
             D W+LG+ + E+  G  P+
Sbjct: 361 TCDVWSLGLTILEVAQGHFPF 381

>Kwal_26.7861
          Length = 955

 Score = 93.6 bits (231), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 77/269 (28%), Positives = 122/269 (45%), Gaps = 31/269 (11%)

Query: 371 DLLKVIGKGSFGKVMQVRKKDTKKIYALKAI------RKSYIVSKSEVTHTLAERTVLAR 424
           +L+K IG+G+ G V    +  T    A+K +      +K  I+++  V        ++  
Sbjct: 669 NLIK-IGQGASGGVYTAYEVGTNASVAIKQMNLEKQPKKELIINEILVMKASKHANIVNF 727

Query: 425 IDCPFIVPLKFSFQSQEKLYLVLACINGGELF----YHLQREGRFDLSRSRFYAAELLCA 480
           ID         S+  +  L++V+  + GG L     + +  EG+         + E L  
Sbjct: 728 ID---------SYLLRGDLWVVMEYMEGGSLTDVVTHCILTEGQIGA-----VSRETLKG 773

Query: 481 LDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELL 540
           L  LH   VI+RD+K +N+LL   G I L DFG C    +   K  T  GTP ++APE++
Sbjct: 774 LQFLHSKGVIHRDIKSDNVLLSMSGEIKLTDFGFCAQINEINLKRTTMVGTPYWMAPEVV 833

Query: 541 LGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQD---PLVFPDGFDRDAKD 597
             + Y   VD W+LG+++ EM+ G PPY +E   +    I  +    L   D    D K 
Sbjct: 834 SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPELKDADSLSDDLKS 893

Query: 598 LLIGLLSRDPQRRLGYNGADEIKNHPFFS 626
            L   L  +P  R     A ++ + PF S
Sbjct: 894 FLGWCLHVNPDERA---TASQLLSDPFIS 919

>AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH]
           (291129..292676) [1548 bp, 515 aa]
          Length = 515

 Score = 92.4 bits (228), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 84/305 (27%), Positives = 146/305 (47%), Gaps = 37/305 (12%)

Query: 367 IDDFDLLKVIGKGSFGKVMQVR-KKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARI 425
           I + +L + IG+G+F  V     + D + I A+K +      ++      L  R V+ + 
Sbjct: 12  IKELELGETIGQGTFAFVKTASLRADPQTIVAVKFVHVERCKARGMTDEDLT-REVVLQT 70

Query: 426 DCP---FIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALD 482
            C     +V +     S+E L++ +   +GG+LF  ++ +   D   +RFY  +L+ AL 
Sbjct: 71  RCAGHRHVVRVLDCNVSREYLWIAMELADGGDLFDKIEPDVGVDSEVARFYYQQLVRALT 130

Query: 483 TLHK-MDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKD-------EDKTDTFCGTPEY 534
            LH+   V +RD+KPEN+LLD  G++ + DFGL     +         D+     GT  Y
Sbjct: 131 HLHEACGVAHRDIKPENMLLDRAGNLKVADFGLATRFRRRDGTRRLARDRR----GTLPY 186

Query: 535 LAPELLLGQGY-SKVVDWWTLGVLLYEMLTGLPPYYDENVPK-MYKKILQDPLVFPDGFD 592
           LAPE++  + Y +   D W+ GVL++ +LTG  P+ + +V   M++  + D     DG  
Sbjct: 187 LAPEVVGERAYHADTADIWSAGVLVFVLLTGETPWSEPSVDDGMFRAFVADGGNLSDGPW 246

Query: 593 RDAKDLLIGLLSRDPQRRLGYNGA-DEIKNHPFF----------------SQLSWKRLLM 635
                + + LL +  Q+R        +++ HP+F                +QL+ +RLL 
Sbjct: 247 GKIGLVELNLLRKMLQQRPAARATLAQLRQHPWFKAPVVFADPDGMCADPAQLA-RRLLF 305

Query: 636 KGYIP 640
           K  +P
Sbjct: 306 KLRVP 310

>YHR030C (SLT2) [2317] chr8 complement(168882..170336)
           Serine/threonine protein kinase of MAP kinase family
           involved in the cell wall integrity (low-osmolarity)
           pathway and in G2 phase cell-cycle checkpoint control
           [1455 bp, 484 aa]
          Length = 484

 Score = 92.0 bits (227), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 85/319 (26%), Positives = 141/319 (44%), Gaps = 67/319 (21%)

Query: 362 NKPLSIDD-FDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVT-HTLAER 419
           N+  S+D  F L+K IG G++G V   R  +  +   +   + + + SK+ +   +L E 
Sbjct: 14  NQDFSVDKRFQLIKEIGHGAYGIVCSARFAEAAEDTTVAIKKVTNVFSKTLLCKRSLREL 73

Query: 420 TVLAR------IDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRS--- 470
            +L        I C + + + F              ING  L+  L       + +S   
Sbjct: 74  KLLRHFRGHKNITCLYDMDIVFYPD---------GSINGLYLYEELMECDMHQIIKSGQP 124

Query: 471 ------RFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDK 524
                 + +  ++LC L  +H  DV++RDLKP N+L++    + +CDFGL +   ++  +
Sbjct: 125 LTDAHYQSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVE 184

Query: 525 TDTF----CGTPEYLAPELLLG-QGYSKVVDWWTLGVLLYEMLTGLPPYY---------- 569
              F      T  Y APE++L  QGY+K +D W+ G +L E L G P +           
Sbjct: 185 NSQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSAGCILAEFLGGKPIFKGKDYVNQLNQ 244

Query: 570 ---------DENVPKMYKKILQD-----------PLV--FPDGFDRDAKDLLIGLLSRDP 607
                    DE + ++  K +QD           P V  +P+  +  A DLL  +L+ DP
Sbjct: 245 ILQVLGTPPDETLRRIGSKNVQDYIHQLGFIPKVPFVNLYPNA-NSQALDLLEQMLAFDP 303

Query: 608 QRRLGYNGADEIKNHPFFS 626
           Q+R+     DE   HP+ S
Sbjct: 304 QKRI---TVDEALEHPYLS 319

>Kwal_14.2497
          Length = 418

 Score = 91.3 bits (225), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 63/186 (33%), Positives = 103/186 (55%), Gaps = 14/186 (7%)

Query: 451 NGGELFYHLQREGRFDLSRSRFYAAELLCALDTLH-KMDVIYRDLKPENILLDYQGHIAL 509
           +GG+LF  ++ +   D   +RFY  +L+ A+D LH +  V +RD+KPEN+LLD +G++ L
Sbjct: 5   SGGDLFDKIEPDVGVDSEVARFYFKQLINAIDHLHNRCGVAHRDIKPENLLLDERGNLKL 64

Query: 510 CDFGLC-KLNMKDEDK---TDTFCGTPEYLAPELLLGQG-YSKVVDWWTLGVLLYEMLTG 564
            DFGL  +   KD  K   +DT    P Y+APE++  +  Y+   D W+ GVL++ +LTG
Sbjct: 65  ADFGLASQFKRKDGSKRIMSDTRGSLP-YMAPEIVYSKSYYADSTDIWSCGVLVFVLLTG 123

Query: 565 LPPYYDENVPKMYKKILQDPLVFPDG----FDRDAKDLLIGLLSRDPQRRLGYNGADEIK 620
             P+   +    +   L++      G     D    +LL  +L  DP RR     A+++K
Sbjct: 124 ETPWDSPSDDSRFDDFLENSGGIASGSWAKIDISQLNLLRKMLHPDPARRA---TAEQLK 180

Query: 621 NHPFFS 626
           +H ++S
Sbjct: 181 SHNWYS 186

>Kwal_33.14167
          Length = 838

 Score = 93.2 bits (230), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 75/300 (25%), Positives = 133/300 (44%), Gaps = 38/300 (12%)

Query: 369 DFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDC- 427
           +++ L+++G+G   KV +V+  +  K+YALK +        S +     E  +L +++  
Sbjct: 514 EYEKLELLGRGGTSKVYKVKNANNNKVYALKRVSFDEF-DDSSIDGFKGEIELLKKLETQ 572

Query: 428 PFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGR-FDLSRSRFYAAELLCALDTLHK 486
           P +V L         LY+V+ C +         R G   D+   R++A E+L  +  +H 
Sbjct: 573 PRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHD 632

Query: 487 MDVIYRDLKPENILLDYQGHIALCDFGLCK------LNMKDEDKTDTFCGTPEYLAPELL 540
             +++ DLKP N +   +G + + DFG+        +N+  E    T  GTP Y+APE L
Sbjct: 633 AGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRE----TQIGTPNYMAPEAL 687

Query: 541 LGQGYS-------------KVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKIL--QDPL 585
           +   Y+             K  D W+ G ++Y+M+ G PPY           I+  +  +
Sbjct: 688 VAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKI 747

Query: 586 VFP------DGFDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQLSWKRLLMKGYI 639
           V+P      D   + A D +   L R+P +R      +E+ N  F   +S     ++  I
Sbjct: 748 VYPEKTSNGDTVPKTAIDTMKACLERNPNKRW---TVEEVANGSFVKPVSVTHFFIRDLI 804

>CAGL0K01617g complement(142479..144803) similar to sp|P54199
           Saccharomyces cerevisiae YDL028c Serine/threonine
           protein kinase, start by similarity
          Length = 774

 Score = 92.8 bits (229), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 82/317 (25%), Positives = 143/317 (45%), Gaps = 47/317 (14%)

Query: 359 PSRNKPLSID--DFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTL 416
           PSR   +S++  +++ ++++G+G    V +VR    + +YALK +       +S V    
Sbjct: 434 PSRKNVVSVNGTEYERVELLGRGGSSNVYKVRGLKNR-VYALKKVSFDEF-DESSVEGFK 491

Query: 417 AERTVLARIDCPFIVPLKFSFQ-SQEKLYLVLACINGG-ELFYHLQREGRFDLSRSRFYA 474
            E ++L ++     V   + F+     LYL++ C +       H +    FD+   R++A
Sbjct: 492 GEISLLKQLQNQNRVVQLYDFEMGSGVLYLLMECGDYDLSQVLHQRANQPFDMEFIRYHA 551

Query: 475 AELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKT---DTFCGT 531
            E++  +  +H   +++ DLKP N +   +G + + DFG+    + D       D   GT
Sbjct: 552 REMVTCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANA-VPDHTVNIYRDMQIGT 609

Query: 532 PEYLAPELLLGQGYS-----------------KVVDWWTLGVLLYEMLTGLPPY------ 568
           P Y+APE L+   Y+                 K  D W+ G ++Y+M+ G PPY      
Sbjct: 610 PNYMAPEALVANNYTADNDGKYDQKTNKWKIGKPADIWSCGCIIYQMIYGKPPYAKYQGQ 669

Query: 569 ------YDENVPKMYKKILQDPLVFPDGFDRDAKDLLIGLLSRDPQRRLGYNGADEIKNH 622
                  D NV   YK++L D  V P      A +L+   L R+P+ R     A +I + 
Sbjct: 670 ERLLSIMDPNVKIEYKEVLPDKTVIPSL----ALELMQYCLMRNPEERW---SALQILDS 722

Query: 623 PFFSQLSWKRLLMKGYI 639
           PF + L   +  +K  I
Sbjct: 723 PFLNPLMVSQDFIKNLI 739

>Scas_640.16
          Length = 505

 Score = 91.7 bits (226), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 75/285 (26%), Positives = 123/285 (43%), Gaps = 24/285 (8%)

Query: 373 LKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPFIVP 432
           L V+G+G+ G V + + K  KK++ALK +  +             E          +IV 
Sbjct: 213 LGVLGEGAGGSVEKCKLKHGKKVFALKIVN-TLNTDPEFQKQIFRELQFNKSFKSDYIVR 271

Query: 433 LKFSFQ--SQEKLYLVLACINGG--ELFYH--LQREGRFDLSRSRFYAAELLCALDTLHK 486
               F   +   +Y+ +  + G   E  Y   L R GR         +  +L  L  LH+
Sbjct: 272 YYGMFNDVNSSSIYIAMEYMGGKSLEAVYKNLLSRGGRISEKVLGKISESVLRGLSYLHE 331

Query: 487 MDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYS 546
             VI+RD+KP+NIL + +G + LCDFG+    +       TF GT  Y+APE + GQ YS
Sbjct: 332 QKVIHRDIKPQNILFNEKGQVKLCDFGVSGEAVN--SLATTFTGTSFYMAPERIQGQPYS 389

Query: 547 KVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKI------------LQDPLVFPDGFDRD 594
              D W+LG+ + E+  G  P+  + +      I            L+D       + + 
Sbjct: 390 VTCDIWSLGLTILEVAQGRFPFGSDKITATIAPIELLVLILTFNPELKDEPELNITWSKA 449

Query: 595 AKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQLSWKRLLMKGYI 639
            K  +   L +DP  R       ++ +HP+      K++ M+ +I
Sbjct: 450 FKSFIHFCLKKDPHER---PSPRQMIDHPWIQGQMKKKVNMENFI 491

>KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces
           cerevisiae YNL298w CLA4 ser/thr protein kinase, start by
           similarity
          Length = 879

 Score = 92.8 bits (229), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 59/204 (28%), Positives = 100/204 (49%), Gaps = 13/204 (6%)

Query: 433 LKFSFQSQEKLYLVLACINGGELFYHLQRE-----GRFDLSRSR--FYAAELLCALDTLH 485
           L+   ++++ L++V+  + GG L   ++       G+  L+  +  +   E    L  LH
Sbjct: 663 LEAYLKTEDDLWVVMEYMEGGSLTDIIENSPTGSSGQSPLTEPQIAYIVRETCQGLKFLH 722

Query: 486 KMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGY 545
              +I+RD+K +N+LLD +G + + DFG C        K  T  GTP ++APE++  + Y
Sbjct: 723 DKHIIHRDIKSDNVLLDTRGRVKITDFGFCAKLTDKRSKRATMVGTPYWMAPEVVKQREY 782

Query: 546 SKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQD---PLVFPDGFDRDAKDLLIGL 602
            + VD W+LG++  EML   PPY +E   K    I  +    L  P+    + K  L   
Sbjct: 783 DEKVDVWSLGIMTIEMLESEPPYLNEEPLKALYLIATNGTPKLKHPEYLSLEIKRFLSVC 842

Query: 603 LSRDPQRRLGYNGADEIKNHPFFS 626
           L  D + R      +E+ +H FF+
Sbjct: 843 LCVDVKYRA---STEELLHHSFFN 863

>CAGL0M03729g complement(420316..422901) similar to sp|P48562
           Saccharomyces cerevisiae YNL298w CLA4, start by
           similarity
          Length = 861

 Score = 92.8 bits (229), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 97/204 (47%), Gaps = 13/204 (6%)

Query: 433 LKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRS-------RFYAAELLCALDTLH 485
           L+   ++++ L++V+  + GG L   ++       + S        +   E    L  LH
Sbjct: 645 LEAYLKTEDDLWVVMEYMEGGSLTDIIENSPTNGSAYSPLSEPQIAYIVRETCKGLKFLH 704

Query: 486 KMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGY 545
             ++I+RD+K +N+LLD +  + + DFG C        K  T  GTP ++APE++  + Y
Sbjct: 705 DKNIIHRDIKSDNVLLDTKARVKITDFGFCAKLTDQRSKRATMVGTPYWMAPEVVKQKEY 764

Query: 546 SKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQD---PLVFPDGFDRDAKDLLIGL 602
              VD W+LG++  EML G PPY +E+  K    I  +    L  P     + K  L   
Sbjct: 765 DAKVDVWSLGIMAIEMLEGEPPYLNEDPLKALYLIATNGTPKLKHPQSLSLEIKRFLSVC 824

Query: 603 LSRDPQRRLGYNGADEIKNHPFFS 626
           L  D + R      +E+ +H FF+
Sbjct: 825 LCVDVKYRA---STEELLHHSFFN 845

>ABR014W [605] [Homologous to ScYHL007C (STE20) - SH]
           complement(417710..420625) [2916 bp, 971 aa]
          Length = 971

 Score = 92.8 bits (229), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 64/207 (30%), Positives = 102/207 (49%), Gaps = 26/207 (12%)

Query: 376 IGKGSFGKVMQVRKKDTKKIYALKAI------RKSYIVSKSEVTHTLAERTVLARIDCPF 429
           IG+G+ G V    +  T    A+K +      +K  I+++  V        ++  ID   
Sbjct: 689 IGQGASGGVYTAYEIGTNASVAIKQMNLEKQPKKELIINEILVMKGSRHNNIVNFID--- 745

Query: 430 IVPLKFSFQSQEKLYLVLACINGGELF----YHLQREGRFD-LSRSRFYAAELLCALDTL 484
                 S+  +  L++++  + GG L     + +  EG+   +SR      E L  L  L
Sbjct: 746 ------SYLLKGDLWVIMEYMEGGSLTDVVTHCILTEGQIAAVSR------ETLRGLHFL 793

Query: 485 HKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQG 544
           H   VI+RD+K +NILL   G+I L DFG C    +   K  T  GTP ++APE++  + 
Sbjct: 794 HSKGVIHRDIKSDNILLSMDGNIKLTDFGFCAQINETNLKRTTMVGTPYWMAPEVVSRKE 853

Query: 545 YSKVVDWWTLGVLLYEMLTGLPPYYDE 571
           Y   VD W+LG+++ EM+ G PPY +E
Sbjct: 854 YGPKVDIWSLGIMIIEMIEGEPPYLNE 880

>AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W
           (RCK1) - SH] complement(289989..291593) [1605 bp, 534
           aa]
          Length = 534

 Score = 91.7 bits (226), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 84/308 (27%), Positives = 126/308 (40%), Gaps = 69/308 (22%)

Query: 370 FDLLKVIGKGSFGKVMQ-VRKKDTKKIY--------ALKAIRKSYIVSKSEVT------- 413
           + LL  IG+G+F +V + V  KD    Y        A+K I K  + + +  T       
Sbjct: 91  YKLLGKIGEGAFSEVYRAVPLKDGPNAYLSSRYKQVAVKVISKKRLSTTASTTGRRRDKR 150

Query: 414 ------------HTLAERTVLARIDCPFIVPLKFSFQSQEKLYLVL-ACINGGELFYHLQ 460
                         L E T+   +     +     FQ  E  Y ++   + GGE+F  + 
Sbjct: 151 EEAGENKATSREQVLKEITIHKAVSSGENIVTFIDFQETESYYFIVQELLAGGEIFGEIV 210

Query: 461 REGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENIL---LDY-------------- 503
           R   F    SR    +L  A+  +H + +++RD+KPEN+L   +D+              
Sbjct: 211 RLTYFSEDLSRHVIRQLALAVKHMHSLGIVHRDIKPENLLFSPIDFIPSKRQQLRQSDDP 270

Query: 504 -----------------QGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYS 546
                             G I L DFGL K        T T CGT  Y APE++  + YS
Sbjct: 271 KTKQDEGLFRPGIGGGGIGVIKLADFGLSKQIYAT--NTTTPCGTVGYTAPEVVKDERYS 328

Query: 547 KVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFP----DGFDRDAKDLLIGL 602
             VD W +G +LY +L G PP+YDE +  + + I +    F     D     AK+ +  L
Sbjct: 329 MKVDMWGIGCVLYTVLCGFPPFYDEKIDVLTELISKGQYTFLRPWWDEISPGAKNAVRRL 388

Query: 603 LSRDPQRR 610
           L  DP +R
Sbjct: 389 LEVDPDKR 396

>KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_1
           Kluyveromyces lactis MAP kinase, start by similarity
          Length = 495

 Score = 90.9 bits (224), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 81/312 (25%), Positives = 144/312 (46%), Gaps = 53/312 (16%)

Query: 362 NKPLSIDD-FDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVT-HTLAER 419
           N+  ++D  F L+K IG GS+G V   R  +      +   + + + SK+ +   +L E 
Sbjct: 16  NQDFTVDKRFQLIKEIGHGSYGIVCSARFTEAADETTVAIKKVTNVFSKTLLCKRSLREL 75

Query: 420 TVLAR------IDCPFIVPLKFSFQSQ-EKLYLVLACINGGELFYHLQREGR-FDLSRSR 471
            +L        I C + + + F        LYL    +      + + + G+    +  +
Sbjct: 76  KLLRHFRGHKNITCLYDMDIVFQPDGMFNGLYLYEELMECD--MHQIVKSGQPLTDAHYQ 133

Query: 472 FYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTF--- 528
            +  ++LC L  +H  DV++RDLKP N+L++    + +CDFGL +   ++  + + F   
Sbjct: 134 SFIYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVENNQFLTE 193

Query: 529 -CGTPEYLAPELLLG-QGYSKVVDWWTLGVLLYEMLTGLPPYY----------------- 569
              T  Y APE++L  QGY+K +D W+ G +L E+L G P +                  
Sbjct: 194 YVATRWYRAPEIMLSYQGYTKAIDVWSCGCILAELLGGKPIFKGKDYVDQLNRILQVLGT 253

Query: 570 --DENVPKMYKKILQDPL-------------VFPDGFDRDAKDLLIGLLSRDPQRRLGYN 614
             +E + ++  K +QD +             ++P+  + DA +LL G+LS DPQ R+   
Sbjct: 254 PPEETLKRIGSKNVQDYIHQLGYIPKIPFSTLYPNA-NPDALNLLEGMLSFDPQLRI--- 309

Query: 615 GADEIKNHPFFS 626
             D+   HP+ S
Sbjct: 310 TVDDALQHPYLS 321

>Scas_688.14
          Length = 479

 Score = 90.1 bits (222), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 85/317 (26%), Positives = 146/317 (46%), Gaps = 63/317 (19%)

Query: 362 NKPLSIDD-FDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVT-HTLAER 419
           N+  ++D  F L+K IG G++G V   R  +  +   +   + + + SKS +   +L E 
Sbjct: 14  NQDFTVDKRFQLIKEIGHGAYGIVCSARFAEAVEDTTVAIKKVTNVFSKSLLCKRSLREL 73

Query: 420 TVLAR------IDCPFIVPLKF----SFQSQEKLYL---VLACINGGELFYHLQREGRFD 466
            +L        I C + + + F    +F     LYL   ++ C    ++   ++      
Sbjct: 74  KLLRHFRGHKNITCLYDMDIVFYPDGTFNG---LYLYEELMEC----DMHQIIKSSQPLT 126

Query: 467 LSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTD 526
            +  + +  ++LC L  +H  DV++RDLKP N+L++    + +CDFGL +   ++  + +
Sbjct: 127 DAHYQSFIYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVENN 186

Query: 527 TF----CGTPEYLAPELLLG-QGYSKVVDWWTLGVLLYEMLTGLPPYY------------ 569
            F      T  Y APE++L  QGY+K +D W+ G +L E L G P +             
Sbjct: 187 QFLTEYVATRWYRAPEIMLSYQGYTKAIDIWSTGCILAEFLGGKPIFKGKDYVDQLTRIL 246

Query: 570 -------DENVPKMYKKILQD-----------PLV--FPDGFDRDAKDLLIGLLSRDPQR 609
                  DE + ++  K +QD           P V  +PD  +  A DLL  +L+ DPQ+
Sbjct: 247 QVLGTPPDETLRRIGSKNVQDYIHQLGYIPKVPFVNLYPDA-NPQALDLLEKMLAFDPQK 305

Query: 610 RLGYNGADEIKNHPFFS 626
           R+     DE   HP+ S
Sbjct: 306 RI---TTDEALEHPYLS 319

>ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH]
           (1386601..1388079) [1479 bp, 492 aa]
          Length = 492

 Score = 90.1 bits (222), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 81/299 (27%), Positives = 134/299 (44%), Gaps = 49/299 (16%)

Query: 374 KVIGKGSFGKVMQVRKKDTKKI-----YALKAIR---------KSYIVSKSEVT--HTLA 417
           +V+G G+FG+V+   +K          YA+K IR          S +V  + V+   T  
Sbjct: 147 QVVGSGTFGQVLVAERKSAHSKHRPLNYAVKVIRMKREALAKEASILVRLNHVSGIETTG 206

Query: 418 ERTVLARIDCPFIVPLKFSFQSQ-EKLYLVLACINGGELFYHLQRE---GRFDLSRSRFY 473
           E  VL R   P ++ +  +F  + + +Y+    + GG+LF +L ++        + +   
Sbjct: 207 EEHVLTRGQ-PNVIKVHDTFVDENDNIYIFEDLVAGGDLFSYLAKKDCLAPISETEALVI 265

Query: 474 AAELLCALDTLHKMDVIYRDLKPENILL---DYQGHIALCDFGLCKLNMKDEDKTDTFCG 530
             ++L AL  LH   +++RDLK +NILL   +    I L DFG+ K       +  T  G
Sbjct: 266 VYQILQALKFLHSKGIVHRDLKLDNILLCTPEPCSRIVLADFGIAKDLPSTRVRMHTIVG 325

Query: 531 TPEYLAPEL-----------------LLGQGYSKVVDWWTLGVLLYEMLTGLPPYY-DEN 572
           TPEY APE+                 +  QGY    D W+LGV+ + MLTG+ P+Y D  
Sbjct: 326 TPEYCAPEVGFRVDRNSYRNFSRTASMEQQGYDFKCDLWSLGVMTHIMLTGISPFYGDGT 385

Query: 573 VPKMYKKILQDPLVFPD----GFDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQ 627
              + + +    L F      G    AK  +  LL  + ++R+      +   HP+ ++
Sbjct: 386 EASIIRNVKIGKLNFGTKQWVGVSDTAKSFVRQLLEVNAEKRM---SVQDCFKHPWIAK 441

>Scas_713.21
          Length = 641

 Score = 90.9 bits (224), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 87/287 (30%), Positives = 136/287 (47%), Gaps = 39/287 (13%)

Query: 368 DDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTV--LARI 425
           ++  +++++GKG   KV +V+ + T K YALK I    +    E   T  ER +  L R+
Sbjct: 319 EELSIVELLGKGGSSKVYKVQDR-TGKYYALKQI---LLEELDENLKTDLEREIELLKRL 374

Query: 426 DCPFIVPLKFSFQSQEKLYLVLACINGGELFYHL-QREGR-FDLSRSRFYAAELLCALDT 483
                V     ++  +++  VL      +L + L +R  R FD++  R  + E++  +  
Sbjct: 375 AREERVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKA 434

Query: 484 LHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKT-----DTFCGTPEYLAPE 538
           +H  D+++ DLKP N +   +G + L DFG+     K  D T     +T  GTP Y+APE
Sbjct: 435 VHDSDIVHSDLKPANFIF-VKGTLKLIDFGIAN---KIADNTLNVYRNTQMGTPNYMAPE 490

Query: 539 LLLGQGYS-----------KVVDWWTLGVLLYEMLTGLPPY-----YDENVPKMYKKILQ 582
            L+ Q YS           K  D W+ G +LY+M  G PPY     +D  +  M   I  
Sbjct: 491 TLISQNYSNNNNNLLWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQI 550

Query: 583 D-PLVFPDG--FDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFS 626
           D P   P G    +    L+   L+RDPQ R      DEI++  FF+
Sbjct: 551 DYPNESPCGKKVPQSLVALIKTCLNRDPQLRA---TTDEIQHCSFFN 594

>Kwal_27.9773
          Length = 406

 Score = 89.4 bits (220), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 72/254 (28%), Positives = 121/254 (47%), Gaps = 42/254 (16%)

Query: 368 DDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDC 427
           +++ +L+ IG+GSFG V +V    T ++   K I+  ++ SK E    ++E  +L+++  
Sbjct: 17  NEYQVLEEIGRGSFGSVRKVVHVPTNRVLVRKEIKYGHMNSK-ERQQLISECAILSQLKH 75

Query: 428 PFIVPLKFSFQSQEKLYLVLA-CING--GELFYHLQREGRFDLSR-------------SR 471
             IV         + LY  +  C NG   ++  H ++E ++   R              R
Sbjct: 76  ENIVEFYEWDSDVDVLYFYMEYCSNGDLSQMISHFKKERKYIPERLVWSVMVQVLVALYR 135

Query: 472 FYAAELLCALDTLH-KMD--------VIYRDLKPENILL---------------DYQG-H 506
            +    L  L+T++ +M         VI+RDLKP NI L               DY    
Sbjct: 136 CHYGSDLAPLETIYDRMKPPVKGSNVVIHRDLKPGNIFLSTERVPDARVALQAFDYSKIS 195

Query: 507 IALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLP 566
           + L DFGL K      +   T+ GTP Y++PE+L+ Q YS + D W+LG ++YEM T  P
Sbjct: 196 VKLGDFGLAKSLGASVEFATTYVGTPYYMSPEVLMDQPYSPLSDIWSLGCVIYEMCTLRP 255

Query: 567 PYYDENVPKMYKKI 580
           P+  +   ++ ++I
Sbjct: 256 PFQAKTYTELQRRI 269

>ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C
           (TOS3) - SH] (273163..276708) [3546 bp, 1181 aa]
          Length = 1181

 Score = 91.3 bits (225), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 90/367 (24%), Positives = 151/367 (41%), Gaps = 87/367 (23%)

Query: 353 ISVDYKPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVS---- 408
           IS++Y P   + + ++ +++++ +G G  GKV       TK+  A+K + +         
Sbjct: 91  ISLEYDPISKRKV-LNTYEIIRELGSGQHGKVKLALDLVTKQHVAIKIVDRHGKKKSSWK 149

Query: 409 ------KSEVTHTLAERTVLARIDCPFIVPL--KFSFQSQEKLYLVLACINGGELFY--- 457
                 + E      E  ++ + D   +V L          K+YLVL   + GE+ +   
Sbjct: 150 LKKTPVREESEKIRREIAIMKKCDHEHVVKLIEVLDDMKSRKIYLVLEYCSKGEVKWCPG 209

Query: 458 -HLQREGR----FDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDF 512
             L+   R        R+R     ++  L+ LH   +I+RD+KP N+LL     + + DF
Sbjct: 210 DQLEAAARGPPLLTFQRTREILRGVVLGLEYLHYQGIIHRDIKPANLLLSEHDIVKISDF 269

Query: 513 GLCKLNMK-----------------------DEDKTDTFCGTPEYLAPELLLGQ-GYSK- 547
           G+   +                         D+ +     GTP + APE+ LG   Y K 
Sbjct: 270 GVSLASSNSGTPSSRSSSSSSVKGVLGAEGPDDLELAKTAGTPAFFAPEICLGSDAYEKL 329

Query: 548 ----------------VVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFP--- 588
                           ++D W LGV LY +L G  P+  E   ++++KI+ DPL FP   
Sbjct: 330 NIDRQSNPCSGSLISYMIDIWALGVTLYCLLFGKLPFIAEYEMELFEKIVNDPLEFPRLE 389

Query: 589 ----DGFDR--------DAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFS-------QLS 629
               +G            A+DLL  LL ++P +R+      +IK HPF          LS
Sbjct: 390 FMQSNGVSMISCKEEYLSAQDLLNKLLEKNPMQRINIV---DIKAHPFVCWDFDHVDGLS 446

Query: 630 WKRLLMK 636
            +R+ M+
Sbjct: 447 GQRISMR 453

>KLLA0D09328g complement(788565..791705) some similarities with
           sp|P38990 Saccharomyces cerevisiae YER129w PAK1 DNA
           polymerase alpha suppressing protein kinase,
           hypothetical start
          Length = 1046

 Score = 90.5 bits (223), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 78/335 (23%), Positives = 148/335 (44%), Gaps = 69/335 (20%)

Query: 353 ISVDYKPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKS-------- 404
           +S++Y P   + + ++ +++++ +G G  GKV   R   TK++ A+K + +         
Sbjct: 99  VSLEYDPISKRKV-LNTYEIIEELGHGQHGKVKLARDLVTKQLVAIKIVNRHKKRTFNDK 157

Query: 405 ----YIVSKSEVTHTLAERTVLARIDCPFIVPLKF----SFQSQEKLYLVLACINGGELF 456
               +   +S +     +R +     C     +K           K+YLVL   + GE+ 
Sbjct: 158 FSNRFKTPQSGIEDEKIKREIAIMKKCHHEHVVKLIEVLDDAKSRKIYLVLEYCSKGEIK 217

Query: 457 YH----LQREGR----FDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIA 508
           +     ++ + R        R+R     +L  L+ LH   +I+RD+KP N+LL   G + 
Sbjct: 218 WCPGDVIETKARGPPLLSFQRTREIFRGVLLGLEYLHFQGIIHRDIKPANLLLSEDGIVK 277

Query: 509 LCDFGLCKLNMKDEDKTDTF--------CGTPEYLAPELLLGQGYSKV------------ 548
           + DFG+  L    +  TD+          GTP + APE+ L +   K             
Sbjct: 278 ISDFGVS-LAFSSDSSTDSLNELELAKTAGTPAFFAPEICLVEDTIKKFDLDPNSKEPII 336

Query: 549 ---VDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDR------------ 593
               D W +G+ L+ +L G+ P+  +   +++ KI+ +PLVF + + +            
Sbjct: 337 SFPTDIWAMGITLHCLLFGMLPFISDYELELFDKIVNEPLVF-EPYQKIEQCQVSQVECK 395

Query: 594 ----DAKDLLIGLLSRDPQRRLGYNGADEIKNHPF 624
               +A++LL  LL ++P++R+    A   K HP+
Sbjct: 396 EEYEEAQNLLNKLLEKNPKKRMAIQDA---KKHPW 427

>Kwal_23.5290
          Length = 819

 Score = 90.1 bits (222), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 96/203 (47%), Gaps = 13/203 (6%)

Query: 433 LKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRS-------RFYAAELLCALDTLH 485
           L+   ++++ L++V+  + GG L   ++       S S        +   E    L  LH
Sbjct: 603 LEAYLKTEDDLWVVMEYMEGGSLTDLIENSPANGSSHSPLTEPQIAYIVRETCQGLKFLH 662

Query: 486 KMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGY 545
              +I+RD+K +N+LLD +  + + DFG C        K  T  GTP ++APE++  + Y
Sbjct: 663 DKHIIHRDIKSDNVLLDNRARVKITDFGFCAKLTDKRSKRATMVGTPYWMAPEVVKQREY 722

Query: 546 SKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQD---PLVFPDGFDRDAKDLLIGL 602
            + VD W+LG++  EML G PPY +E+  K    I  +    L  P+      K  L   
Sbjct: 723 DEKVDVWSLGIMTIEMLEGEPPYLNEDPLKALYLIATNGTPKLKQPEVLSLKIKRFLSVC 782

Query: 603 LSRDPQRRLGYNGADEIKNHPFF 625
           L  D + R      +E+ +H FF
Sbjct: 783 LCVDVKYRA---STEELLHHSFF 802

>Kwal_23.5576
          Length = 504

 Score = 89.4 bits (220), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 83/312 (26%), Positives = 146/312 (46%), Gaps = 53/312 (16%)

Query: 362 NKPLSIDD-FDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVT-HTLAER 419
           N+  ++D  F L+K IG G++G V   R  +  +   +   + + + SK+ +   +L E 
Sbjct: 14  NQEFTVDKRFQLIKEIGHGAYGIVCSARFIEAAEETNVAIKKVTNVFSKTLLCKRSLREL 73

Query: 420 TVLAR------IDCPFIVPLKFSFQSQ-EKLYLVLACINGGELFYHLQREGR-FDLSRSR 471
            +L        I C + + + FS  +    LYL    +      + + + G+    +  +
Sbjct: 74  KLLRHFRGHKNITCLYDMDIVFSPNNTFNGLYLYEELMECD--IHQIIKSGQPLTDAHYQ 131

Query: 472 FYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTF--- 528
            +  +LLCAL  +H  DV++RDLKP N+L++    + +CDFGL +   ++  + + F   
Sbjct: 132 SFIYQLLCALKYIHSADVLHRDLKPGNLLVNADCQLKVCDFGLARGYSENPVENNQFLTE 191

Query: 529 -CGTPEYLAPELLLG-QGYSKVVDWWTLGVLLYEMLTGLPPYY----------------- 569
              T  Y APE++L  QGY+K +D W+ G +L E+L G P +                  
Sbjct: 192 YVATRWYRAPEIMLSYQGYTKAIDIWSCGCILAELLGGKPIFKGKDYVDQLNRILQVLGT 251

Query: 570 --DENVPKMYKKILQD-----------PLV--FPDGFDRDAKDLLIGLLSRDPQRRLGYN 614
             +E + ++  K +QD           P V  +P   +  A DLL  +L+ DPQ+R+   
Sbjct: 252 PPEETLERIGSKNVQDYIHQLGYIPKVPFVTLYPQA-NVQALDLLEKMLTFDPQKRI--- 307

Query: 615 GADEIKNHPFFS 626
             +E   HP+ S
Sbjct: 308 TVEEALEHPYLS 319

>Kwal_55.20326
          Length = 750

 Score = 90.1 bits (222), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 74/273 (27%), Positives = 120/273 (43%), Gaps = 41/273 (15%)

Query: 376 IGKGSFGKVMQVRKKDTKKIYALK-------------------------------AIRKS 404
           IG GSFG V       T ++ A+K                               A++ S
Sbjct: 464 IGSGSFGSVYLGMNAQTGELMAVKQVELQPTAVAAGVVSVPDEVKKQYNQNANGSAVKNS 523

Query: 405 YIVSKSEVTHTLAERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGR 464
             V +  V     E  +L  +    IV    S Q    L + L  + GG +   L   G 
Sbjct: 524 SQVHRKMVDALQHEMGLLKELQHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLNSYGP 583

Query: 465 FDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCK----LNMK 520
           F+    R +  ++L  L  LH+ D+I+RD+K  NIL+D +G + + DFG+ K    LN +
Sbjct: 584 FEEPLIRNFTRQILIGLSYLHRKDIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNQQ 643

Query: 521 DEDKTDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKI 580
            ++K  +  G+  ++APE++     +K  D W++G ++ EM TG  P+ D +  +   KI
Sbjct: 644 -QNKRASLQGSVYWMAPEVVKQVVTTKKADIWSVGCVIIEMFTGKHPFPDFSQMQAIFKI 702

Query: 581 LQDPLVFPDG---FDRDAKDLLIGLLSRDPQRR 610
             +   FPD       +AKD L+     D ++R
Sbjct: 703 GTN--TFPDSPSWSSNEAKDFLLKTFELDYRKR 733

>AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH]
           (1043479..1044750) [1272 bp, 423 aa]
          Length = 423

 Score = 88.2 bits (217), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 81/298 (27%), Positives = 134/298 (44%), Gaps = 56/298 (18%)

Query: 368 DDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDC 427
           ++F +L+ IG+GSFG V +V    T K+   K I+  ++ SK E    +AE T+LA +  
Sbjct: 25  NEFKVLEEIGRGSFGSVRKVLHVPTSKLMVRKEIKYGHMNSK-ERQQLIAECTILAGLRH 83

Query: 428 PFIVPL------------KFSFQSQEKLYLVL---ACINGGELFYHLQREGRFDLSRSRF 472
             IV                 + + E LYL +   +C +  ++  H +   ++   R  +
Sbjct: 84  ENIVEFYNWDHASSRTGNSVDYGNGEVLYLYMEYCSCGDLSQMIKHYKGMRKYVPERDIW 143

Query: 473 -YAAELLCALDTLH------KMDVIY--------------------RDLKPENILLDYQG 505
             A +LL AL   H      ++D IY                    RDLKP NI L   G
Sbjct: 144 RIAVQLLLALYKCHTSCDLPQLDTIYDKISKSAIESEAGKVTSVIHRDLKPGNIFLTGDG 203

Query: 506 ------------HIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVDWWT 553
                        + L DFGL K      +   T+ GTP Y++PE+L+ Q YS + D W+
Sbjct: 204 VGGRGSVDYSKVEVKLGDFGLAKSLQSAIEFATTYVGTPYYMSPEVLMDQPYSPLSDIWS 263

Query: 554 LGVLLYEMLTGLPPYYDENVPKMYKKILQ-DPLVFPDGFDRDAKDLLIGLLSRDPQRR 610
           LG ++YE+     P+   N  ++ + I + D    PD + ++ + L+I  ++ + + R
Sbjct: 264 LGCVIYELCALRVPFPARNFMELQRMIQRADVQPLPDYYSKELQQLVISCINPNEKLR 321

>Scas_598.6
          Length = 790

 Score = 89.4 bits (220), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 69/262 (26%), Positives = 116/262 (44%), Gaps = 22/262 (8%)

Query: 375 VIGKGSFGKVMQVRKK-DTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPFIVPL 433
            I  G F +  +V  K   K++   K  RK  IV++  V      + ++  ++       
Sbjct: 523 AIPPGEFDETPEVGDKVAIKQMILSKQPRKELIVNEILVMKDSRHKNIVNFLEA------ 576

Query: 434 KFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRS-------RFYAAELLCALDTLHK 486
               ++++ L++V+  + GG L   ++       S S        +   E    L  LH 
Sbjct: 577 --YLKTEDDLWVVMEFMEGGSLTDIIENSPATGSSSSPLTEPQIAYIVRETCQGLKFLHD 634

Query: 487 MDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYS 546
             +I+RD+K +N+LLD    + + DFG C        K  T  GTP ++APE++  + Y 
Sbjct: 635 KHIIHRDIKSDNVLLDNNARVKITDFGFCAKLTDQRSKRATMVGTPYWMAPEVVKQREYD 694

Query: 547 KVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQD---PLVFPDGFDRDAKDLLIGLL 603
           + VD W+LG++  EML   PPY +E+  K    I  +    L  P+    + K  L   L
Sbjct: 695 EKVDVWSLGIMTIEMLESEPPYLNEDPLKALYLIATNGTPKLKNPESLSLEIKRFLSVCL 754

Query: 604 SRDPQRRLGYNGADEIKNHPFF 625
             D + R      +E+ +H FF
Sbjct: 755 CVDVRYRA---STEELLHHGFF 773

>CAGL0M11748g 1167306..1168649 highly similar to sp|P32485
           Saccharomyces cerevisiae YLR113w HOG1, start by
           similarity
          Length = 447

 Score = 88.2 bits (217), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 91/337 (27%), Positives = 144/337 (42%), Gaps = 73/337 (21%)

Query: 373 LKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERT-----VLARIDC 427
           L  +G G+FG V       T +  A+K I K +       T  LA+RT     +L  +  
Sbjct: 26  LNPVGMGAFGLVCSATDTLTNQQVAIKKIMKPF------ATAVLAKRTYRELKLLKHLRH 79

Query: 428 PFIVPLKFSFQSQ-EKLYLVLACINGGELFYHLQR---EGRFDLSRSRFYAAELLCALDT 483
             ++ L+  F S  E +Y V   + G +L   LQ    E +F     +++  ++L  L  
Sbjct: 80  ENLICLQDIFLSPLEDIYFVTE-LQGTDLHRLLQTRPLEKQF----VQYFHYQILRGLKY 134

Query: 484 LHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLG- 542
           +H   V++RDLKP NIL++    + +CDFGL ++    + +   +  T  Y APE++L  
Sbjct: 135 VHSAGVVHRDLKPSNILINENCDLKICDFGLARIQ---DPQMTGYVSTRYYRAPEIMLTW 191

Query: 543 QGYSKVVDWWTLGVLLYEMLTGLPPY---------------------------YDENVPK 575
           Q Y   VD W+ G +  EM+ G P +                             EN  K
Sbjct: 192 QKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPSDVIDTICSENTLK 251

Query: 576 MYKKI-LQDPLVFPDGF---DRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQLSWK 631
               +  +DP+ F + F   + DA DLL  +L  DP++R+    AD +  HP        
Sbjct: 252 FVTSLPHRDPIPFSERFKTVEPDAVDLLEKMLVFDPKKRI--TAADALA-HP-------- 300

Query: 632 RLLMKGYIPPYKPPVTSATDTSNFDQEFT-REKPIDS 667
                 Y+ PY  P       + FD  F   + P+D+
Sbjct: 301 ------YLAPYHDPTDEPVAEAKFDWHFNDADLPVDT 331

>CAGL0D02244g complement(229504..230967) similar to sp|P24719
           Saccharomyces cerevisiae YOR351c MEK1 ser/thr protein
           kinase, hypothetical start
          Length = 487

 Score = 88.6 bits (218), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 85/315 (26%), Positives = 146/315 (46%), Gaps = 51/315 (16%)

Query: 354 SVDYKPSRNKPLSIDDFDLLK-VIGKGSFGKVM-----------QVRKKDTKKIYALKAI 401
           S+  K + N   ++D++++   V+G G+FG V+           +  +K T K YA+K +
Sbjct: 136 SLPKKITINYTENVDNWNISNIVVGNGTFGYVLIAYMGIGAHSGKSSQKITPKCYAVKIV 195

Query: 402 RKSYIVSKSEVTHTLAERTVLARIDCPFIVPL-KFSFQSQEKLYLVLACINGGELFYHLQ 460
                  K +++    E  +L +++ P I+ + K        LY+    I GG+LF +L 
Sbjct: 196 -------KMKLSKLDKEAKILMQLNHPNIIKVFKTHTDKSNNLYIFQELIPGGDLFSYLA 248

Query: 461 R-EGRFDLSRSR--FYAAELLCALDTLHKMDVIYRDLKPENILL---DYQGHIALCDFGL 514
           + +    +S++    +  ++L AL  LH   +++RDLK +NILL   +    I L DFG+
Sbjct: 249 KGDCLMPISQTEALVFVYQILHALKYLHTKGIVHRDLKLDNILLCTPEPFTKIVLADFGI 308

Query: 515 CKLNMKDEDKTDTFCGTPEYLAPEL-----------------LLGQGYSKVVDWWTLGVL 557
            +     + +  T  GTPEY APE+                 L  QGY    D W+LGV+
Sbjct: 309 ARTVTTMKSRMFTVVGTPEYCAPEVGFKANRKAYHSFFRAATLEQQGYDSKCDLWSLGVI 368

Query: 558 LYEMLTGLPPYYDEN-----VPKMYKKILQDPLVFPDGFDRDAKDLLIGLLSRDPQRRLG 612
            + MLTG+ P+Y +      V      IL   +      D  A++ +  LL  +  +RL 
Sbjct: 369 THIMLTGISPFYGDGTEQSIVENAKAGILNFNVSQWSTIDIMAQNFVSKLLEVNVDKRL- 427

Query: 613 YNGADEIKNHPFFSQ 627
               ++  NH + S+
Sbjct: 428 --DCEQCFNHLWISK 440

>Scas_700.35
          Length = 439

 Score = 87.4 bits (215), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 62/204 (30%), Positives = 99/204 (48%), Gaps = 12/204 (5%)

Query: 373 LKVIGKGSFGKVMQVR-KKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLAR-IDCPFI 430
           L ++G+G+ G V + R +K++ +++ALK I    + +  E    L       +     +I
Sbjct: 152 LGMLGEGAGGSVAKCRLRKNSSQVFALKTINT--LNTDPEFQKQLFRELEFNKSFKSNYI 209

Query: 431 VPLKFSFQS--QEKLYLVLACINGGEL--FYH--LQREGRFDLSRSRFYAAELLCALDTL 484
           V     F       +Y+ +  + G  L   Y   L R GR         A  +L  L  L
Sbjct: 210 VTYYGMFNDTLNGSIYIAMEYMGGQSLDTIYKSLLSRGGRIGEKILGKIAESVLRGLSYL 269

Query: 485 HKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQG 544
           H+  +I+RD+KP+NILL+ +G + LCDFG+    +       TF GT  Y+APE + G  
Sbjct: 270 HERKIIHRDIKPQNILLNEEGEVKLCDFGVSGEAVN--SLATTFTGTSFYMAPERIQGHP 327

Query: 545 YSKVVDWWTLGVLLYEMLTGLPPY 568
           YS   D W+LG+ + E+  G  P+
Sbjct: 328 YSVTCDVWSLGLTILEVAQGRFPF 351

>Scas_623.11
          Length = 378

 Score = 87.0 bits (214), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 67/220 (30%), Positives = 113/220 (51%), Gaps = 20/220 (9%)

Query: 360 SRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAER 419
           S N P++I  F   ++IGKGSFG V     ++T ++ A+K + +       E+       
Sbjct: 38  SNNDPITIT-FPTTEIIGKGSFGLVFCTTIRETDEVVAIKKVLQDRRFKNREL------- 89

Query: 420 TVLARIDCPFIVPLKFSFQSQ---EKLYLVLACINGGELFYHLQR---EGRFDLSR--SR 471
            ++  I  P ++ LK+ F  +   +++YL L      +  Y   R     R  +SR   +
Sbjct: 90  EIMKLIQHPNVINLKYYFYEKDVDDEVYLNLILDYMPQSLYQRLRHFVHQRQSMSRLEIK 149

Query: 472 FYAAELLCALDTLHKM-DVIYRDLKPENILLDYQG-HIALCDFGLCKLNMKDEDKTDTFC 529
           FY  +L  +L+ LH   +V +RD+KP+NIL+D    ++ LCDFG  K  +K  +   ++ 
Sbjct: 150 FYMFQLFKSLNYLHNAKNVCHRDIKPQNILVDPNSWNLKLCDFGSAK-QLKPTEPNVSYI 208

Query: 530 GTPEYLAPELLLGQ-GYSKVVDWWTLGVLLYEMLTGLPPY 568
            +  Y APEL+ G   YS  +D W+ G ++ E+L G P +
Sbjct: 209 CSRYYRAPELIFGATNYSNQIDIWSSGCVMAELLLGQPMF 248

>YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase
            kinase kinase (MAPKKK) with strong similarity to Ssk2p,
            participates in the high-osmolarity signal transduction
            pathway [3996 bp, 1331 aa]
          Length = 1331

 Score = 89.0 bits (219), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 65/213 (30%), Positives = 99/213 (46%), Gaps = 20/213 (9%)

Query: 376  IGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAER-TVLARIDCPFIVPLK 434
            IG G+FG+V      +  +I A+K I+     +  ++   + E  TVL  ++ P IV   
Sbjct: 1040 IGGGTFGQVYSAINLENGEILAVKEIKIHDTTTMKKIFPLIKEEMTVLEMLNHPNIVQYY 1099

Query: 435  FSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDL 494
                 ++K+ + +    GG L   L      D   ++ Y  ELL  L  LH+  V++RD+
Sbjct: 1100 GVEVHRDKVNIFMEYCEGGSLASLLDHGRIEDEMVTQVYTFELLEGLAYLHQSGVVHRDI 1159

Query: 495  KPENILLDYQGHIALCDFGLCKLNMKDEDKT----------------DTFCGTPEYLAPE 538
            KPENILLD+ G I   DFG  +  +    +T                +   GTP Y+APE
Sbjct: 1160 KPENILLDFNGIIKYVDFGTARTVVGSRTRTVRNAAVQDFGVETKSLNEMMGTPMYMAPE 1219

Query: 539  LLLG---QGYSKVVDWWTLGVLLYEMLTGLPPY 568
             + G   +G     D W LG ++ EM TG  P+
Sbjct: 1220 TISGSAVKGKLGADDVWALGCVVLEMATGRRPW 1252

>Kwal_33.13222
          Length = 148

 Score = 81.3 bits (199), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 38/112 (33%), Positives = 67/112 (59%), Gaps = 1/112 (0%)

Query: 437 FQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKP 496
           +++   LY+VL  +  GELF  L   G    + +  +  +++  +   H + +++RDLKP
Sbjct: 16  WETNSNLYMVLEYVEKGELFNLLVERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKP 75

Query: 497 ENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKV 548
           EN+LLD++ +I + DFG+  L  KD+   +T CG+P Y APE++ G   S++
Sbjct: 76  ENLLLDHKFNIKIADFGMAALESKDK-LLETSCGSPHYAAPEIVSGTALSRL 126

>YAR018C (KIN3) [73] chr1 complement(170393..171700)
           Serine/threonine protein kinase [1308 bp, 435 aa]
          Length = 435

 Score = 86.7 bits (213), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 80/278 (28%), Positives = 124/278 (44%), Gaps = 67/278 (24%)

Query: 369 DFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCP 428
           ++ +L+ IG+GSFG V +V    TKK+   K I+  ++ SK E    +AE ++L+++   
Sbjct: 24  EYQVLEEIGRGSFGSVRKVIHIPTKKLLVRKDIKYGHMNSK-ERQQLIAECSILSQLKHE 82

Query: 429 FIVPL-KFSFQSQ-EKLYLVLACINGGEL---FYHLQREGRFDLSRSRF-YAAELLCALD 482
            IV    + F  Q E LYL +   + G+L     H ++E ++   +  +   A+LL AL 
Sbjct: 83  NIVEFYNWDFDEQKEVLYLYMEYCSRGDLSQMIKHYKQEHKYIPEKIVWGILAQLLTALY 142

Query: 483 TLH---------------------KMDVIYRDLKPENILLDYQ-----------GH---- 506
             H                     K  VI+RDLKP NI L Y            GH    
Sbjct: 143 KCHYGVELPTLTTIYDRMKPPVKGKNIVIHRDLKPGNIFLSYDDSDYNINEQVDGHEEVN 202

Query: 507 ------------------------IALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLG 542
                                   + L DFGL K          T+ GTP Y++PE+L+ 
Sbjct: 203 SNYYRDHRVNSGKRGSPMDYSQVVVKLGDFGLAKSLETSIQFATTYVGTPYYMSPEVLMD 262

Query: 543 QGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKI 580
           Q YS + D W+LG +++EM +  PP+  +N  ++  KI
Sbjct: 263 QPYSPLSDIWSLGCVIFEMCSLHPPFQAKNYLELQTKI 300

>Kwal_56.23841
          Length = 432

 Score = 86.7 bits (213), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 90/337 (26%), Positives = 145/337 (43%), Gaps = 73/337 (21%)

Query: 373 LKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERT-----VLARIDC 427
           L  +G G+FG V       T +  A+K I K +       T  LA+RT     +L  +  
Sbjct: 26  LNPVGMGAFGLVCSANDTYTNQSVAIKKIMKPF------STAVLAKRTYRELKLLKHLRH 79

Query: 428 PFIVPLKFSFQSQ-EKLYLVLACINGGELFYHLQR---EGRFDLSRSRFYAAELLCALDT 483
             ++ L+  F S  E +Y V   + G +L   LQ    E +F     +++  ++L  L  
Sbjct: 80  ENLICLEDIFLSPLEDIYFVTE-LQGTDLHRLLQTRPLEKQF----VQYFLYQILRGLKY 134

Query: 484 LHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLG- 542
           +H   VI+RDLKP NIL++    + +CDFGL ++    + +   +  T  Y APE++L  
Sbjct: 135 VHSAGVIHRDLKPSNILINENCDLKICDFGLARIQ---DPQMTGYVSTRYYRAPEIMLTW 191

Query: 543 QGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKIL--------------------- 581
           Q Y+  VD W+ G +  EM+ G P +  ++    +  I                      
Sbjct: 192 QKYNVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPEDVINTICSVNTLK 251

Query: 582 -------QDPLVFPDGF---DRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQLSWK 631
                  +DP+ F + F   + DA DLL  +L  DP +R+    AD + +HP        
Sbjct: 252 FVTSLPHRDPVPFSERFKNVEPDAVDLLEKMLVFDPNKRI--TAADAL-SHP-------- 300

Query: 632 RLLMKGYIPPYKPPVTSATDTSNFDQEFT-REKPIDS 667
                 Y+ PY  P       + FD  F   + P+D+
Sbjct: 301 ------YLAPYHDPTDEPVADAKFDWHFNDADLPVDT 331

>Scas_602.11
          Length = 1186

 Score = 88.2 bits (217), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 90/417 (21%), Positives = 169/417 (40%), Gaps = 107/417 (25%)

Query: 312 NQDVHLDSFQLPVNLLI----DSAATIRLYNHHWVELRDGLGKIN--------ISVDYKP 359
           N  +H +    P + LI    +  A    +N+ +  L + LG+ +        IS+ Y P
Sbjct: 103 NHPLHQEHISSPASTLIYNNSNRTAPFNTFNNKFATLDEKLGRTSTKVKETNRISLTYDP 162

Query: 360 SRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKS--------YIVSKSE 411
              + + ++ ++++K +G G  GKV   +   T ++ A+K + +         +  +K +
Sbjct: 163 ISKRKV-LNTYEIIKELGHGQHGKVKLAKDLLTSQLVAIKIVDRHEKLRLTNFFKFNKRK 221

Query: 412 VTH---TLAERTVLARIDCPFIVPLKFSFQ--SQEKLYLVLACINGGELFYH----LQRE 462
             +      E  ++ ++    +V L          K+YLVL     GE+ +     L+ E
Sbjct: 222 QQNDDRIKREIAIMKKLHHKHVVKLIEVLDDLKSRKIYLVLEYCAQGEIKWCPKDCLETE 281

Query: 463 GR----FDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLC--- 515
            +         +R     ++  L+ LH   +I+RD+KP N+L+D +G + + DFG+    
Sbjct: 282 AKGPPLLSFQSAREIIRGVILGLEYLHYQGIIHRDIKPANLLVDEEGTVKISDFGVSLAS 341

Query: 516 ------------------------------KLNMKDEDKTDTF-----CGTPEYLAPELL 540
                                           N  D++  D        GTP + APE+ 
Sbjct: 342 RSSGNSTANSSSVLGGTPRNLSRSSTESMNTTNNNDDESIDEVELAKTAGTPAFFAPEIC 401

Query: 541 LGQ-GYSK----------------VVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQD 583
           LG+  + K                ++D W LG+  Y +L G+ P+  +   ++++KI+ +
Sbjct: 402 LGEEAFDKFSLRKNEMFKGSCISFMIDIWALGITFYCLLFGMLPFISDFELELFEKIVGE 461

Query: 584 PLVFPDGFD---------------RDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFF 625
           PL FP   +                 AK++L  LL ++P +R       E+K HPF 
Sbjct: 462 PLTFPSYEELQANRVSNVCSIEEYEAAKNVLQRLLEKNPSKRCSI---LELKYHPFI 515

>AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -
           SH] (1066272..1067981) [1710 bp, 569 aa]
          Length = 569

 Score = 87.0 bits (214), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 78/310 (25%), Positives = 140/310 (45%), Gaps = 66/310 (21%)

Query: 370 FDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVT-HTLAERTVLAR---- 424
           F L+K IG G++G V   R  ++ +   +   + + + SK+ +   +L E  +L      
Sbjct: 23  FQLIKEIGYGAYGIVCSARFMESVEDTTVAIKKVTNVFSKALLCKRSLRELKLLRHFRGH 82

Query: 425 --IDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRS---------RFY 473
             I C + + +         + L     NG +L+  L       + +S         + +
Sbjct: 83  KNITCLYDMDI---------VLLPDGSFNGLDLYEELMEWDMHQIIKSGQPLTDAHYQSF 133

Query: 474 AAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTF----C 529
             ++LC L  +H  DV++RDLKP N+L++    + +CDFGL +   ++  + D F     
Sbjct: 134 VYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPIENDQFLTEYV 193

Query: 530 GTPEYLAPELLLG-QGYSKVVDWWTLGVLLYEMLTGLPPYY------------------- 569
            T  Y APE++L  QGY++ +D W+ G +L E+L G P +                    
Sbjct: 194 ATRWYRAPEIMLSYQGYTRAIDVWSCGCVLAELLGGRPIFKGKDYVDQLNRILQVLGTPP 253

Query: 570 DENVPKMYKKILQDPL-------------VFPDGFDRDAKDLLIGLLSRDPQRRLGYNGA 616
           +E + ++  K +QD +             ++P+  + DA DLL  +L+ DP+ R+     
Sbjct: 254 EETLKRIGSKNVQDYIHQLGYIPKVPFERLYPNA-NPDAADLLERMLALDPKTRI---TV 309

Query: 617 DEIKNHPFFS 626
           DE   HP+ S
Sbjct: 310 DEALEHPYLS 319

>Scas_633.29
          Length = 789

 Score = 87.4 bits (215), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 76/312 (24%), Positives = 142/312 (45%), Gaps = 40/312 (12%)

Query: 358 KPSRNKPLSIDD--FDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHT 415
           K ++   ++++D  ++ ++++G+G   +V +V K    K++ALK +        S V   
Sbjct: 286 KLAKRNTITVNDTEYEKIELLGRGGSSRVYKV-KNSQNKVFALKRVSFDEF-DDSSVDGF 343

Query: 416 LAERTVLARIDCPFIVPLKFSFQSQEK-LYLVLACINGGELFYHLQREGR-FDLSRSRFY 473
             E  +L ++     V   F +Q     L+L++ C +        QR     D+   R++
Sbjct: 344 KGEIELLEKLSNESRVVKLFDYQMDSGVLFLIMECGDHDLSQILSQRSDMPLDMDFVRYH 403

Query: 474 AAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCK------LNMKDEDKTDT 527
           A E++  +  +H   +++ DLKP N +   +G + + DFG+        +N+  E++   
Sbjct: 404 AREVVRCIKIVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAIPDHTVNIYRENQ--- 459

Query: 528 FCGTPEYLAPELLLGQGYS------------KVVDWWTLGVLLYEMLTGLPPY-----YD 570
             GTP Y+APE L+   Y+            K  D W+ G ++Y+M+ G PPY      +
Sbjct: 460 -IGTPNYMAPEALVAMNYTNENDGGNKWKVGKPSDIWSCGCIIYQMIYGRPPYAGFQGQN 518

Query: 571 ENVPKM---YKKILQDPLVFPDGFDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQ 627
             +  M    K I  +     +   R   DL+ G L+RDP++R      D++   PFF+ 
Sbjct: 519 RLLAIMNPDVKVIFSEKTANNESIPRSLIDLMKGCLTRDPEKRW---SVDQVLESPFFNP 575

Query: 628 LSWKRLLMKGYI 639
           +      +K  I
Sbjct: 576 IVVTPFFIKDLI 587

>Scas_713.38
          Length = 432

 Score = 85.5 bits (210), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 92/337 (27%), Positives = 143/337 (42%), Gaps = 73/337 (21%)

Query: 373 LKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERT-----VLARIDC 427
           L  +G G+FG V       T +  A+K I K +       T  LA+RT     +L  +  
Sbjct: 26  LNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPF------STAVLAKRTYRELKLLKHLRH 79

Query: 428 PFIVPLKFSFQSQ-EKLYLVLACINGGELFYHLQR---EGRFDLSRSRFYAAELLCALDT 483
             ++ L+  F S  E +Y V   + G +L   LQ    E +F     +++  ++L  L  
Sbjct: 80  ENLICLQDIFLSPLEDIYFVTE-LQGTDLHRLLQTRPLEKQF----VQYFLYQILRGLKY 134

Query: 484 LHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLG- 542
           +H + VI+RDLKP NIL++    + +CDFGL ++    + +   +  T  Y APE++L  
Sbjct: 135 VHSVGVIHRDLKPSNILINENCDLKICDFGLARIQ---DPQMTGYVSTRYYRAPEIMLTW 191

Query: 543 QGYSKVVDWWTLGVLLYEMLTGLPPY---------------------------YDENVPK 575
           Q Y   VD W+ G +  EM+ G P +                             EN  K
Sbjct: 192 QKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPEDVINTICSENTLK 251

Query: 576 MYKKI-LQDPLVFPDGF---DRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQLSWK 631
               +  +DP+ F + F   + DA DLL  +L  DP++R+    A E   HP        
Sbjct: 252 FVTSLPHRDPIPFSERFKTVEPDAVDLLGKMLVFDPKKRV---TAAEALAHP-------- 300

Query: 632 RLLMKGYIPPYKPPVTSATDTSNFDQEFT-REKPIDS 667
                 Y+ PY  P         FD  F   + P+D+
Sbjct: 301 ------YLAPYHDPTDEPVADCKFDWHFNDADLPVDT 331

>CAGL0D02002g 207419..209080 similar to sp|Q03957 Saccharomyces
           cerevisiae YKL139w CTK1 carboxy-terminal domain kinase,
           hypothetical start
          Length = 553

 Score = 86.3 bits (212), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 80/301 (26%), Positives = 143/301 (47%), Gaps = 25/301 (8%)

Query: 307 DKINTNQDVHLDSFQLPVNLLIDSAATIRLYNHHWVELRDGLGKINISVDYKPSR--NKP 364
           +  N NQD     F+LP        +TI  YN    E   G    +I     P+   ++P
Sbjct: 162 NNANNNQDSGRKIFELPK----GPKSTISRYNTG--EPYKGTKPQSIPTPTLPTTFLSRP 215

Query: 365 LSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLAR 424
           ++   ++ L  +G+G++GKV + R   TK++ ALK +R         +T ++ E  +L  
Sbjct: 216 MNDSVYERLLQVGEGTYGKVYKARNTVTKELVALKKLRLQGEREGFPIT-SIREIKLLQS 274

Query: 425 IDCPFIVPLK-FSFQSQEKLYLVLACIN---GGELFYHLQREGRFDLSRSRFYAAELLCA 480
            +   +  +K    +SQ+ +Y++    +   GG L   L ++   + ++S+    ++L  
Sbjct: 275 FNHENVSTIKEIMVESQKIIYMIFEYADNDLGGLL---LNKQININAAQSKHIFKQILHG 331

Query: 481 LDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCG---TPEYLAP 537
           ++ LH  ++++RD+K  NIL+D QG + L DFGL +    + D    +     T  Y  P
Sbjct: 332 IEYLHDNNILHRDIKGSNILIDNQGSLKLTDFGLARKIDCNRDAIRDYTNRVITIWYRPP 391

Query: 538 ELLLG-QGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYK---KILQDPLV--FPDGF 591
           ELLLG   Y   VD W  G +L E+   +  +   N  +  +   K++  P +  +P+ F
Sbjct: 392 ELLLGTTNYGPEVDMWGCGCILVELFNKMAIFQGTNELEQLEAIFKVMGSPSIEQWPNIF 451

Query: 592 D 592
           D
Sbjct: 452 D 452

>Scas_720.94
          Length = 1683

 Score = 87.0 bits (214), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 75/268 (27%), Positives = 114/268 (42%), Gaps = 33/268 (12%)

Query: 376  IGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAER-TVLARIDCPFIVPLK 434
            IG G+FG V      D  +I A+K I+     +  ++   + E  TVL  ++ P IV   
Sbjct: 1367 IGGGTFGTVYSAVNLDNGEILAVKEIKIQDSKTMKKIFPLVKEEMTVLEMLNHPNIVQYY 1426

Query: 435  FSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDL 494
                 ++K+ + +    GG +   L+     D   ++ Y  ELL  L  LH+  V++RD+
Sbjct: 1427 GVEVHRDKVNIFMEYCEGGSMASLLEHGRIEDEMVTQVYTLELLEGLAYLHQAGVVHRDI 1486

Query: 495  KPENILLDYQGHIALCDFGLCKLNMKDEDKTDT-------------------------FC 529
            KPENILLD+ G I   DFG  +   K+  K                              
Sbjct: 1487 KPENILLDFNGIIKYVDFGAARKIAKNGTKVTNINSKSKDDDEPDEKDTEGGANSVHDML 1546

Query: 530  GTPEYLAPELLLGQGYSKVV---DWWTLGVLLYEMLTGLPPY--YDENVPKMYKKIL-QD 583
            GTP Y+APE + G          D W+ G ++ EM+TG  P+   D     +Y     Q 
Sbjct: 1547 GTPMYMAPESITGYKNKTKFGSDDIWSFGCVVLEMITGRRPWANLDNEWAIIYHVAAGQT 1606

Query: 584  P-LVFPDGFDRDAKDLLIGLLSRDPQRR 610
            P L +P+      +  L   L +DP +R
Sbjct: 1607 PQLPYPNEVSPAGRRFLQRCLVQDPIKR 1634

>Scas_568.9*
          Length = 306

 Score = 83.6 bits (205), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 79/300 (26%), Positives = 134/300 (44%), Gaps = 49/300 (16%)

Query: 370 FDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAER--TVLARIDC 427
           F  L+ +G G++  V +   K T    ALK ++    +   E T + A R  +++  +  
Sbjct: 2   FKQLEKLGNGTYATVYKGLNKTTGAYVALKEVK----LDSEEGTPSTAIREISLMKELKH 57

Query: 428 PFIVPLKFSFQSQEKLYLVLACINGGELFYHLQRE-----GRFDLSRSRFYAAELLCALD 482
             IV L     ++ KL LV   ++     Y   R         +L+  +++  +LL  L 
Sbjct: 58  ENIVRLYDVIHTENKLTLVFEYMDNDLKKYMDSRTVGNSPRGLELNLVKYFQWQLLEGLA 117

Query: 483 TLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLG 542
             H+  +++RDLKP+N+L++ +G + L DFGL +      +   +   T  Y AP++L+G
Sbjct: 118 FCHENKILHRDLKPQNLLINKKGALKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMG 177

Query: 543 -QGYSKVVDWWTLGVLLYEMLTGLP--------------------------------PYY 569
            + YS  +D W+ G +L EM+TG P                                P Y
Sbjct: 178 SRTYSTSIDIWSCGCILAEMITGKPLFPGSNDEEQLKLIFETMGTPTEATWPGVSALPKY 237

Query: 570 DENVPKMYKKILQDPL--VFPDGFDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQ 627
           + N P+   K L+  L     +  D +  DLL GLL  +P  RL    A +  +HP+F++
Sbjct: 238 NPNFPQRLPKDLRMVLQPYCKEPLDDNVIDLLHGLLQLNPDMRL---SAKQALHHPWFAE 294

>KLLA0F20053g 1867209..1868543 highly similar to sp|P32485
           Saccharomyces cerevisiae YLR113w HOG1 ser/thr protein
           kinase of MAP kinase (MAPK) family, start by similarity
          Length = 444

 Score = 85.1 bits (209), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 92/337 (27%), Positives = 144/337 (42%), Gaps = 73/337 (21%)

Query: 373 LKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERT-----VLARIDC 427
           L  +G G+FG V       T +  A+K I K +       T  LA+RT     +L  +  
Sbjct: 25  LNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPF------STSVLAKRTYRELKLLKHLRH 78

Query: 428 PFIVPLKFSFQSQ-EKLYLVLACINGGELFYHLQR---EGRFDLSRSRFYAAELLCALDT 483
             ++ L+  F S  E +Y V   + G +L   LQ    E +F     +++  ++L  L  
Sbjct: 79  ENLICLEDIFLSPLEDIYFVTE-LQGTDLHRLLQTRPLEKQF----VQYFLYQILRGLKY 133

Query: 484 LHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLG- 542
           +H   VI+RDLKP NIL++    + +CDFGL ++    + +   +  T  Y APE++L  
Sbjct: 134 VHSAGVIHRDLKPSNILINENCDLKICDFGLARIQ---DPQMTGYVSTRYYRAPEIMLTW 190

Query: 543 QGYSKVVDWWTLGVLLYEMLTGLPPY---------------------------YDENVPK 575
           Q Y+  VD W+ G +  EM+ G P +                             EN  K
Sbjct: 191 QKYNVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVIDTICSENTLK 250

Query: 576 MYKKI-LQDPLVFPDGF---DRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQLSWK 631
               +  +DP+ F   F   + DA DLL  +L  DP++R+    AD +  HP+ S     
Sbjct: 251 FVTSLPHRDPVPFSSRFQNLEPDAIDLLEKMLVFDPKKRI--TAADALA-HPYLS----- 302

Query: 632 RLLMKGYIPPYKPPVTSATDTSNFDQEFT-REKPIDS 667
                    PY  P       + FD  F   + P+D+
Sbjct: 303 ---------PYHDPTDEPIAEAKFDWNFNDADLPVDT 330

>KLLA0A02497g 218592..219680 highly similar to sp|P14681
           Saccharomyces cerevisiae YGR040w KSS1 ser/thr protein
           kinase of the MAP kinase family, start by similarity
          Length = 362

 Score = 84.3 bits (207), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 68/222 (30%), Positives = 107/222 (48%), Gaps = 40/222 (18%)

Query: 370 FDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSE-VTHTLAERTVLARIDCP 428
           + L+ ++G+G++G V     K T    A+K I+     S+S  VT TL E  +L      
Sbjct: 13  YQLVDLVGEGAYGTVCSAIHKPTNTKVAIKKIQP---FSRSMFVTRTLRELKLL------ 63

Query: 429 FIVPLKFSFQSQEKLYLVLACI-----NGGELFYHLQREGRFDLSRS-----------RF 472
                KF F S E +  VL  +     +  E  Y +Q     DL +            ++
Sbjct: 64  -----KF-FHSHENIISVLDIVRPTSWHKFEAVYLVQELMETDLQKIINQQNLSEDHIQY 117

Query: 473 YAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCK-LNMKDEDKTDT---- 527
           +  ++L AL +LH   VI+RDLKP N+LL+    + +CDFGL + L   D+ + +     
Sbjct: 118 FVYQILRALKSLHSAQVIHRDLKPSNLLLNSNCDLKVCDFGLARCLASSDQSRENMVGFM 177

Query: 528 --FCGTPEYLAPELLLG-QGYSKVVDWWTLGVLLYEMLTGLP 566
             +  T  Y APE++L  Q Y+  +D W+ G +L EM+ G P
Sbjct: 178 TEYVATRWYRAPEIMLSFQEYTTAMDIWSCGCILAEMIMGKP 219

>YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capable
           of suppressing DNA polymerase alpha mutations [3429 bp,
           1142 aa]
          Length = 1142

 Score = 86.7 bits (213), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 128/284 (45%), Gaps = 49/284 (17%)

Query: 353 ISVDYKPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAI-------RKSY 405
           IS+ Y P   + + ++ ++++K +G G  GKV   R   +K++ A+K +       RK +
Sbjct: 117 ISLTYDPVSKRKV-LNTYEIIKELGHGQHGKVKLARDILSKQLVAIKIVDRHEKKQRKFF 175

Query: 406 IVSKS----EVTHTLAERTVLARIDCPFIVPLKFSFQ--SQEKLYLVLACINGGELFYH- 458
              KS    E      E  ++ +     +V L          K+YLVL   + GE+ +  
Sbjct: 176 TFIKSSKISENDKIKREIAIMKKCHHKHVVQLIEVLDDLKSRKIYLVLEYCSRGEVKWCP 235

Query: 459 ---LQREGR----FDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCD 511
              ++ + +         +R     ++  L+ LH   +I+RD+KP N+L+   G + + D
Sbjct: 236 PDCMESDAKGPSLLSFQETREILRGVVLGLEYLHYQGIIHRDIKPANLLISGDGTVKISD 295

Query: 512 FGLC----------KLNMKDEDKTDTFCGTPEYLAPELLLGQGY---------------- 545
           FG+                DE +     GTP + APE+ LG+                  
Sbjct: 296 FGVSLAASSTNSSDSSESLDELELAKTVGTPAFFAPEMCLGEDAFTRYNLTKENLFRGSC 355

Query: 546 -SKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFP 588
            S ++D W +GV LY +L G+ P++ +   K+++KI+ DPL FP
Sbjct: 356 ISFMIDIWAVGVTLYCLLFGMLPFFSDFELKLFEKIVNDPLKFP 399

>CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces
            cerevisiae YAL017w FUN31 or sp|Q08217 Saccharomyces
            cerevisiae YOL045w, start by similarity
          Length = 1206

 Score = 86.7 bits (213), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 71/256 (27%), Positives = 123/256 (48%), Gaps = 22/256 (8%)

Query: 369  DFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYI-----VSKSEVTHTLAERTVLA 423
            DF +L+ +G+G++GKV     K+ K I  +K I K  I     V   ++    +E  +LA
Sbjct: 945  DFVVLQKMGEGAYGKVNLCIHKEKKYIVVIKMIFKERILVDTWVRDRKLGTIPSEIQILA 1004

Query: 424  RID---CPFIVPLKFSFQSQEKLYLVL---ACINGGELFYHLQREGRFDLSRSRFYAAEL 477
             I+      I+ L   F+  +  YL           +LF  ++ +       ++    ++
Sbjct: 1005 TINKRPHENILGLLDFFEDDDYYYLETPPHGQTGSVDLFDIIEFKSNMTEFEAKLIFKQI 1064

Query: 478  LCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAP 537
            +  +  LH   +++RD+K EN+++D +G + L DFG            D F GT +Y AP
Sbjct: 1065 VSGIKHLHDQGIVHRDIKDENVIVDSKGFVKLIDFGSAA--YVKSGPFDVFVGTIDYAAP 1122

Query: 538  ELLLGQGYS-KVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFD--RD 594
            E+L G  Y  K  D W +G+LLY ++    P+Y+        +IL+  L F D  D  ++
Sbjct: 1123 EVLGGNPYEGKSQDIWAIGILLYTLIYKENPFYN------IDEILEGELRFNDSADVSQE 1176

Query: 595  AKDLLIGLLSRDPQRR 610
             K L+  +L+R  ++R
Sbjct: 1177 CKALITKILNRCVRKR 1192

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.137    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 22,059,044
Number of extensions: 991627
Number of successful extensions: 4940
Number of sequences better than 10.0: 662
Number of HSP's gapped: 4032
Number of HSP's successfully gapped: 737
Length of query: 692
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 583
Effective length of database: 12,822,747
Effective search space: 7475661501
Effective search space used: 7475661501
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)