Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0K03355g34233718080.0
YMR101C (SRT1)3433338821e-118
Scas_717.673432908431e-112
Kwal_26.76493623277821e-102
Sklu_2430.113892807761e-101
KLLA0B12848g3612957041e-90
ABL022W4333026933e-88
Scas_716.563302394461e-52
KLLA0E17259g2752604352e-51
Kwal_27.109862852384292e-50
CAGL0C04279g2742464221e-49
AER003C2742614194e-49
YBR002C (RER2)2862353822e-43
KLLA0F19668g16253720.24
YPR118W41176700.84
Scas_538.526673662.4
Kwal_27.11998414125662.9
CAGL0C01397g76245663.0
KLLA0C18447g44234636.3
CAGL0L04862g60391637.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0K03355g
         (337 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0K03355g complement(304962..305990) similar to sp|Q03175 Sac...   701   0.0  
YMR101C (SRT1) [4059] chr13 complement(468444..469475) cis-Preny...   344   e-118
Scas_717.67                                                           329   e-112
Kwal_26.7649                                                          305   e-102
Sklu_2430.11 YMR101C, Contig c2430 20248-21417                        303   e-101
KLLA0B12848g 1122397..1123482 similar to sp|Q03175 Saccharomyces...   275   1e-90
ABL022W [570] [Homologous to ScYMR101C (SRT1) - SH] complement(3...   271   3e-88
Scas_716.56                                                           176   1e-52
KLLA0E17259g 1530035..1530862 similar to sp|P35196 Saccharomyces...   172   2e-51
Kwal_27.10986                                                         169   2e-50
CAGL0C04279g 416100..416924 similar to sp|P35196 Saccharomyces c...   167   1e-49
AER003C [2508] [Homologous to ScYBR002C (RER2) - SH] (638834..63...   166   4e-49
YBR002C (RER2) [195] chr2 complement(241672..242532) Cis-prenylt...   151   2e-43
KLLA0F19668g complement(1819417..1819905) no similarity, hypothe...    32   0.24 
YPR118W (YPR118W) [5539] chr16 (767748..768983) Member of the in...    32   0.84 
Scas_538.5                                                             30   2.4  
Kwal_27.11998                                                          30   2.9  
CAGL0C01397g complement(148889..151177) similar to sp|P40433 Sac...    30   3.0  
KLLA0C18447g complement(1629477..1630805) similar to sgd|S000431...    29   6.3  
CAGL0L04862g complement(554884..556695) similar to sp|P48837 Sac...    29   7.4  

>CAGL0K03355g complement(304962..305990) similar to sp|Q03175
           Saccharomyces cerevisiae YMR101c, hypothetical start
          Length = 342

 Score =  701 bits (1808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/337 (100%), Positives = 337/337 (100%)

Query: 1   MIHLIRNLFICVVEVMSIGSSSVTKFISDYATVLFYYCKSFYYINVITTSIQKMLIFALR 60
           MIHLIRNLFICVVEVMSIGSSSVTKFISDYATVLFYYCKSFYYINVITTSIQKMLIFALR
Sbjct: 1   MIHLIRNLFICVVEVMSIGSSSVTKFISDYATVLFYYCKSFYYINVITTSIQKMLIFALR 60

Query: 61  TGPVPAHVAFIMDGNRRFAKSKDIPLRKGHEAGGETLLTLVYICKTLGVKCISAYAFSIE 120
           TGPVPAHVAFIMDGNRRFAKSKDIPLRKGHEAGGETLLTLVYICKTLGVKCISAYAFSIE
Sbjct: 61  TGPVPAHVAFIMDGNRRFAKSKDIPLRKGHEAGGETLLTLVYICKTLGVKCISAYAFSIE 120

Query: 121 NFNRPREEVETLMNLFGDKLDEFAQKANDYKDPLYGSSLRIVGDRSLISPELRERIENVE 180
           NFNRPREEVETLMNLFGDKLDEFAQKANDYKDPLYGSSLRIVGDRSLISPELRERIENVE
Sbjct: 121 NFNRPREEVETLMNLFGDKLDEFAQKANDYKDPLYGSSLRIVGDRSLISPELRERIENVE 180

Query: 181 KLTENSEKFILYICFPYTSRNDIFQTVTKVTDKYVQSNIIDSNLSINEFTKSMHFKEYSD 240
           KLTENSEKFILYICFPYTSRNDIFQTVTKVTDKYVQSNIIDSNLSINEFTKSMHFKEYSD
Sbjct: 181 KLTENSEKFILYICFPYTSRNDIFQTVTKVTDKYVQSNIIDSNLSINEFTKSMHFKEYSD 240

Query: 241 NCDILIRTSGHKRLSDFMLWQVNEHATMEFSTSLWPQFNFFQMYLIILRWSMFKMFQIYN 300
           NCDILIRTSGHKRLSDFMLWQVNEHATMEFSTSLWPQFNFFQMYLIILRWSMFKMFQIYN
Sbjct: 241 NCDILIRTSGHKRLSDFMLWQVNEHATMEFSTSLWPQFNFFQMYLIILRWSMFKMFQIYN 300

Query: 301 MNNVSKHSKFGSKLYKPYKTILKYIFSERLPDPPMAV 337
           MNNVSKHSKFGSKLYKPYKTILKYIFSERLPDPPMAV
Sbjct: 301 MNNVSKHSKFGSKLYKPYKTILKYIFSERLPDPPMAV 337

>YMR101C (SRT1) [4059] chr13 complement(468444..469475)
           cis-Prenyltransferase (dehydrodolichyl diphosphate
           synthetase), synthesizes long-chain polyprenol compounds
           [1032 bp, 343 aa]
          Length = 343

 Score =  344 bits (882), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 174/333 (52%), Positives = 240/333 (72%), Gaps = 9/333 (2%)

Query: 5   IRNLFICVVEVMSIGSSSVTKFISDYATVLFYYCKSFYYINVITTSIQKMLIFALRTGPV 64
           ++ L +   E M     S+  F   +A V+     S++Y+N     +Q +LI ALR GPV
Sbjct: 14  LKRLLVETKEQMCFAVKSI--FQRVFAWVMSLSLFSWFYVN-----LQNILIKALRVGPV 66

Query: 65  PAHVAFIMDGNRRFAKSKDIPLRKGHEAGGETLLTLVYICKTLGVKCISAYAFSIENFNR 124
           P HV+FIMDGNRR+AKS+ +P++KGHEAGG TLLTL+YICK LGVKC+SAYAFSIENFNR
Sbjct: 67  PEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLLTLLYICKRLGVKCVSAYAFSIENFNR 126

Query: 125 PREEVETLMNLFGDKLDEFAQKANDYKDPLYGSSLRIVGDRSLISPELRERIENVEKLTE 184
           P+EEV+TLMNLF  KLDEFA++A DYKDPLYGS +RIVGD+SL+SPE+R++I+ VE++T+
Sbjct: 127 PKEEVDTLMNLFTVKLDEFAKRAKDYKDPLYGSKIRIVGDQSLLSPEMRKKIKKVEEITQ 186

Query: 185 NSEKFILYICFPYTSRNDIFQTVTKVTDKYVQSNIIDSNLSINEFTKSMHFKEYSDNCDI 244
           + + F L+ICFPYTSRND+  T+    + ++++      ++I +FT  M+   +S+ C++
Sbjct: 187 DGDDFTLFICFPYTSRNDMLHTIRDSVEDHLENK--SPRINIRKFTNKMYMGFHSNKCEL 244

Query: 245 LIRTSGHKRLSDFMLWQVNEHATMEFSTSLWPQFNFFQMYLIILRWSMFKMFQIYNMNNV 304
           LIRTSGH+RLSD+MLWQV+E+AT+EFS +LWP F+FF MYL+IL+WS F   Q YN  N 
Sbjct: 245 LIRTSGHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKYNEKNH 304

Query: 305 SKHSKFGSKLYKPYKTILKYIFSERLPDPPMAV 337
           S   K    +   +K     +     P+PP++V
Sbjct: 305 SLFEKIHESVPSIFKKKKTAMSLYNFPNPPISV 337

>Scas_717.67
          Length = 343

 Score =  329 bits (843), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 157/290 (54%), Positives = 201/290 (69%), Gaps = 10/290 (3%)

Query: 52  QKMLIFALRTGPVPAHVAFIMDGNRRFAKSKDIPLRKGHEAGGETLLTLVYICKTLGVKC 111
           Q +LI  L    VP HV+FIMDGNRR+AKS+++PL KGHEAGG TLLTL YICK +GVKC
Sbjct: 53  QLLLIKILSVAQVPEHVSFIMDGNRRYAKSRNLPLNKGHEAGGVTLLTLAYICKKIGVKC 112

Query: 112 ISAYAFSIENFNRPREEVETLMNLFGDKLDEFAQKANDYKDPLYGSSLRIVGDRSLISPE 171
           +SAYAFSIENFNR +EEV+TLM LF  KLDEFA++A DY+DPLYGS L++VGD SLIS E
Sbjct: 113 VSAYAFSIENFNRSKEEVDTLMELFSAKLDEFAKRAIDYRDPLYGSRLKVVGDHSLISKE 172

Query: 172 LRERIENVEKLTENSEKFILYICFPYTSRNDIFQTVTKVTDKYVQSNIIDSNLSINEFTK 231
           LR++I  VE+LT +   F  Y+CFPYT+RNDI+ T+                L+I +FT 
Sbjct: 173 LRDKIYKVEQLTTDGSDFTFYVCFPYTARNDIYHTMYNFIANPEPEKEKSEELTIEKFTS 232

Query: 232 SMHFKEYSDNCDILIRTSGHKRLSDFMLWQVNEHATMEFSTSLWPQFNFFQMYLIILRWS 291
            M+ +E+S+ CD+LIRTSGH R SD+MLWQ +E+ T+EF  + WP F F  MY+IIL+WS
Sbjct: 233 QMYLREFSNKCDLLIRTSGHNRFSDYMLWQTHENGTIEFCNTFWPDFGFMGMYMIILKWS 292

Query: 292 MFKMFQIYNMNNVSKHSKF----GSKLYKPYKTILKYIFSERLPDPPMAV 337
            FK  Q +N  N S  + +     SK+   Y  +      E LP+PP+ V
Sbjct: 293 FFKTIQKFNEMNFSLKTIWYEGPNSKIQNRYTKL------EELPEPPVHV 336

>Kwal_26.7649
          Length = 362

 Score =  305 bits (782), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 154/327 (47%), Positives = 213/327 (65%), Gaps = 13/327 (3%)

Query: 18  IGSSSVTKFISDYATVLFYYCKSFYYINVITTSIQKMLIFALRTGPVPAHVAFIMDGNRR 77
           +  SSV +++      ++ +  +   +  I   IQ +L   LR GP+P HV+FIMDGNRR
Sbjct: 36  LNRSSVKEYVHAQKLRIWSFVLNMAIVRWILIQIQMILTNILRVGPLPPHVSFIMDGNRR 95

Query: 78  FAKSKDIPLRKGHEAGGETLLTLVYICKTLGVKCISAYAFSIENFNRPREEVETLMNLFG 137
           +AKS  +P++ GHEAG  TLL L+  C+ LG+K +SAYAFSIENFNRP+EEV+TL  L  
Sbjct: 96  YAKSLSVPIKAGHEAGALTLLNLLVTCRNLGIKTVSAYAFSIENFNRPQEEVDTLTGLLA 155

Query: 138 DKLDEFAQKANDYKDPLYGSSLRIVGDRSLISPELRERIENVEKLTENSEKFILYICFPY 197
           +KLDE A++A D +  LYG  LR+VG+RS IS  L +RI  VE+LT+  +   LYICFPY
Sbjct: 156 EKLDEVARRACDRESELYGLRLRVVGERSRISKSLNDRISRVERLTDEGDIMTLYICFPY 215

Query: 198 TSRNDIFQTVTKVTD--KYVQSNIIDSNLSINE--FTKSMHFKEYSDNCDILIRTSGHKR 253
           TSRNDI+  +    +  KY+ S + D    I+E   T +M  KE S+ CD+LIRTSGH R
Sbjct: 216 TSRNDIYHAIYNCAESCKYLNSPVSD----IDETYLTNNMFMKEQSNKCDLLIRTSGHTR 271

Query: 254 LSDFMLWQVNEHATMEFSTSLWPQFNFFQMYLIILRWSMFKMFQIYNMNNVSKHSK---F 310
           LSD+MLWQ +E+  +EFS +LWP F+FF+ + ++L+WS F   +   +NNVS  S+   F
Sbjct: 272 LSDYMLWQAHENGVIEFSNTLWPDFDFFEFFKMLLKWSFFTSVRRKQLNNVSLRSQTLSF 331

Query: 311 GSKLYKPYKTILKYIFSERLPDPPMAV 337
             +   P+K   K +  E LP+PP AV
Sbjct: 332 FKRTLFPFKR--KQVSYEDLPEPPQAV 356

>Sklu_2430.11 YMR101C, Contig c2430 20248-21417
          Length = 389

 Score =  303 bits (776), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 141/280 (50%), Positives = 193/280 (68%), Gaps = 5/280 (1%)

Query: 35  FYYCKSFYYINVITTSIQKMLIFALRTGPVPAHVAFIMDGNRRFAKSKDIPLRKGHEAGG 94
           + Y  S   I+ + T +Q  L+  LR GP+P H++FIMDGNRR+AKS  +P+ KGHEAG 
Sbjct: 74  YQYLLSLPLISWLITLLQDFLLDILRAGPLPNHISFIMDGNRRYAKSLGMPIIKGHEAGA 133

Query: 95  ETLLTLVYICKTLGVKCISAYAFSIENFNRPREEVETLMNLFGDKLDEFAQKANDYKDPL 154
            TLL ++Y CK LG+K  SAYAFSIENFNRP+EEV+TL  L  +KLDE A KA D KD L
Sbjct: 134 ITLLRMLYNCKKLGIKTTSAYAFSIENFNRPKEEVDTLTRLLAEKLDEIAVKAQDVKDEL 193

Query: 155 YGSSLRIVGDRSLISPELRERIENVEKLT-----ENSEKFILYICFPYTSRNDIFQTVTK 209
           YGSS ++VGDRSLIS EL ++I NVE++T     +  +  +LYICFPYTSRNDI+  +  
Sbjct: 194 YGSSFKVVGDRSLISRELNDKITNVERMTAVNDVDEEKTSLLYICFPYTSRNDIYHAMYN 253

Query: 210 VTDKYVQSNIIDSNLSINEFTKSMHFKEYSDNCDILIRTSGHKRLSDFMLWQVNEHATME 269
             ++     +   ++S+   T +M+F E+S+ CD+LIRTSGH RLSD+MLWQ +E+  +E
Sbjct: 254 TVERVKYHGMSTESISVESLTDAMYFDEFSNKCDLLIRTSGHTRLSDYMLWQSHENGMIE 313

Query: 270 FSTSLWPQFNFFQMYLIILRWSMFKMFQIYNMNNVSKHSK 309
           FST+LWP + F + YL+++RWS F   Q +  +  S   +
Sbjct: 314 FSTTLWPSYTFLEFYLVLVRWSFFTSLQRFQTSGFSARGQ 353

>KLLA0B12848g 1122397..1123482 similar to sp|Q03175 Saccharomyces
           cerevisiae YMR101c SRT1 cis-prenyltransferase homologue,
           start by similarity
          Length = 361

 Score =  275 bits (704), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 137/295 (46%), Positives = 203/295 (68%), Gaps = 13/295 (4%)

Query: 51  IQKMLIFALRTGPVPAHVAFIMDGNRRFAKSKDIPLRKGHEAGGETLLTLVYICKTLGVK 110
           +Q  ++  LR GPVP H++FIMDGNRR+AK  D P+++GH AGG TL+ +++IC+ L V 
Sbjct: 67  LQMFMVRILRMGPVPRHLSFIMDGNRRYAKKLDQPVKEGHRAGGATLIDILHICRRLNVS 126

Query: 111 CISAYAFSIENFNRPREEVETLMNLFGDKLDEFAQKANDYKDPLYGSSLRIVGDRSLISP 170
            +SAYAFSIENFNR  +EV TLM L G  +D+F ++A + KD LYG  LR+VGD SL+S 
Sbjct: 127 SVSAYAFSIENFNRSPQEVATLMELLGYYIDQFTERATNAKDELYGIRLRVVGDLSLLSE 186

Query: 171 ELRERIENVEKLTENSEKFILYICFPYTSRNDIFQTVTKVTDKYVQSNIIDSNLSINEFT 230
           EL ++I N EKLT + ++F+LY+  PYTSRNDI  ++   TDK + SN    +++    T
Sbjct: 187 ELLKKIRNAEKLTRDGQEFVLYLALPYTSRNDIAHSMQVTTDKCINSN---EDITEQALT 243

Query: 231 KSMHFKEYSDNCDILIRTSGHKRLSDFMLWQVNEHATMEFSTSLWPQFNFFQMYLIILRW 290
            +M+F++YS+ CD+LIRTSGH RLSD+MLWQV+E + +EF   LWP FNF+++Y I+L+W
Sbjct: 244 DNMYFEQYSNKCDLLIRTSGHTRLSDYMLWQVHEGSIIEFVDCLWPDFNFWRLYWIMLKW 303

Query: 291 SMFKMFQIYNMNNVSKHSKFGSKLYK------PYKTI--LKYIFSERLPDPPMAV 337
           S ++ +Q  N + +    +  ++++       P +T+   K +  + LP  P+AV
Sbjct: 304 SFYQTWQ--NASQLPDPVRTRTRVFPKISGALPIETLKRTKRVALDSLPAAPLAV 356

>ABL022W [570] [Homologous to ScYMR101C (SRT1) - SH]
           complement(356930..358231) [1302 bp, 433 aa]
          Length = 433

 Score =  271 bits (693), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 126/302 (41%), Positives = 197/302 (65%), Gaps = 11/302 (3%)

Query: 41  FYYINVITTSIQKMLIFALRTGPVPAHVAFIMDGNRRFAKSKDIPLRKGHEAGGETLLTL 100
           F  + ++   +Q +L+  L+ GP+P HV+FIMDGNRR+AKS ++PL+ GHEAG   L+  
Sbjct: 133 FGLLRMVVNFVQNLLLKILQMGPLPQHVSFIMDGNRRYAKSMNLPLKLGHEAGSVALMRT 192

Query: 101 VYICKTLGVKCISAYAFSIENFNRPREEVETLMNLFGDKLDEFAQKANDYKDPLYGSSLR 160
           ++ CK  G++ +SAYAFSIENFNRP+EE++TL  +   +L +FA +A + KD +YG+ L 
Sbjct: 193 LHTCKRAGIEAVSAYAFSIENFNRPKEEIDTLTEMLSRRLQDFANRATNLKDRMYGARLL 252

Query: 161 IVGDRSLISPELRERIENVEKLTENSEKFILYICFPYTSRNDIFQTVTKVTDKYVQSNII 220
           +VGDR+L+SPEL ++I  +E +T+++  F +YIC PYT+RNDI+  +  +  +  Q+  +
Sbjct: 253 VVGDRALLSPELNDKITYIEDMTKHNTAFTVYICLPYTTRNDIYHAMFDLV-RLCQAGAL 311

Query: 221 DS-NLSINEFTKSMHFKEYSDNCDILIRTSGHKRLSDFMLWQVNEHATMEFSTSLWPQFN 279
           DS ++S    T +M+    S+  DIL+RTSGH RLSD+MLWQV+E + +EFS  +WP F 
Sbjct: 312 DSKDISTEMLTNAMYLGANSNRADILVRTSGHTRLSDYMLWQVHEQSYIEFSNCMWPDFT 371

Query: 280 FFQMYLIILRWSMFKMFQIYNMNNVSKHSKFGSKLYKPYKTIL----KYIFSERLPDPPM 335
           F   + I+L+WS      +  ++   K  +   KL    +++L    + +  E LP PP 
Sbjct: 372 FRTFFTILLKWSF-----VTALHEARKQERLRRKLGTYARSLLARRARPVRLEALPPPPQ 426

Query: 336 AV 337
           A+
Sbjct: 427 AI 428

>Scas_716.56
          Length = 330

 Score =  176 bits (446), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 96/239 (40%), Positives = 141/239 (58%), Gaps = 5/239 (2%)

Query: 64  VPAHVAFIMDGNRRFAKSKDIPLRKGHEAGGETLLTLVYICKTLGVKCISAYAFSIENFN 123
           VP HV FIMDGNRR+A+   + +++GHEAG  T+  ++ +C   GV+C + YAFSIENF 
Sbjct: 67  VPRHVGFIMDGNRRYARRNHLQVKEGHEAGFFTMSKILELCYESGVECATVYAFSIENFK 126

Query: 124 RPREEVETLMNLFGDKLDEFAQKANDYKDPLYGSSLRIVGDRSLISPELRERIENVEKLT 183
           R   EV+ LM L  D++ +    A+      YG  +RI+GD SL+  ELR+ + N  ++T
Sbjct: 127 RSPHEVDALMKLAKDRIRQIV--ASGEMAEKYGIKVRIIGDLSLLDKELRDDMNNAMEIT 184

Query: 184 ENSEKFILYICFPYTSRNDIFQTVTKVTDKYVQSNIIDSNLSINE-FTKSMHFKEYSDNC 242
           +N+++ +L ICFPYT R +I  ++  V +   Q+N  D    I+E    +  +       
Sbjct: 185 KNNKRAVLNICFPYTGREEIVHSMQNVVE-LAQANSDDPKFIIDEQLINANLYTGDQPPL 243

Query: 243 DILIRTSGHKRLSDFMLWQV-NEHATMEFSTSLWPQFNFFQMYLIILRWSMFKMFQIYN 300
           D+LIRTSG  RLSDFM+WQV N+   +E    LWP F   +M  I+L++   K F   N
Sbjct: 244 DLLIRTSGMVRLSDFMVWQVSNKGVAIELIDCLWPDFGPLRMAWILLKFVFQKSFSNRN 302

>KLLA0E17259g 1530035..1530862 similar to sp|P35196 Saccharomyces
           cerevisiae YBR002c RER2 cis-prenyltransferase, a key
           enzyme in dolichol synthesis, start by similarity
          Length = 275

 Score =  172 bits (435), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 94/260 (36%), Positives = 152/260 (58%), Gaps = 9/260 (3%)

Query: 43  YINVITTSIQKMLIFALRTGPVPAHVAFIMDGNRRFAKSKDIPLRKGHEAGGETLLTLVY 102
           ++ ++ T++ K++     +  VP HVAFIMDGNRRFAK  ++ + +GH AG E++  ++ 
Sbjct: 13  FLEMVKTTLAKVI---RSSDKVPQHVAFIMDGNRRFAKKNNMEVNEGHNAGFESMCRILE 69

Query: 103 ICKTLGVKCISAYAFSIENFNRPREEVETLMNLFGDKLDEFAQKANDYKDPLYGSSLRIV 162
           +C   G+K  + +AFSIENF R   EV  LM L  DK+ + +Q     +   YG  ++I+
Sbjct: 70  LCYESGMKVATVFAFSIENFKRSTFEVNWLMELAKDKIKQISQHGELAEQ--YGIKVQII 127

Query: 163 GDRSLISPELRERIENVEKLTENSEKFILYICFPYTSRNDIFQTVTKVTDKYVQSNIIDS 222
           GDRSL+  ++ + +E  E++T N+ + +L ICFPYT R +I  ++  +  +     I   
Sbjct: 128 GDRSLLPADVLKEVELAEEITMNNSRAVLNICFPYTGREEIVHSIQGIMKETAMGEI--D 185

Query: 223 NLSINEFTKSMH-FKEYSDNCDILIRTSGHKRLSDFMLWQV-NEHATMEFSTSLWPQFNF 280
              I+E T   H + +     ++LIRTSG  RLSDF+LWQ+ N   T+E    LWP+F  
Sbjct: 186 YRDIDEQTIEDHLYTQGQPPVELLIRTSGVTRLSDFLLWQLSNRGCTIELVDCLWPEFTP 245

Query: 281 FQMYLIILRWSMFKMFQIYN 300
           F M  I+++++  K +   N
Sbjct: 246 FSMLKILIKFAFKKTYSPSN 265

>Kwal_27.10986
          Length = 285

 Score =  169 bits (429), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 90/238 (37%), Positives = 140/238 (58%), Gaps = 6/238 (2%)

Query: 61  TGPVPAHVAFIMDGNRRFAKSKDIPLRKGHEAGGETLLTLVYICKTLGVKCISAYAFSIE 120
           +G VP HV  IMDGNRR+AK K + +++GH AG  ++   + +C   GV   + +AFSIE
Sbjct: 28  SGNVPRHVGLIMDGNRRWAKLKHVEIKEGHNAGFHSMSRALELCYEAGVSTATVFAFSIE 87

Query: 121 NFNRPREEVETLMNLFGDKLDEFAQKANDYKDPLYGSSLRIVGDRSLISPELRERIENVE 180
           NF R   EVE+LMNL    + +  Q  N      +G  + ++GDRSL+  ++   +E  E
Sbjct: 88  NFKRSSAEVESLMNLARSGIRQVVQ--NGEMAEKFGIKINVIGDRSLLPADVLREVETAE 145

Query: 181 KLTENSEKFILYICFPYTSRNDIFQTVTKVTDKYVQSNIIDSNLSINEFT-KSMHFKEYS 239
           ++T+ + + +L ICFPYT R+++  ++  V ++    N+  S+  INE T     +   S
Sbjct: 146 EITKANTRAVLNICFPYTGRDELLHSIRGVVNEAQCGNLNTSD--INEATIDKFLYTGGS 203

Query: 240 DNCDILIRTSGHKRLSDFMLWQVN-EHATMEFSTSLWPQFNFFQMYLIILRWSMFKMF 296
              D+LIRTSG  RLSDF++WQV+ +   +EF   LWP F   QM  ++LR++  + F
Sbjct: 204 PPVDLLIRTSGVTRLSDFLIWQVSRKDVVIEFLDCLWPDFGSRQMAWLLLRFAFSRTF 261

>CAGL0C04279g 416100..416924 similar to sp|P35196 Saccharomyces
           cerevisiae YBR002c RER2, hypothetical start
          Length = 274

 Score =  167 bits (422), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 95/246 (38%), Positives = 138/246 (56%), Gaps = 31/246 (12%)

Query: 64  VPAHVAFIMDGNRRFAKSKDIPLRKGHEAGGETLLTLVYICKTLGVKCISAYAFSIENFN 123
           VP H+ FIMDGNRR+AK K +  ++GHEAG  ++  ++ +C   GV   + +AFSIENF 
Sbjct: 27  VPRHIGFIMDGNRRYAKKKQMESKEGHEAGFRSMSKILELCYEAGVDTATVFAFSIENFK 86

Query: 124 RPREEVETLMNLFGDKL------DEFAQKANDYKDPLYGSSLRIVGDRSLISPELRERIE 177
           R   EV+ +M+L  +++       E AQK        YG  +R++GD SL+  +L + I+
Sbjct: 87  RSAYEVDAIMSLARERIRQIREHGELAQK--------YGVRIRVIGDISLLDKDLLKEIK 138

Query: 178 NVEKLTENSEKFILYICFPYTSRNDIFQTVTKVTD------KYVQSNIIDSNLSINEFTK 231
           N  +LT N+ +  L IC PYT R +I+ ++  V D      K +   IID +L       
Sbjct: 139 NTMELTRNNTRATLNICMPYTGREEIYHSMKTVLDDDSYSSKNISEEIIDEHL------- 191

Query: 232 SMHFKEYSDNCDILIRTSGHKRLSDFMLWQVNEHATM-EFSTSLWPQFNFFQMYLIILRW 290
              +       D+LIRTSG  RLSDFMLWQ   +  M EF   LWP+F  F+M  I+L++
Sbjct: 192 ---YTAGQPPLDLLIRTSGVTRLSDFMLWQTCSNDVMIEFIDCLWPEFGPFRMAWILLKF 248

Query: 291 SMFKMF 296
           +  K F
Sbjct: 249 AFHKNF 254

>AER003C [2508] [Homologous to ScYBR002C (RER2) - SH]
           (638834..639658) [825 bp, 274 aa]
          Length = 274

 Score =  166 bits (419), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 93/261 (35%), Positives = 151/261 (57%), Gaps = 14/261 (5%)

Query: 39  KSFYYINVITTSIQKMLIFALRT-GPVPAHVAFIMDGNRRFAKSKDIPLRKGHEAGGETL 97
           + F   + + + ++ + +  LR+ G VP HV FIMDGNRR+AK  +I +R+GH AG  ++
Sbjct: 5   RDFTQNSWLISRLKDVFVSVLRSSGRVPKHVGFIMDGNRRYAKKHNIEVREGHSAGFMSM 64

Query: 98  LTLVYICKTLGVKCISAYAFSIENFNRPREEVETLMNLFGDKLDEFAQKANDYKDPLYGS 157
             ++ +C   GV   + +AFS++NF R   EV++LM L  +++ +  Q     +   YG 
Sbjct: 65  NKVLELCYESGVTTATVFAFSVDNFRRSAFEVDSLMELAKERVMQITQHGELAEQ--YGI 122

Query: 158 SLRIVGDRSLISPELRERIENVEKLTENSEKFILYICFPYTSRNDIFQTVTKVTDKYVQS 217
            +RI+GDRSL+  +++E +   EK TE + + +L +C PYT+R +I   + K T    QS
Sbjct: 123 HVRIIGDRSLLPADVQEEMARAEKATEANTRAVLNVCIPYTARGEILHAM-KGTIADAQS 181

Query: 218 N---IIDSNLSINEFTKSMHFKEYSDNCDILIRTSGHKRLSDFMLWQVNEHA-TMEFSTS 273
           +   I +++L  + +T  +         D+LIRTSG  RLSDF+LWQV +    +E  + 
Sbjct: 182 DGAPITEADLDAHMYTGGL------PPLDLLIRTSGVSRLSDFLLWQVCQKGVVIELLSC 235

Query: 274 LWPQFNFFQMYLIILRWSMFK 294
           LWP F    M  I+LR++  K
Sbjct: 236 LWPDFGPLTMAWILLRYAFKK 256

>YBR002C (RER2) [195] chr2 complement(241672..242532)
           Cis-prenyltransferase (dehydrodolichyl diphosphate
           synthetase), involved in dolichol synthesis [861 bp, 286
           aa]
          Length = 286

 Score =  151 bits (382), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 87/235 (37%), Positives = 136/235 (57%), Gaps = 10/235 (4%)

Query: 64  VPAHVAFIMDGNRRFAKSKDIPLRKGHEAGGETLLTLVYICKTLGVKCISAYAFSIENFN 123
           VP HV FIMDGNRRFA+ K++ +++GHEAG  ++  ++ +C   GV   + +AFSIENF 
Sbjct: 31  VPRHVGFIMDGNRRFARKKEMDVKEGHEAGFVSMSRILELCYEAGVDTATVFAFSIENFK 90

Query: 124 RPREEVETLMNLFGDKLDEFAQKANDYKDPLYGSSLRIVGDRSLISPELRERIENVEKLT 183
           R   EVE+LM L  +++ +  ++        YG  ++I+GD SL+   L E +    + T
Sbjct: 91  RSSREVESLMTLARERIRQITERGELACK--YGVRIKIIGDLSLLDKSLLEDVRVAVETT 148

Query: 184 ENSEKFILYICFPYTSRNDIFQTVTKVTDKYVQSNIID-SNLSINEFTKSMHFKEYSDNC 242
           +N+++  L ICFPYT R +I   + +   ++ +   ID S L  + +T  +         
Sbjct: 149 KNNKRATLNICFPYTGREEILHAMKETIVQHKKGAAIDESTLESHLYTAGV------PPL 202

Query: 243 DILIRTSGHKRLSDFMLWQVNEHAT-MEFSTSLWPQFNFFQMYLIILRWSMFKMF 296
           D+LIRTSG  RLSDF++WQ +     +E    LWP+F   +M  I+L++S  K F
Sbjct: 203 DLLIRTSGVSRLSDFLIWQASSKGVRIELLDCLWPEFGPIRMAWILLKFSFHKSF 257

>KLLA0F19668g complement(1819417..1819905) no similarity,
           hypothetical start
          Length = 162

 Score = 32.3 bits (72), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%)

Query: 276 PQFNFFQMYLIILRWSMFKMFQIYNMNNVSKHSKFGSKLYKPYKTILKYIFSE 328
           PQ   + M   ++++S+ K+  IY+MNN++   K   KL       LK IF++
Sbjct: 35  PQMRRYNMKCEVVQFSLEKLKIIYDMNNLTGSDKVNEKLLYQLNERLKIIFTK 87

>YPR118W (YPR118W) [5539] chr16 (767748..768983) Member of the
           initiation factor 2 subunit family, has high similarity
           to uncharacterized C. albicans Orf6.6352p [1236 bp, 411
           aa]
          Length = 411

 Score = 31.6 bits (70), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 34/76 (44%), Gaps = 10/76 (13%)

Query: 55  LIFALRTGPVPAHVAFIMDGNRRFAKSKDIPLRKGHEAGGETLLTLVYICKTLGVK-CIS 113
           + + +RT P+P   AF+  G  R        +R G  A     L L  ICK  G+K  + 
Sbjct: 261 IAYRIRTSPIPIKAAFV--GADRI-------VRNGDTANKIGTLQLAVICKQFGIKFFVV 311

Query: 114 AYAFSIENFNRPREEV 129
           A   +I+N     +++
Sbjct: 312 APKTTIDNVTETGDDI 327

>Scas_538.5
          Length = 266

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 34/73 (46%), Gaps = 3/73 (4%)

Query: 171 ELRERIENVEKLTENSEKFILYICFPYTSRNDIFQTVTKVTDKYVQSNIIDSNLSINEFT 230
           +LR+  EN+  L   +   I     P+   NDI    +K   +    N ID+N  IN+F 
Sbjct: 128 KLRDPNENLIILAPTNSAIIELSLKPWEFPNDIDALESKGASEMELDNAIDAN--INKFV 185

Query: 231 KSMHFKEYSDNCD 243
           +S H   Y DN D
Sbjct: 186 RS-HIVSYDDNKD 197

>Kwal_27.11998
          Length = 414

 Score = 30.0 bits (66), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 28/125 (22%), Positives = 56/125 (44%), Gaps = 12/125 (9%)

Query: 197 YTSRNDIFQTVTKVTDKYVQSNIIDSNLSINEFTKSMHFKEYS---DNCDILIRTSGHKR 253
           Y  + ++  TVTK  ++ +  + ID    +   TK+M F++Y    +   +L R   H+ 
Sbjct: 213 YDPKENVLHTVTKPINEVLLDSGIDFKQDVRTLTKNMQFRQYEMSLNEPAVLYRLPTHEP 272

Query: 254 L------SDFMLWQVNEHATMEFSTSLWPQFNFFQM-YLIILRWSM--FKMFQIYNMNNV 304
           +         +L   NE     +  S+  +   F + + I +R+ +   K F+I+   +V
Sbjct: 273 ILTEAPPETVLLKSKNELEPFRYHNSITTRGKLFSVTHGITMRFKIGNAKDFEIHQPLDV 332

Query: 305 SKHSK 309
           S  +K
Sbjct: 333 SPWTK 337

>CAGL0C01397g complement(148889..151177) similar to sp|P40433
           Saccharomyces cerevisiae YIL107c PFK26, start by
           similarity
          Length = 762

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 3/45 (6%)

Query: 8   LFICVVEVMSIGSSSVTKFISDYATVLFYYCKSFYYINVITTSIQ 52
           L I +V + + G S +T  +S Y   L YYCK F   NV  T  Q
Sbjct: 176 LIIVMVGLPATGKSFITNKLSRYLNYLMYYCKVF---NVGNTRRQ 217

>KLLA0C18447g complement(1629477..1630805) similar to sgd|S0004313
           Saccharomyces cerevisiae YLR321c SFH1 subunit of the RSC
           complex, start by similarity
          Length = 442

 Score = 28.9 bits (63), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 3/34 (8%)

Query: 249 SGHKRLSDFMLWQVNEHATM--EFSTSLWPQFNF 280
           SGHK L+DF +W +N+H+    +F+T L    +F
Sbjct: 220 SGHK-LADFFMWNLNDHSMTPEQFATILCQDLDF 252

>CAGL0L04862g complement(554884..556695) similar to sp|P48837
           Saccharomyces cerevisiae YGR119c NUP57 nuclear pore
           protein, start by similarity
          Length = 603

 Score = 28.9 bits (63), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 20/91 (21%), Positives = 37/91 (40%), Gaps = 13/91 (14%)

Query: 126 REEVETLMNLFGDKLDEFAQKANDYKDPLYGSSLRIVGDRSLISPELRERIENVEKLTEN 185
           RE  +T+      KL    +       P         GD + +S E+ +RI+ + ++ +N
Sbjct: 524 RERAKTISEQLDSKLVIIGENGGQTGKP------SASGDNNRVSDEVYDRIDKIAEILKN 577

Query: 186 SEKFILYICFPYTSRNDIFQTVTKVTDKYVQ 216
            +  I Y+       ND+ +   K  D  V+
Sbjct: 578 QQSGIAYL-------NDVLEKDNKALDSVVE 601

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.138    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,223,743
Number of extensions: 484136
Number of successful extensions: 2183
Number of sequences better than 10.0: 41
Number of HSP's gapped: 2221
Number of HSP's successfully gapped: 41
Length of query: 337
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 235
Effective length of database: 13,065,073
Effective search space: 3070292155
Effective search space used: 3070292155
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 62 (28.5 bits)