Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0K03267g48748022680.0
Kwal_26.81523732435944e-72
Scas_709.573942595791e-69
ABR048W3573705593e-67
KLLA0F25388g4052774858e-56
YHL020C (OPI1)4042404202e-46
Kwal_14.239420796672.6
YLR221C22065663.5
YHR023W (MYO1)192871648.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0K03267g
         (480 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0K03267g 299090..300553 similar to tr|AAB65073 Saccharomyces...   878   0.0  
Kwal_26.8152                                                          233   4e-72
Scas_709.57                                                           227   1e-69
ABR048W [639] [Homologous to ScYHL020C (OPI1) - SH] complement(4...   219   3e-67
KLLA0F25388g complement(2362150..2363367) some similarities with...   191   8e-56
YHL020C (OPI1) [2266] chr8 complement(66238..67452) Negative reg...   166   2e-46
Kwal_14.2394                                                           30   2.6  
YLR221C (RSA3) [3621] chr12 complement(578364..579026) Protein o...    30   3.5  
YHR023W (MYO1) [2310] chr8 (151658..157444) Myosin heavy chain (...    29   8.5  

>CAGL0K03267g 299090..300553 similar to tr|AAB65073 Saccharomyces
           cerevisiae YHL020c Negative regulator of phospholipid
           biosynthesis, hypothetical start
          Length = 487

 Score =  878 bits (2268), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/480 (90%), Positives = 434/480 (90%)

Query: 1   MDTRRGWIHNYISFSGLSXXXXXXXXXXXXXRNSHVDADVEVEEDRSKKRVRDGEDEDGG 60
           MDTRRGWIHNYISFSGLS             RNSHVDADVEVEEDRSKKRVRDGEDEDGG
Sbjct: 1   MDTRRGWIHNYISFSGLSEEDVEAAEALDVLRNSHVDADVEVEEDRSKKRVRDGEDEDGG 60

Query: 61  HVRRRKASVRDRSDSRMSQLSNVSNASTEERVVRVNSHEDSQSKRQEEESLFDKVCRNSN 120
           HVRRRKASVRDRSDSRMSQLSNVSNASTEERVVRVNSHEDSQSKRQEEESLFDKVCRNSN
Sbjct: 61  HVRRRKASVRDRSDSRMSQLSNVSNASTEERVVRVNSHEDSQSKRQEEESLFDKVCRNSN 120

Query: 121 EILTNMGSFFEEMNSNVFMEGGSDVPEEHPNGYVRPRRDSRSISTTGADADTESQGTQGS 180
           EILTNMGSFFEEMNSNVFMEGGSDVPEEHPNGYVRPRRDSRSISTTGADADTESQGTQGS
Sbjct: 121 EILTNMGSFFEEMNSNVFMEGGSDVPEEHPNGYVRPRRDSRSISTTGADADTESQGTQGS 180

Query: 181 YNGKWDTWSSRSYNDRQYYSKRKALSEALAKGRYNLREYKLTMSIESKKRLITCLHLLKL 240
           YNGKWDTWSSRSYNDRQYYSKRKALSEALAKGRYNLREYKLTMSIESKKRLITCLHLLKL
Sbjct: 181 YNGKWDTWSSRSYNDRQYYSKRKALSEALAKGRYNLREYKLTMSIESKKRLITCLHLLKL 240

Query: 241 ANKQLSDKVAYLQDAVEKEQELANGEEVKKETRALNGEHSGPQNDDDLEFYDASESVDQN 300
           ANKQLSDKVAYLQDAVEKEQELANGEEVKKETRALNGEHSGPQNDDDLEFYDASESVDQN
Sbjct: 241 ANKQLSDKVAYLQDAVEKEQELANGEEVKKETRALNGEHSGPQNDDDLEFYDASESVDQN 300

Query: 301 SGDLGLEIVGTVKKVYSLISKYTGSSLPEPARSQVRESLLNLPSNWNTSVHNGFKNNGTG 360
           SGDLGLEIVGTVKKVYSLISKYTGSSLPEPARSQVRESLLNLPSNWNTSVHNGFKNNGTG
Sbjct: 301 SGDLGLEIVGTVKKVYSLISKYTGSSLPEPARSQVRESLLNLPSNWNTSVHNGFKNNGTG 360

Query: 361 IMTAXXXXXXXXXXXXXXXXXXNGKYLILAKESLNMVQSVIDVVDSTLGRAEEWVKQKQE 420
           IMTA                  NGKYLILAKESLNMVQSVIDVVDSTLGRAEEWVKQKQE
Sbjct: 361 IMTASSSTDSLSSYSSILPVSSNGKYLILAKESLNMVQSVIDVVDSTLGRAEEWVKQKQE 420

Query: 421 LKEMIKKKFLEQQEHQKMLGIGTESLDQNESSVKKEQPXXXXXXXXXXXXXXXLDTVKEE 480
           LKEMIKKKFLEQQEHQKMLGIGTESLDQNESSVKKEQP               LDTVKEE
Sbjct: 421 LKEMIKKKFLEQQEHQKMLGIGTESLDQNESSVKKEQPTTHISISSITNSTNTLDTVKEE 480

>Kwal_26.8152
          Length = 373

 Score =  233 bits (594), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 125/243 (51%), Positives = 169/243 (69%), Gaps = 26/243 (10%)

Query: 196 RQYYSKRKALSEALAKGRYNLREYKLTMSIESKKRLITCLHLLKLANKQLSDKVAYLQDA 255
           R+  SKR+ +S A+AK + NL+ Y+L MSIESKKRL+TCLHLLKLAN QLS++V +LQD 
Sbjct: 147 RKRTSKRQKISNAIAKSKVNLKGYQLDMSIESKKRLVTCLHLLKLANNQLSNRVGFLQDL 206

Query: 256 VEKEQELANGEEVKKETRALNGEHSGPQNDDDLEFYDASESVDQNSGDLGLEIVGTVKKV 315
           V KEQ+L  G    ++           ++DD+ E+YDAS+++D+ S  + +EIVGTVKKV
Sbjct: 207 VLKEQKLRKGRIRDRQA----------ESDDEEEYYDASDNIDELSNVVKMEIVGTVKKV 256

Query: 316 YSLISKYTGSSLPEPARSQVRESLLNLPSNWNTSVHNGFKNNGTGIMTAXXXXXXXXXXX 375
           YSLISK+TGSSLPEPAR+QVRESLL LP NW +++++                       
Sbjct: 257 YSLISKFTGSSLPEPARTQVRESLLKLPMNWTSTMNS----------------ENLARYT 300

Query: 376 XXXXXXXNGKYLILAKESLNMVQSVIDVVDSTLGRAEEWVKQKQELKEMIKKKFLEQQEH 435
                  NGK LILAKESL MV +V++VVD+TLG+AEEWVKQKQE+KE++KK++L  +  
Sbjct: 301 SSKGVSPNGKVLILAKESLGMVHNVMNVVDNTLGKAEEWVKQKQEVKELLKKQYLHGRYR 360

Query: 436 QKM 438
           +K+
Sbjct: 361 EKV 363

>Scas_709.57
          Length = 394

 Score =  227 bits (579), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 136/259 (52%), Positives = 176/259 (67%), Gaps = 33/259 (12%)

Query: 195 DRQYYSKRKALSEALAKGRYNLREYKLTMSIESKKRLITCLHLLKLANKQLSDKVAYLQD 254
           D    SKR+ LSEAL K + N +EYKL MSIESKKRLITCLHLLKLANKQLSDKV +LQ+
Sbjct: 140 DEYVVSKRRKLSEALLKSKDNFKEYKLNMSIESKKRLITCLHLLKLANKQLSDKVTFLQE 199

Query: 255 --------------AVEKEQELANGEEVKKETRALNGEH----SGPQNDDDLEFYDASES 296
                         A+EK+      E V +  +  + EH       +++D+ EF+DA+ES
Sbjct: 200 LVEEEETVKEEDSHAIEKK------EHVVRNKKQQHTEHEDDEDEDEDEDEDEFFDANES 253

Query: 297 V--DQNSGDLGLEIVGTVKKVYSLISKYTGSSLPEPARSQVRESLLNLPSNWNTSVHNGF 354
           V  D+    + +EIVGT+KKVYSL+SKY G+SLPEPAR+QVRE+LLNLP+NW  SV+N F
Sbjct: 254 VNYDEKCTIINMEIVGTIKKVYSLVSKYGGTSLPEPARTQVREALLNLPTNWTISVNNSF 313

Query: 355 KNNGTGIMTAXXXXXXXXXXXXXXXXXXNGKYLILAKESLNMVQSVIDVVDSTLGRAEEW 414
            ++ T                       NGK LILAKESLN+V++++DVVDS+LG+AEEW
Sbjct: 314 FSSSTA-------PAATEPPKDEPLLTTNGKVLILAKESLNVVRNIMDVVDSSLGKAEEW 366

Query: 415 VKQKQELKEMIKKKFLEQQ 433
           VKQKQELKEMI+++FL++Q
Sbjct: 367 VKQKQELKEMIREQFLQRQ 385

>ABR048W [639] [Homologous to ScYHL020C (OPI1) - SH]
           complement(481129..482202) [1074 bp, 357 aa]
          Length = 357

 Score =  219 bits (559), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 147/370 (39%), Positives = 205/370 (55%), Gaps = 71/370 (19%)

Query: 77  MSQLSNVSNASTEERVVRVNSHEDSQSKRQEE--ESLFDKVCR-NSNEILTNMGSFFEEM 133
           +S+L N +N  T  R+ + +  E  Q+++ ++  E+L    CR   N I TN  S +E+ 
Sbjct: 20  LSRLCNGTNGET--RLEKSHGAEQGQAQQHQDDGETLL---CRMRQNPIFTNAVSLYEQT 74

Query: 134 NSNVFMEGGSDVPEEHPNGYVRPRRDSRSIST---------TGADADTESQGTQGSYNGK 184
            S+            HPN   R     RS ST            D  ++ +  +    G 
Sbjct: 75  KSH------------HPNFRRRAELVERSASTMVRRTSELWAPRDGASKHRLEESCETG- 121

Query: 185 WDTWSSRSYNDRQYYSKRKALSEALAKGRYNLREYKLTMSIESKKRLITCLHLLKLANKQ 244
             T            SKR+ + E       NL+EY+LTMSIESKK+LITCLHLLKLAN+Q
Sbjct: 122 --TPLDDEVGPSPRVSKRQKIKE-------NLKEYRLTMSIESKKQLITCLHLLKLANRQ 172

Query: 245 LSDKVAYLQDAVEKEQELANGEEVKKETRALNGEHSGPQNDDDLEFYDASES-VDQNSGD 303
           LS  V  LQD V+KE+E +   E              P+ +D  +++DASE+ V + S +
Sbjct: 173 LSSTVGSLQDLVQKEREDSGPRE--------------PEEEDGEQYFDASETIVSERSKE 218

Query: 304 LGLEIVGTVKKVYSLISKYTGSSLPEPARSQVRESLLNLPSNWNTSVHNGFKNNGTGIMT 363
           + +E+VGTVKKVYSLIS++ GSSLPEPARSQVRE+LL +P+NW+ +V++  +   T    
Sbjct: 219 IKMEVVGTVKKVYSLISRFAGSSLPEPARSQVRETLLKMPTNWSLTVNSASRETPTNARL 278

Query: 364 AXXXXXXXXXXXXXXXXXXNGKYLILAKESLNMVQSVIDVVDSTLGRAEEWVKQKQELKE 423
           +                  N K LILA+ESL+MV ++I V D TLGRAEEWVK KQELKE
Sbjct: 279 S-----------------ANSKMLILAEESLDMVSNIIQVFDMTLGRAEEWVKHKQELKE 321

Query: 424 MIKKKFLEQQ 433
           +IK +++E Q
Sbjct: 322 LIKSQYMEAQ 331

>KLLA0F25388g complement(2362150..2363367) some similarities with
           sp|P21957 Saccharomyces cerevisiae YHL020c OPI1 negative
           regulator of phospholipid biosynthesis pathway
           singleton, hypothetical start
          Length = 405

 Score =  191 bits (485), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 119/277 (42%), Positives = 161/277 (58%), Gaps = 67/277 (24%)

Query: 200 SKRKALSEALAKGRYNLREYKLTMSIESKKRLITCLHLLKLANKQLSDKVAYLQDAVEKE 259
           SKR+ + E       NL+EY+L MSIESKKRL+TCL LLKLANKQLS +V  LQD V+KE
Sbjct: 142 SKRRRIKE-------NLKEYQLNMSIESKKRLMTCLGLLKLANKQLSQRVMSLQDVVKKE 194

Query: 260 Q-----ELANGEEVKKETRALN----------GEHSGPQNDD--DLEFYDASESVDQNSG 302
           Q      L     +  E R  N           EH G   D+  D +F+DAS  +++ +G
Sbjct: 195 QLRRRSPLPISSSIDAEVRPRNHCSVRETTSSAEHPGHDRDEEEDEQFFDASSQLNEQAG 254

Query: 303 ---------------------DLGLEIVGTVKKVYSLISKYTGSSLPEPARSQVRESLLN 341
                                D+ LE+VGT+KKVYS++S++TG+SLPEPARSQVRESLL 
Sbjct: 255 NRKQDDTNKEQEDLDIDAAANDIQLEVVGTLKKVYSVVSRFTGNSLPEPARSQVRESLLK 314

Query: 342 LPSNWNTSVHNGFKNNGTGIMTAXXXXXXXXXXXXXXXXXXNGKYLILAKESLNMVQSVI 401
           LP+ W   + N  K N   I +                   N + L+LA+E+L+MV +V+
Sbjct: 315 LPTKW---MINSEKPNSKRISS-------------------NKRALLLAQEALDMVGNVM 352

Query: 402 DVVDSTLGRAEEWVKQKQELKEMIKKKFLEQQEHQKM 438
           +VVD TLG+AEEWVK KQELK+M+ ++F  +Q  Q++
Sbjct: 353 NVVDGTLGKAEEWVKNKQELKQMLMEQFRHEQLKQQV 389

>YHL020C (OPI1) [2266] chr8 complement(66238..67452) Negative
           regulator of phospholipid biosynthesis pathway [1215 bp,
           404 aa]
          Length = 404

 Score =  166 bits (420), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 112/240 (46%), Positives = 148/240 (61%), Gaps = 38/240 (15%)

Query: 117 RNSNEILTNMGSFFEEMNSNVFMEGGSDVPEEHPNGYVRPRRDSRSISTTGADADTESQG 176
           R SN+I++N+ +F++E+N+N                  RP +    +     D   +   
Sbjct: 58  RVSNKIISNVVTFYDEINTN-----------------KRPLKSIGRLLDDDDDEHDDYDY 100

Query: 177 TQGSYNGKWDTWSSRSYNDRQYYSKRKALSEALAKGRYNLREYKLTMSIESKKRLITCLH 236
               +                + +KR+ LS A+AKG+ NL+EYKL MSIESKKRL+TCLH
Sbjct: 101 NDDEF----------------FTNKRQKLSRAIAKGKDNLKEYKLNMSIESKKRLVTCLH 144

Query: 237 LLKLANKQLSDKVAYLQDAVEKEQELANGEE---VKKETRALNGEHSGPQNDDDLEFYDA 293
           LLKLANKQLSDK++ LQD VEKEQ     ++    +  T A   E S  ++DDD EF+DA
Sbjct: 145 LLKLANKQLSDKISCLQDLVEKEQVHPLHKQDGNARTTTGAGEDETSSDEDDDDEEFFDA 204

Query: 294 SESVD--QNSGDLGLEIVGTVKKVYSLISKYTGSSLPEPARSQVRESLLNLPSNWNTSVH 351
           SE V+  + S  + +E+VGTVKKVYSLISK+T +SLPEPARSQVRESLLNLP+NW  SVH
Sbjct: 205 SEQVNASEQSIVVKMEVVGTVKKVYSLISKFTANSLPEPARSQVRESLLNLPTNWFDSVH 264

 Score = 79.7 bits (195), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 45/48 (93%)

Query: 383 NGKYLILAKESLNMVQSVIDVVDSTLGRAEEWVKQKQELKEMIKKKFL 430
           NGK LILAKESL MV++V+ VVDSTLG+AEEWVKQKQE+KEMI+++FL
Sbjct: 329 NGKVLILAKESLEMVRNVMGVVDSTLGKAEEWVKQKQEVKEMIRERFL 376

>Kwal_14.2394
          Length = 207

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 45/96 (46%), Gaps = 6/96 (6%)

Query: 74  DSRMSQLSNVSNASTEERVVRVNSHEDSQSKRQEEESLFDKVCRNSNEILTNMGSFFEEM 133
           D  +  + N  +  TEE   R    ED+Q   QE+  LF +V   +    + + + F+E+
Sbjct: 112 DLVICLVGNKLDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTG---SGVAAIFQEI 168

Query: 134 NSNVFMEGGSDV---PEEHPNGYVRPRRDSRSISTT 166
             NV+ + G+     P+      V+ +R S + ST+
Sbjct: 169 GENVYQKKGAATAASPQARKTPNVKLQRPSTNDSTS 204

>YLR221C (RSA3) [3621] chr12 complement(578364..579026) Protein of
           unknown function [663 bp, 220 aa]
          Length = 220

 Score = 30.0 bits (66), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 5/65 (7%)

Query: 277 GEHSGPQNDDDLEFYDASESVDQNSGDLGLEIVGTVKKVYSLISKYTGSSLPEPARSQVR 336
           G     Q D  +E  D  E  D+ S DL L      K+V   ++K + S +PEP +SQ +
Sbjct: 69  GNDEDKQEDIAIEVSDV-ELTDEESKDLKL----NSKEVIDDLTKISLSKIPEPTKSQNK 123

Query: 337 ESLLN 341
           E  +N
Sbjct: 124 EGFMN 128

>YHR023W (MYO1) [2310] chr8 (151658..157444) Myosin heavy chain
            (myosin II), coiled-coil protein involved in septation
            and cell wall organization [5787 bp, 1928 aa]
          Length = 1928

 Score = 29.3 bits (64), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 42/71 (59%), Gaps = 4/71 (5%)

Query: 242  NKQLSDKVAYLQDA--VEKEQELANGEEVKKETRALNG--EHSGPQNDDDLEFYDASESV 297
            NK++++K+ YL++   ++ EQ   NGE VK    + NG  +    +   +++ Y+ ++++
Sbjct: 1712 NKEITEKIKYLEETLQLQMEQNSRNGELVKTLQASCNGYKDKFDDEKQKNIDLYEENQTL 1771

Query: 298  DQNSGDLGLEI 308
             + + DL L++
Sbjct: 1772 QKLNTDLQLQL 1782

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.308    0.125    0.344 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,721,458
Number of extensions: 646525
Number of successful extensions: 3321
Number of sequences better than 10.0: 116
Number of HSP's gapped: 3288
Number of HSP's successfully gapped: 120
Length of query: 480
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 375
Effective length of database: 12,961,219
Effective search space: 4860457125
Effective search space used: 4860457125
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 63 (28.9 bits)