Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0K02937g43843120200.0
Scas_489.3*43743116010.0
Sklu_1977.244441315340.0
Kwal_26.797644838615160.0
KLLA0E18766g44643914890.0
AGL066W45038614700.0
YKL027W44743714250.0
YHR003C42943310881e-146
YHR111W (UBA4)440151730.63
Kwal_55.2127860078720.75
CAGL0I01254g433186720.86
AER248W44383711.0
Sklu_2217.165441682.6
Sklu_2344.6439192672.7
YHR171W (ATG7)63050682.7
CAGL0I02420g62350647.4
Scas_576.377952648.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0K02937g
         (431 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0K02937g complement(260273..261589) highly similar to sp|P36...   782   0.0  
Scas_489.3*                                                           621   0.0  
Sklu_1977.2 YKL027W, Contig c1977 674-2008 reverse complement         595   0.0  
Kwal_26.7976                                                          588   0.0  
KLLA0E18766g 1659258..1660598 similar to sp|P36101 Saccharomyces...   578   0.0  
AGL066W [4245] [Homologous to ScYKL027W - SH; ScYHR003C - SH] co...   570   0.0  
YKL027W (YKL027W) [3228] chr11 (387205..388548) Protein with sim...   553   0.0  
YHR003C (YHR003C) [2288] chr8 complement(110022..111311) Member ...   423   e-146
YHR111W (UBA4) [2399] chr8 (333074..334396) Ubiquitin-activating...    33   0.63 
Kwal_55.21278                                                          32   0.75 
CAGL0I01254g 102965..104266 highly similar to sp|P38820 Saccharo...    32   0.86 
AER248W [2750] [Homologous to ScYHR111W - SH] complement(1094793...    32   1.0  
Sklu_2217.1 YOR181W, Contig c2217 1454-3418                            31   2.6  
Sklu_2344.6 YHR111W, Contig c2344 8194-9513                            30   2.7  
YHR171W (ATG7) [2458] chr8 (445711..447603) Apg12p-activating en...    31   2.7  
CAGL0I02420g 214100..215971 similar to sp|P38862 Saccharomyces c...    29   7.4  
Scas_576.3                                                             29   8.4  

>CAGL0K02937g complement(260273..261589) highly similar to sp|P36101
           Saccharomyces cerevisiae YKL027w or sp|P38756
           Saccharomyces cerevisiae YHR003c, start by similarity
          Length = 438

 Score =  782 bits (2020), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/431 (89%), Positives = 387/431 (89%)

Query: 1   MGKDHWXXXXXXXXXXXXXXXXXEVAWKKYVEQKDAITQQVSVKKMLKREYDDNLFREQL 60
           MGKDHW                 EVAWKKYVEQKDAITQQVSVKKMLKREYDDNLFREQL
Sbjct: 1   MGKDHWKLVAVTAAVTITLTKIAEVAWKKYVEQKDAITQQVSVKKMLKREYDDNLFREQL 60

Query: 61  ARNYAFLGEDGMEKLKNQYIXXXXXXXXXXXXXTMLIRSGCKKIRVIDFDQVSLSSLNRH 120
           ARNYAFLGEDGMEKLKNQYI             TMLIRSGCKKIRVIDFDQVSLSSLNRH
Sbjct: 61  ARNYAFLGEDGMEKLKNQYIVVVGAGGVGSWVVTMLIRSGCKKIRVIDFDQVSLSSLNRH 120

Query: 121 SCATLEDVGASKVDCLKAHMEKIAPWCQIEAINSLWXXXXXXXXXXXXXXPTMVVDCIDN 180
           SCATLEDVGASKVDCLKAHMEKIAPWCQIEAINSLW              PTMVVDCIDN
Sbjct: 121 SCATLEDVGASKVDCLKAHMEKIAPWCQIEAINSLWNKENGEELLLGGGKPTMVVDCIDN 180

Query: 181 IDTKVDLLEFTYSNKIEVISSMGASTKSDPTRINVGDITITEEDPLARAVRRRLKIKGIT 240
           IDTKVDLLEFTYSNKIEVISSMGASTKSDPTRINVGDITITEEDPLARAVRRRLKIKGIT
Sbjct: 181 IDTKVDLLEFTYSNKIEVISSMGASTKSDPTRINVGDITITEEDPLARAVRRRLKIKGIT 240

Query: 241 TGINVVFSAEKPDPRKAKLLPLPDDEYSKGKVGELSALKDFRVRILPVLGTMPGIFGLTI 300
           TGINVVFSAEKPDPRKAKLLPLPDDEYSKGKVGELSALKDFRVRILPVLGTMPGIFGLTI
Sbjct: 241 TGINVVFSAEKPDPRKAKLLPLPDDEYSKGKVGELSALKDFRVRILPVLGTMPGIFGLTI 300

Query: 301 ATWILTKVSGYPMNPIEGKNRIKVYDGIYQSLAGQMTRIGMPDQRVPIALKEVGYIVEEV 360
           ATWILTKVSGYPMNPIEGKNRIKVYDGIYQSLAGQMTRIGMPDQRVPIALKEVGYIVEEV
Sbjct: 301 ATWILTKVSGYPMNPIEGKNRIKVYDGIYQSLAGQMTRIGMPDQRVPIALKEVGYIVEEV 360

Query: 361 FRGKSPVSGFSTRLTLSKWDPKKPVSLQNVVVLTKEEQKEHEQRILNGKEALSDVYSQDV 420
           FRGKSPVSGFSTRLTLSKWDPKKPVSLQNVVVLTKEEQKEHEQRILNGKEALSDVYSQDV
Sbjct: 361 FRGKSPVSGFSTRLTLSKWDPKKPVSLQNVVVLTKEEQKEHEQRILNGKEALSDVYSQDV 420

Query: 421 IDLVNQRFEEE 431
           IDLVNQRFEEE
Sbjct: 421 IDLVNQRFEEE 431

>Scas_489.3*
          Length = 437

 Score =  621 bits (1601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/431 (70%), Positives = 342/431 (79%), Gaps = 1/431 (0%)

Query: 1   MGKDHWXXXXXXXXXXXXXXXXXEVAWKKYVEQKDAITQQVSVKKMLKREYDDNLFREQL 60
           MG   W                 +VAW +Y   +    +Q  +  + KREY D LFREQL
Sbjct: 1   MGNSTWKVIAGTALLTAAATKCLDVAWTQYKSTQLNEPKQTEIANVDKREYSDELFREQL 60

Query: 61  ARNYAFLGEDGMEKLKNQYIXXXXXXXXXXXXXTMLIRSGCKKIRVIDFDQVSLSSLNRH 120
           ARNYAFLGE+GMEKLK QYI             TML+RSGC +IRVIDFDQVSLSSLNRH
Sbjct: 61  ARNYAFLGEEGMEKLKQQYIVVVGAGGVGSWVVTMLVRSGCTRIRVIDFDQVSLSSLNRH 120

Query: 121 SCATLEDVGASKVDCLKAHMEKIAPWCQIEAINSLWXXXXXXXXXXXXXXPTMVVDCIDN 180
           SCATL+DVG SKV CLK HM +IAPWC+IEAIN LW              PT VVDCIDN
Sbjct: 121 SCATLKDVGTSKVGCLKQHMAEIAPWCEIEAINELWTKESGERLIFGAGQPTFVVDCIDN 180

Query: 181 IDTKVDLLEFTYSNKIEVISSMGASTKSDPTRINVGDITITEEDPLARAVRRRLKIKGIT 240
           +DTKVDLLEF Y+  I+VISS G   K DPTRINVGDI+ TEEDP+AR+VRRRLKIKGIT
Sbjct: 181 LDTKVDLLEFVYNKNIDVISSHGGFYKGDPTRINVGDISSTEEDPMARSVRRRLKIKGIT 240

Query: 241 TGINVVFSAEKPDPRKAKLLPLPDDEYSKGKVGELSALKDFRVRILPVLGTMPGIFGLTI 300
           TGI VVFSAEKPDPRKAKLLPLPD+EY KG+VGELSALKDFRVRILPVLGTMPGIFGLT+
Sbjct: 241 TGIPVVFSAEKPDPRKAKLLPLPDEEYEKGQVGELSALKDFRVRILPVLGTMPGIFGLTL 300

Query: 301 ATWILTKVSGYPMNPIEGKNRIKVYDGIYQSLAGQMTRIGMPDQRVPIALKEVGYIVEEV 360
           ATWILTKV+GYPMNPIEGKNRIKVYDGIYQSLAGQM+RIG  +QRVPIA+ ++GYIVEEV
Sbjct: 301 ATWILTKVAGYPMNPIEGKNRIKVYDGIYQSLAGQMSRIG-KEQRVPIAITDIGYIVEEV 359

Query: 361 FRGKSPVSGFSTRLTLSKWDPKKPVSLQNVVVLTKEEQKEHEQRILNGKEALSDVYSQDV 420
           FRGKSPVSG+STRLTLS+WDP+KPVSLQNVV+LTK+EQKEHE+R+LNG E +  VYS+DV
Sbjct: 360 FRGKSPVSGYSTRLTLSQWDPEKPVSLQNVVILTKDEQKEHERRVLNGGEKIEGVYSKDV 419

Query: 421 IDLVNQRFEEE 431
           +DL+ +RFEEE
Sbjct: 420 LDLIKKRFEEE 430

>Sklu_1977.2 YKL027W, Contig c1977 674-2008 reverse complement
          Length = 444

 Score =  595 bits (1534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/413 (71%), Positives = 332/413 (80%), Gaps = 5/413 (1%)

Query: 24  EVAWKKYVEQKDAITQ-QVSVKKMLKRE-YDDNLFREQLARNYAFLGEDGMEKLKNQYIX 81
           ++A K Y E    + Q +   KK  + E YDD+LFREQLARNYAFLGE+GMEKLK Q I 
Sbjct: 25  DLAIKNYKESGTIVPQTKRHGKKTTETEGYDDDLFREQLARNYAFLGEEGMEKLKQQRII 84

Query: 82  XXXXXXXXXXXXTMLIRSGCKKIRVIDFDQVSLSSLNRHSCATLEDVGASKVDCLKAHME 141
                       TML+RSGC+KI+VIDFDQVSLSSLNRHSCATL+DVG  KV+CLK HM+
Sbjct: 85  VVGAGGVGSWVVTMLVRSGCQKIKVIDFDQVSLSSLNRHSCATLKDVGVPKVECLKQHMK 144

Query: 142 KIAPWCQIEAINSLWXXXXXXXX---XXXXXXPTMVVDCIDNIDTKVDLLEFTYSNKIEV 198
            IAPWCQ++A+N LW                 PT V+DCIDNIDTKVDLLEF Y + I  
Sbjct: 145 GIAPWCQVDAVNELWSKENAERLIFGEDGQYNPTFVIDCIDNIDTKVDLLEFVYKHNIPR 204

Query: 199 ISSMGASTKSDPTRINVGDITITEEDPLARAVRRRLKIKGITTGINVVFSAEKPDPRKAK 258
           ISSMGA+TKSDPTRINVGD+T TEEDPLAR VRRRLK +G+  GI VVFSAEKPDPRKAK
Sbjct: 205 ISSMGAATKSDPTRINVGDLTTTEEDPLARTVRRRLKKRGVIKGIPVVFSAEKPDPRKAK 264

Query: 259 LLPLPDDEYSKGKVGELSALKDFRVRILPVLGTMPGIFGLTIATWILTKVSGYPMNPIEG 318
           LLPLP++E+ KG+V ELSA++DFRVRILPVLGTMPG+FGLTIATW+LTK+SGYPM PIEG
Sbjct: 265 LLPLPEEEFQKGQVDELSAIRDFRVRILPVLGTMPGVFGLTIATWVLTKLSGYPMEPIEG 324

Query: 319 KNRIKVYDGIYQSLAGQMTRIGMPDQRVPIALKEVGYIVEEVFRGKSPVSGFSTRLTLSK 378
           KNRIK+YDGIYQSLA QM+RIGMPDQRVPIAL E+GYIVEEVFRGKSPVSGFSTRLTLSK
Sbjct: 325 KNRIKIYDGIYQSLASQMSRIGMPDQRVPIALSEIGYIVEEVFRGKSPVSGFSTRLTLSK 384

Query: 379 WDPKKPVSLQNVVVLTKEEQKEHEQRILNGKEALSDVYSQDVIDLVNQRFEEE 431
           WDP KPVSLQNVVVLTKEEQKEHE RILNG E L DVYS + +  V +RF EE
Sbjct: 385 WDPSKPVSLQNVVVLTKEEQKEHETRILNGTERLEDVYSPEALATVKKRFVEE 437

>Kwal_26.7976
          Length = 448

 Score =  588 bits (1516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/386 (73%), Positives = 318/386 (82%), Gaps = 3/386 (0%)

Query: 49  REYDDNLFREQLARNYAFLGEDGMEKLKNQYIXXXXXXXXXXXXXTMLIRSGCKKIRVID 108
           R+YDD L REQLARNYAFLGE+GM+ LK Q +             TML+RSG   I+VID
Sbjct: 56  RDYDDELIREQLARNYAFLGEEGMKALKAQNVVVVGAGGVGSWVVTMLVRSGIYNIKVID 115

Query: 109 FDQVSLSSLNRHSCATLEDVGASKVDCLKAHMEKIAPWCQIEAINSLWXXXXXXXX---X 165
           FDQVSLSSLNRHSCA L+DVG SKV CLK H+++IAPWC I+A++ LW            
Sbjct: 116 FDQVSLSSLNRHSCANLKDVGTSKVGCLKKHLQEIAPWCNIDAVHELWTKDNAQRLLFGE 175

Query: 166 XXXXXPTMVVDCIDNIDTKVDLLEFTYSNKIEVISSMGASTKSDPTRINVGDITITEEDP 225
                PT V+DCIDNIDTKVDLLEF Y ++I VISSMGA+TKSDPTRINVGD++ TEEDP
Sbjct: 176 NGDEKPTFVIDCIDNIDTKVDLLEFVYVHQIPVISSMGAATKSDPTRINVGDLSTTEEDP 235

Query: 226 LARAVRRRLKIKGITTGINVVFSAEKPDPRKAKLLPLPDDEYSKGKVGELSALKDFRVRI 285
           LAR VRRRLK +GIT GI VVFSAEKPDPRKA LLPLP+DE+ KGKV ELSALKDFRVRI
Sbjct: 236 LARTVRRRLKQRGITKGITVVFSAEKPDPRKASLLPLPEDEFQKGKVDELSALKDFRVRI 295

Query: 286 LPVLGTMPGIFGLTIATWILTKVSGYPMNPIEGKNRIKVYDGIYQSLAGQMTRIGMPDQR 345
           LPVLGTMPG+FGLTIA+W+LTK+SGYPM PI GKNRIKVYDGIYQSLAGQMTRIG PDQR
Sbjct: 296 LPVLGTMPGVFGLTIASWLLTKISGYPMEPIVGKNRIKVYDGIYQSLAGQMTRIGRPDQR 355

Query: 346 VPIALKEVGYIVEEVFRGKSPVSGFSTRLTLSKWDPKKPVSLQNVVVLTKEEQKEHEQRI 405
           +PIALKEVGYI EEVFRGKSPVSGFSTRLTLSKWDP KPVSLQNVV+LTKEEQK HE R+
Sbjct: 356 IPIALKEVGYICEEVFRGKSPVSGFSTRLTLSKWDPAKPVSLQNVVLLTKEEQKIHEDRV 415

Query: 406 LNGKEALSDVYSQDVIDLVNQRFEEE 431
           LNG E+L D YSQ+V+DLV +RF EE
Sbjct: 416 LNGGESLEDCYSQEVLDLVKRRFAEE 441

>KLLA0E18766g 1659258..1660598 similar to sp|P36101 Saccharomyces
           cerevisiae YKL027w, start by similarity
          Length = 446

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/439 (63%), Positives = 335/439 (76%), Gaps = 8/439 (1%)

Query: 1   MGKDHWXXXXXXXXXXXXXXXXXEVAWKKYVEQKDAI------TQQVSVKKMLK--REYD 52
           MG D+W                 ++A K + ++  A        + V + K L+  REYD
Sbjct: 1   MGNDNWRVIASTAAITFAGVKFIDLAIKSWNKRTAASYSGSDNEKDVKLAKRLRETREYD 60

Query: 53  DNLFREQLARNYAFLGEDGMEKLKNQYIXXXXXXXXXXXXXTMLIRSGCKKIRVIDFDQV 112
           + L+REQLARNYAFLGE+GMEKLK QY              TML+RSG  +I++IDFDQV
Sbjct: 61  NLLYREQLARNYAFLGEEGMEKLKEQYFIVVGAGGVGSWVVTMLVRSGACRIKIIDFDQV 120

Query: 113 SLSSLNRHSCATLEDVGASKVDCLKAHMEKIAPWCQIEAINSLWXXXXXXXXXXXXXXPT 172
           SLSSLNRHSCA L DVG SKV+ L+ H++KIAPWC IE  N LW              PT
Sbjct: 121 SLSSLNRHSCADLYDVGLSKVNVLRDHLQKIAPWCNIEVCNELWNKENADRLIFGDGTPT 180

Query: 173 MVVDCIDNIDTKVDLLEFTYSNKIEVISSMGASTKSDPTRINVGDITITEEDPLARAVRR 232
            V+DCIDN+DTKVDLLE+TY   I VI+SMGA+TKSDPTRINVGD+T+TEEDPLAR VRR
Sbjct: 181 FVIDCIDNLDTKVDLLEYTYKKNIPVIASMGAATKSDPTRINVGDLTMTEEDPLARTVRR 240

Query: 233 RLKIKGITTGINVVFSAEKPDPRKAKLLPLPDDEYSKGKVGELSALKDFRVRILPVLGTM 292
           RLK +GIT GI  VFSAEKPDP+KAKLLPLP++E+ KG V +LSALKDFRVRILPVLGTM
Sbjct: 241 RLKQRGITKGIPAVFSAEKPDPKKAKLLPLPEEEFQKGNVDQLSALKDFRVRILPVLGTM 300

Query: 293 PGIFGLTIATWILTKVSGYPMNPIEGKNRIKVYDGIYQSLAGQMTRIGMPDQRVPIALKE 352
           PG+FGLTIATW+L K+SGYPM PIEGKNRIK+YDGIYQSLAGQMTRIG  DQR+PIAL +
Sbjct: 301 PGVFGLTIATWVLCKISGYPMEPIEGKNRIKLYDGIYQSLAGQMTRIGQKDQRIPIALSD 360

Query: 353 VGYIVEEVFRGKSPVSGFSTRLTLSKWDPKKPVSLQNVVVLTKEEQKEHEQRILNGKEAL 412
           +GYIVEEV+RGKSP+S +STRLTLSKWDP KPVS+QNV++LTK+EQ+EHE RILNG E  
Sbjct: 361 IGYIVEEVWRGKSPISNYSTRLTLSKWDPTKPVSIQNVILLTKDEQREHEARILNGTETF 420

Query: 413 SDVYSQDVIDLVNQRFEEE 431
           SDVYS++ + ++N+RF+EE
Sbjct: 421 SDVYSEEALAMINKRFQEE 439

>AGL066W [4245] [Homologous to ScYKL027W - SH; ScYHR003C - SH]
           complement(584465..585817) [1353 bp, 450 aa]
          Length = 450

 Score =  570 bits (1470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/386 (70%), Positives = 315/386 (81%), Gaps = 3/386 (0%)

Query: 49  REYDDNLFREQLARNYAFLGEDGMEKLKNQYIXXXXXXXXXXXXXTMLIRSGCKKIRVID 108
           R YD+ L+REQLARNYAFLGEDGM +L+ QY              TML+RSGC+KI+VID
Sbjct: 58  RAYDEELYREQLARNYAFLGEDGMARLQEQYFIVVGAGGVGSWVVTMLVRSGCRKIKVID 117

Query: 109 FDQVSLSSLNRHSCATLEDVGASKVDCLKAHMEKIAPWCQIEAINSLWXXXXXXXXXXX- 167
           FDQVSLSSLNRHSCATL DVG SKV+ LK+H+ KIAPWC+IEA+N LW            
Sbjct: 118 FDQVSLSSLNRHSCATLNDVGHSKVEVLKSHLLKIAPWCEIEAVNELWHIDSAERLIFGN 177

Query: 168 --XXXPTMVVDCIDNIDTKVDLLEFTYSNKIEVISSMGASTKSDPTRINVGDITITEEDP 225
                PT V+DCIDNI TKVDLLE+ Y   I VISSMGA+TKSDPTRINVGD++ TEED 
Sbjct: 178 DGQDKPTFVIDCIDNISTKVDLLEYVYRKGIPVISSMGAATKSDPTRINVGDLSTTEEDS 237

Query: 226 LARAVRRRLKIKGITTGINVVFSAEKPDPRKAKLLPLPDDEYSKGKVGELSALKDFRVRI 285
           L+R+VRRRLK +GIT GI VVFSAEKPDP+KAKLLPLP+++Y  GKV ELSALKDFRVR+
Sbjct: 238 LSRSVRRRLKQRGITKGIPVVFSAEKPDPKKAKLLPLPEEQYLMGKVDELSALKDFRVRV 297

Query: 286 LPVLGTMPGIFGLTIATWILTKVSGYPMNPIEGKNRIKVYDGIYQSLAGQMTRIGMPDQR 345
           LPVLGTMPG+FGLTIATW+L  ++GYPM PIEG+NRIK+YDGIY SLAGQM+RIGMPDQR
Sbjct: 298 LPVLGTMPGVFGLTIATWVLCSIAGYPMEPIEGENRIKLYDGIYHSLAGQMSRIGMPDQR 357

Query: 346 VPIALKEVGYIVEEVFRGKSPVSGFSTRLTLSKWDPKKPVSLQNVVVLTKEEQKEHEQRI 405
           VP+++ +V Y+VEEV+RGKSPVSG+STRLTLSKWDP +PVSLQNVV+LTKEEQ  HE RI
Sbjct: 358 VPVSVADVAYLVEEVYRGKSPVSGYSTRLTLSKWDPSQPVSLQNVVLLTKEEQTAHEARI 417

Query: 406 LNGKEALSDVYSQDVIDLVNQRFEEE 431
           LNG E L DVYS +VI LV+QR +EE
Sbjct: 418 LNGDERLEDVYSPEVIALVHQRLQEE 443

>YKL027W (YKL027W) [3228] chr11 (387205..388548) Protein with
           similarity to E. coli molybdopterin-converting factor
           [1344 bp, 447 aa]
          Length = 447

 Score =  553 bits (1425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/437 (61%), Positives = 317/437 (72%), Gaps = 8/437 (1%)

Query: 3   KDHWXXXXXXXXXXXXXXXXXEVAWKKYVEQKDAITQQVSVKKMLK--------REYDDN 54
           KD W                 + AW  +  QK  I QQ +  K  +         +YD+ 
Sbjct: 4   KDTWKLITATALFTVAVTTITDYAWTSWQAQKQVIAQQKNKNKGGQTKSDTDKYHQYDEQ 63

Query: 55  LFREQLARNYAFLGEDGMEKLKNQYIXXXXXXXXXXXXXTMLIRSGCKKIRVIDFDQVSL 114
             R+ L  N  FLGED +EKL NQY+               L+RSGC+KIRV+DFDQVSL
Sbjct: 64  FIRQSLKNNVEFLGEDTIEKLSNQYVVVVGAGGVGSWVVNSLVRSGCRKIRVVDFDQVSL 123

Query: 115 SSLNRHSCATLEDVGASKVDCLKAHMEKIAPWCQIEAINSLWXXXXXXXXXXXXXXPTMV 174
           SSLNRHSCA L DVG  KV+CL+ HM +IAPWC+I+ IN LW              P  +
Sbjct: 124 SSLNRHSCAILNDVGTPKVECLRRHMREIAPWCEIDPINELWTLQNGERLTLGNGTPDFI 183

Query: 175 VDCIDNIDTKVDLLEFTYSNKIEVISSMGASTKSDPTRINVGDITITEEDPLARAVRRRL 234
           VDCIDNIDTKVDLLEF Y++ I+VISSMGAS KSDPT++NVGD+  TEEDPLAR VRR+L
Sbjct: 184 VDCIDNIDTKVDLLEFAYNHGIKVISSMGASAKSDPTKLNVGDLATTEEDPLARVVRRKL 243

Query: 235 KIKGITTGINVVFSAEKPDPRKAKLLPLPDDEYSKGKVGELSALKDFRVRILPVLGTMPG 294
           K +GI +GI VVFSAEKPDP+KAKLLPLPD+EY +GKV ELSALKDFRVRILPVLGTMP 
Sbjct: 244 KKRGILSGIPVVFSAEKPDPKKAKLLPLPDEEYERGKVDELSALKDFRVRILPVLGTMPS 303

Query: 295 IFGLTIATWILTKVSGYPMNPIEGKNRIKVYDGIYQSLAGQMTRIGMPDQRVPIALKEVG 354
           +FGLTI TWIL+ +S  P+ P+EGKNRIKVYDGIYQSLAGQM+R+G+P QR+P+ALK+V 
Sbjct: 304 LFGLTITTWILSNISDKPLEPVEGKNRIKVYDGIYQSLAGQMSRVGIPSQRIPLALKDVS 363

Query: 355 YIVEEVFRGKSPVSGFSTRLTLSKWDPKKPVSLQNVVVLTKEEQKEHEQRILNGKEALSD 414
           Y+VEEVF+GKSP+SG STRLTL+KWDP KP+SLQNVVVLTK EQK HE R+L GKE+L D
Sbjct: 364 YLVEEVFKGKSPISGISTRLTLTKWDPSKPISLQNVVVLTKNEQKVHEDRVLKGKESLQD 423

Query: 415 VYSQDVIDLVNQRFEEE 431
           VY   V+ LV+QRF EE
Sbjct: 424 VYDAKVLKLVSQRFREE 440

>YHR003C (YHR003C) [2288] chr8 complement(110022..111311) Member of
           the UBA-THIF-type NAD-FAD binding fold family, has high
           similarity to uncharacterized C. albicans Orf6.4746p
           [1290 bp, 429 aa]
          Length = 429

 Score =  423 bits (1088), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 215/433 (49%), Positives = 289/433 (66%), Gaps = 10/433 (2%)

Query: 1   MGKDHWXXXXXXXXXXXXXXXXXEVAWKKYVEQKDAITQQVSVKKMLKREYDDNLFREQL 60
           M  + W                 +  WK+Y +   A  +  +V +   R+YDD+LFREQL
Sbjct: 1   MANNTWKLIATTALISVFSTQLAKSVWKEY-KLSCAANKNKTVSR--PRQYDDHLFREQL 57

Query: 61  ARNYAFLGEDGMEKLKNQYIXXXXXXXXXXXXXTMLIRSGCKKIRVIDFDQVSLSSLNRH 120
           ARNYAFLGE+GM K+K QYI             TMLIRSGC+KI +ID + +S+ SLN H
Sbjct: 58  ARNYAFLGEEGMRKIKEQYIVIVGAGEVGSWVCTMLIRSGCQKIMIIDPENISIDSLNTH 117

Query: 121 SCATLEDVGASKVDCLKAHMEKIAPWCQIEAINSLWXXXXXXXXXXXX-XXPTMVVDCID 179
            CA L D+G  KV CLK H+ KIAPW +I+A    W               PT +VDC+D
Sbjct: 118 CCAVLSDIGKPKVQCLKEHLSKIAPWSEIKARAKAWTKENSHDLIFADGESPTFIVDCLD 177

Query: 180 NIDTKVDLLEFTYSNKIEVISSMGASTKSDPTRINVGDITITEEDPLARAVRRRLKIKGI 239
           N+++KVDLLE+ + NKI+VISSMG +TKSDPTR+++ DI++TE DP++R VRR+L+ +GI
Sbjct: 178 NLESKVDLLEYAHHNKIDVISSMGVATKSDPTRVSINDISMTEFDPISRCVRRKLRKRGI 237

Query: 240 TTGINVVFSAEKPDPRKAKLLPLPDDEYSKGKVGELSALKDFRVRILPVLGTMPGIFGLT 299
            TGI+VVFS E  DPR+  +L   D E+       ++A++D  +R LP LGTMPGIFGL+
Sbjct: 238 ATGISVVFSNEMLDPRRDDILSPIDCEHRA-----INAVRDEALRHLPELGTMPGIFGLS 292

Query: 300 IATWILTKVSGYPMNPIEGKNRIKVYDGIYQSLAGQMTRIGMPDQRVP-IALKEVGYIVE 358
           IATWILTKVSGYPM   E KNR+K YD I ++   QM R+    +R   + L+EVGYIVE
Sbjct: 293 IATWILTKVSGYPMKENEVKNRLKFYDSILETFQKQMARLNENKERSSLLGLEEVGYIVE 352

Query: 359 EVFRGKSPVSGFSTRLTLSKWDPKKPVSLQNVVVLTKEEQKEHEQRILNGKEALSDVYSQ 418
           E+FRGKSP+SG+ST+L L+KW+  K +SL NVV++TKEEQ+ HE+RIL   E L+ VYS+
Sbjct: 353 EMFRGKSPISGYSTKLALTKWEANKEISLTNVVLMTKEEQEIHEKRILLDGEKLTAVYSE 412

Query: 419 DVIDLVNQRFEEE 431
           +V+D + + F+EE
Sbjct: 413 EVLDFIERLFKEE 425

>YHR111W (UBA4) [2399] chr8 (333074..334396) Ubiquitin-activating
           enzyme that activates ubiquitin related protein, Urm1p
           [1323 bp, 440 aa]
          Length = 440

 Score = 32.7 bits (73), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 32/151 (21%), Positives = 58/151 (38%), Gaps = 3/151 (1%)

Query: 68  GEDGMEKLKNQYIXXXXXXXXXXXXXTMLIRSGCKKIRVIDFDQVSLSSLNRHSCATLED 127
           G  G  KLKN  +               L  +G  +I ++D D V  S+L+R        
Sbjct: 58  GVAGQVKLKNTKVLVVGAGGLGCPALPYLAGAGVGQIGIVDNDVVETSNLHRQVLHDSSR 117

Query: 128 VGASKVDCLKAHMEKIAPWCQIEAINSLWXXXXXXXXXXXXXXPTMVVDCIDNIDTKVDL 187
           VG  K +  + ++ K+ P   +    +                   ++DC D+  T+  +
Sbjct: 118 VGMLKCESARQYITKLNPHINVV---TYPVRLNSSNAFDIFKGYNYILDCTDSPLTRYLV 174

Query: 188 LEFTYSNKIEVISSMGASTKSDPTRINVGDI 218
            +   +  I V+S+ G  T+   T +N  +I
Sbjct: 175 SDVAVNLGITVVSASGLGTEGQLTILNFNNI 205

>Kwal_55.21278
          Length = 600

 Score = 32.3 bits (72), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 33/78 (42%)

Query: 67  LGEDGMEKLKNQYIXXXXXXXXXXXXXTMLIRSGCKKIRVIDFDQVSLSSLNRHSCATLE 126
           LGE+  EKL N  +               L+  G  +I ++D D + LS+LNR       
Sbjct: 9   LGEENSEKLCNSRVLLVGAGGIGCELLKDLVLMGFGEIHIVDLDTIDLSNLNRQFLFRQR 68

Query: 127 DVGASKVDCLKAHMEKIA 144
           D+  +K       +E I+
Sbjct: 69  DIKQAKATTAMRAIEHIS 86

>CAGL0I01254g 102965..104266 highly similar to sp|P38820
           Saccharomyces cerevisiae YHR111w, start by similarity
          Length = 433

 Score = 32.3 bits (72), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 39/186 (20%), Positives = 72/186 (38%), Gaps = 9/186 (4%)

Query: 39  QQVSVKKMLKREYDDNLFREQLARNYAFL------GEDGMEKLKNQYIXXXXXXXXXXXX 92
           +   +K+ LK + D+ L  E+ +R    +      G  G  +LK   +            
Sbjct: 16  ENAQLKEKLKSQDDEQLSLEEYSRYGRQMIVEGTGGVVGQLRLKKAKVLVVGAGGLGSPS 75

Query: 93  XTMLIRSGCKKIRVIDFDQVSLSSLNRHSCATLEDVGASKVDCLKAHMEKIAPWCQIEAI 152
              L+ +G   I ++D D V  S+L+R +      VG  K +  K  ++ + P   I   
Sbjct: 76  LPYLVGAGVGTIGIVDNDIVDTSNLHRQTIHNTAKVGMLKCESAKQVLKDLNPHVNI--- 132

Query: 153 NSLWXXXXXXXXXXXXXXPTMVVDCIDNIDTKVDLLEFTYSNKIEVISSMGASTKSDPTR 212
           N+                  +V+DC D   T+  + +   +    V+S+ G  T+   T 
Sbjct: 133 NTYPVRLGPENAFSIFADYDIVMDCTDTPLTRYLISDVAVNLGKTVVSASGLGTEGQLTI 192

Query: 213 INVGDI 218
           +N  +I
Sbjct: 193 LNFNNI 198

>AER248W [2750] [Homologous to ScYHR111W - SH]
           complement(1094793..1096124) [1332 bp, 443 aa]
          Length = 443

 Score = 32.0 bits (71), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 34/83 (40%)

Query: 68  GEDGMEKLKNQYIXXXXXXXXXXXXXTMLIRSGCKKIRVIDFDQVSLSSLNRHSCATLED 127
           G  G  KL++  +               L  +G   + ++D D V  S+L+R        
Sbjct: 62  GLSGQVKLRSARVLIVGAGGLGCPALQYLAGAGIGHLGIVDNDVVEESNLHRQPLHDTSK 121

Query: 128 VGASKVDCLKAHMEKIAPWCQIE 150
           VG  K D  K  + ++ P+C I+
Sbjct: 122 VGLLKCDSAKEALSRLNPYCSIK 144

>Sklu_2217.1 YOR181W, Contig c2217 1454-3418
          Length = 654

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 25/41 (60%)

Query: 378 KWDPKKPVSLQNVVVLTKEEQKEHEQRILNGKEALSDVYSQ 418
           K+  KK +S +N + LTK+ ++E EQRI+ G    S +  Q
Sbjct: 125 KYGSKKTLSNKNAIALTKKVKEEQEQRIVQGPRGESMISDQ 165

>Sklu_2344.6 YHR111W, Contig c2344 8194-9513
          Length = 439

 Score = 30.4 bits (67), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 38/192 (19%), Positives = 70/192 (36%), Gaps = 9/192 (4%)

Query: 27  WKKYVEQKDAITQQVSVKKMLKREYDDNLFREQLARNYAFLGEDGMEKLKNQYIXXXXXX 86
            K+ ++ +  I  Q+ +     R Y   +  E+        G  G  KL+N  +      
Sbjct: 23  LKQQLDHERGINSQLPMALEEYRRYGRQMIVEETN------GVQGQLKLRNANVLVVGAG 76

Query: 87  XXXXXXXTMLIRSGCKKIRVIDFDQVSLSSLNRHSCATLEDVGASKVDCLKAHMEKIAPW 146
                    L  +G   I ++D D V  S+L+R        VG  K +  K  + K+ P 
Sbjct: 77  GLGCPALPYLAGAGIGHIGIVDNDTVDTSNLHRQVLHDSTKVGMLKCESAKEVLNKLNPH 136

Query: 147 CQIEAINSLWXXXXXXXXXXXXXXPTMVVDCIDNIDTKVDLLEFTYSNKIEVISSMGAST 206
            +   + +                   V+DC D   T+  + +   +  I VIS+ G  T
Sbjct: 137 VK---VTTYPVRLSCENAFEIFENYDYVLDCTDTPLTRYLISDVAVNLGITVISASGLRT 193

Query: 207 KSDPTRINVGDI 218
           +   + +N  ++
Sbjct: 194 EGQLSILNFQNV 205

>YHR171W (ATG7) [2458] chr8 (445711..447603) Apg12p-activating
           enzyme, involved in autophagy, cytoplasm-to-vacuole
           protein targeting, and peroxisome degradation pathways
           [1893 bp, 630 aa]
          Length = 630

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%)

Query: 96  LIRSGCKKIRVIDFDQVSLSSLNRHSCATLEDVGASKVDCLKAHMEKIAP 145
           LI  G +KI  +D   VS S+  R +    ED G  K +   A +++I P
Sbjct: 343 LIAWGVRKITFVDNGTVSYSNPVRQALYNFEDCGKPKAELAAASLKRIFP 392

>CAGL0I02420g 214100..215971 similar to sp|P38862 Saccharomyces
           cerevisiae YHR171w APG7 component of the autophagic
           system, hypothetical start
          Length = 623

 Score = 29.3 bits (64), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 25/50 (50%)

Query: 96  LIRSGCKKIRVIDFDQVSLSSLNRHSCATLEDVGASKVDCLKAHMEKIAP 145
           L+  GC+ I ++D  +VS S+  R       DVG  K     A ++++ P
Sbjct: 339 LMAWGCRNITLVDNGRVSYSNPVRQPLFEFSDVGKEKAVAAAASLKRVFP 388

>Scas_576.3
          Length = 779

 Score = 29.3 bits (64), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 5/52 (9%)

Query: 206 TKSDPTRINVGDITITEEDPLARAVRRRLKIKGITTGINVVFSAEKPDPRKA 257
           T+++ T  N+ DI+IT EDP      +R + KG T     V S E  D R A
Sbjct: 108 TENNSTDENINDISITIEDPT-----KRNEAKGKTASTRNVCSREDRDRRYA 154

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.135    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,100,688
Number of extensions: 472331
Number of successful extensions: 1361
Number of sequences better than 10.0: 29
Number of HSP's gapped: 1361
Number of HSP's successfully gapped: 29
Length of query: 431
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 327
Effective length of database: 12,995,837
Effective search space: 4249638699
Effective search space used: 4249638699
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)