Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0K02475g1501487931e-110
YPR017C (DSS4)1431442705e-31
Scas_602.61461492612e-29
Kwal_14.21881371402393e-26
Sklu_1537.21311421592e-14
YMR092C (AIP1)61564670.46
Sklu_1614.258655631.6
CAGL0M14069g86626622.4
Scas_646.3*145640622.7
Sklu_2364.2411102613.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0K02475g
         (148 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0K02475g 224263..224715 similar to sp|P32601 Saccharomyces c...   310   e-110
YPR017C (DSS4) [5451] chr16 complement(593481..593912) Guanine-n...   108   5e-31
Scas_602.6                                                            105   2e-29
Kwal_14.2188                                                           97   3e-26
Sklu_1537.2 YPR017C, Contig c1537 1997-2392 reverse complement         66   2e-14
YMR092C (AIP1) [4050] chr13 complement(451631..453478) Actin int...    30   0.46 
Sklu_1614.2 YOL148C, Contig c1614 1289-3049 reverse complement         29   1.6  
CAGL0M14069g 1390029..1392629 some similarities with sp|P38894 S...    28   2.4  
Scas_646.3*                                                            28   2.7  
Sklu_2364.2 YGL004C, Contig c2364 1650-2885 reverse complement         28   3.3  

>CAGL0K02475g 224263..224715 similar to sp|P32601 Saccharomyces
           cerevisiae YPR017c exchange factor for SEC4P,
           hypothetical start
          Length = 150

 Score =  310 bits (793), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 148/148 (100%), Positives = 148/148 (100%)

Query: 1   MASTGKVRKARCQFTECASSLISVPAVDSKTTDRLIYFPGAIMEKYKIMETREGADAQKE 60
           MASTGKVRKARCQFTECASSLISVPAVDSKTTDRLIYFPGAIMEKYKIMETREGADAQKE
Sbjct: 1   MASTGKVRKARCQFTECASSLISVPAVDSKTTDRLIYFPGAIMEKYKIMETREGADAQKE 60

Query: 61  YEFLVVPEFWDFDNIGVSRDLCQVTEDRDNAEFKFEWDGHTWELIHCQRYLACAECDRGP 120
           YEFLVVPEFWDFDNIGVSRDLCQVTEDRDNAEFKFEWDGHTWELIHCQRYLACAECDRGP
Sbjct: 61  YEFLVVPEFWDFDNIGVSRDLCQVTEDRDNAEFKFEWDGHTWELIHCQRYLACAECDRGP 120

Query: 121 IGLLCEVQDANDHSSTRKICLLSIASVD 148
           IGLLCEVQDANDHSSTRKICLLSIASVD
Sbjct: 121 IGLLCEVQDANDHSSTRKICLLSIASVD 148

>YPR017C (DSS4) [5451] chr16 complement(593481..593912)
           Guanine-nucleotide exchange factor for Sec4p [432 bp,
           143 aa]
          Length = 143

 Score =  108 bits (270), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 88/144 (61%), Gaps = 10/144 (6%)

Query: 7   VRKARCQFTECASSLISVPAVDSKTTDRLIYFPGAIMEKYKIMETREGADAQ-KEYEFLV 65
           + KA C F  C S++I++        D +I  P  +  ++K++E R   DA   E  FLV
Sbjct: 1   MSKATCSFEGCHSAVITI------NDDNIINLPEQVHSEFKLLENRTMRDATPSESNFLV 54

Query: 66  VPEFWDFDNIGVSRDLCQ--VTEDRDNAEFKFEWDGHTWELIHCQRYLACAECDRGPIGL 123
           VP+ WDFDN+GVSR++    + +  D ++F FE+   +W++  C +YL CA+CD+GPIG+
Sbjct: 55  VPDVWDFDNVGVSREIPSSILGDLSDKSDFVFEYGNSSWKIKKCLKYLICADCDKGPIGI 114

Query: 124 LCEVQDANDHSSTRKICLLSIASV 147
           +C+VQD   +   R + LLS+ S+
Sbjct: 115 ICKVQDQTKNEE-RVLHLLSLRSL 137

>Scas_602.6
          Length = 146

 Score =  105 bits (261), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 86/149 (57%), Gaps = 16/149 (10%)

Query: 7   VRKARCQFTECASSLISVPAVDSKTTDRLIYFPGAIMEKYKIMETREGADAQK--EYEFL 64
           + KA C F  C  S+I++        D++I  PG I E   +M+ ++ AD ++     FL
Sbjct: 1   MSKAICAFGNCGCSIINL------NDDKIIQLPGTIFETLHLMQRKQSADIKEGSTTSFL 54

Query: 65  VVPEFWDFDNIGVSRDLCQ-VTEDRD-----NAEFKFEWDGHTWELIHCQRYLACAECDR 118
           +  + WDFDNIGVS+DL   ++E+ +     N E  F+ DG+ W +  C++YL C +CDR
Sbjct: 55  ITEDVWDFDNIGVSKDLMPGISEELNSRANTNTEVSFQHDGNLWYIKKCEKYLICGDCDR 114

Query: 119 GPIGLLCEVQDANDHSSTRKICLLSIASV 147
           GPIG++C +   +D    R+  LLS+ S+
Sbjct: 115 GPIGMVCMISQQDDQE--RRAYLLSLGSL 141

>Kwal_14.2188
          Length = 137

 Score = 96.7 bits (239), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 54/140 (38%), Positives = 81/140 (57%), Gaps = 11/140 (7%)

Query: 9   KARCQFTECASSLISVPAVDSKTTDRLIYFPGAIMEKYKIMETREGADAQKEYEFLVVPE 68
           K RC +TEC S ++S    D K   +L   P  + E  K+     G +A  E  FLV  +
Sbjct: 4   KLRCPYTECDSCIVSF---DDKRKTKL---PLEVYETTKLAIPAGGGEANGE--FLVFED 55

Query: 69  FWDFDNIGVSRDLCQ-VTEDRDNAEFKFEWDGHTWELIHCQRYLACAECDRGPIGLLCEV 127
            WDFDNIG+SR + + +   ++     F W+ H ++L    RY+ CAECD+GP+G++CEV
Sbjct: 56  IWDFDNIGMSRPIPEELISGQEEPPISFSWEQHEYKLRKLLRYIICAECDKGPLGIVCEV 115

Query: 128 QDANDHSSTRKICLLSIASV 147
           +  ND  ++  + LLS+ASV
Sbjct: 116 E--NDEGNSMNVNLLSLASV 133

>Sklu_1537.2 YPR017C, Contig c1537 1997-2392 reverse complement
          Length = 131

 Score = 65.9 bits (159), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 71/142 (50%), Gaps = 14/142 (9%)

Query: 7   VRKARCQFTECASSLISVPAVDSKTTDRLIYFPGAIMEKYKIMETREGADAQKEYEFLVV 66
           + K  C F +C   +I +      T    +Y    I+     + T+E     K   FL+V
Sbjct: 1   MSKLICPFDQCKCCIIPLEKGTQVTLPLQVYKDLNIL-----LPTKEHCPQGK---FLIV 52

Query: 67  PEFWDFDNIGVSRDLCQVTEDRDNAEFKFEWDGHT-WELIHCQRYLACAECDRGPIGLLC 125
            + WDFDNIGVSR++     D    E     +  T + +    +YL CA+CD+GP+G++C
Sbjct: 53  NDVWDFDNIGVSRNI----PDLKGFEMSVSCEEETVFTINRVIKYLICADCDKGPLGIVC 108

Query: 126 EVQDANDHSSTRKICLLSIASV 147
           E + + D   T+ I LLS+ SV
Sbjct: 109 EAR-SKDGLDTKVINLLSLESV 129

>YMR092C (AIP1) [4050] chr13 complement(451631..453478) Actin
           interacting protein, contains eight WD (WD-40) repeats
           [1848 bp, 615 aa]
          Length = 615

 Score = 30.4 bits (67), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 10/64 (15%)

Query: 56  DAQKEYEFLVVPEF---WDFDNIGVSRDLCQVTEDRDNAEFKFEWD-GHTWELI--HCQR 109
           + + E++ L  P     WDF+     R LC V E RDN      WD G++   +  H QR
Sbjct: 107 NVKSEFQVLAGPISDISWDFEG----RRLCVVGEGRDNFGVFISWDSGNSLGEVSGHSQR 162

Query: 110 YLAC 113
             AC
Sbjct: 163 INAC 166

>Sklu_1614.2 YOL148C, Contig c1614 1289-3049 reverse complement
          Length = 586

 Score = 28.9 bits (63), Expect = 1.6,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 89  DNAEFKF-EWDGHTWELIHCQRYLACAECDRGPIGLLCEVQDANDHSSTRKICLL 142
           D++ F   EWD  +  L H  R L+  +  +G +G + + ++   HSS+ +  +L
Sbjct: 330 DDSSFSIPEWDEKSQSLKHAHRPLSTRDGTKGKVGHIEQHEELPQHSSSYEQMML 384

>CAGL0M14069g 1390029..1392629 some similarities with sp|P38894
           Saccharomyces cerevisiae YHR211w FLO5, hypothetical
           start
          Length = 866

 Score = 28.5 bits (62), Expect = 2.4,   Method: Composition-based stats.
 Identities = 10/26 (38%), Positives = 15/26 (57%), Gaps = 6/26 (23%)

Query: 96  EWDGHTWELIHCQRYLACAECDRGPI 121
           +W+G+ W+      Y AC +CD  PI
Sbjct: 209 DWNGYVWQ------YDACTDCDYKPI 228

>Scas_646.3*
          Length = 1456

 Score = 28.5 bits (62), Expect = 2.7,   Method: Composition-based stats.
 Identities = 13/40 (32%), Positives = 23/40 (57%)

Query: 78  SRDLCQVTEDRDNAEFKFEWDGHTWELIHCQRYLACAECD 117
           ++ + Q+  D   AE KF++D  T EL H + +++  E D
Sbjct: 10  NKKVSQLERDEKVAELKFQYDLLTNELYHLKEFVSLFEFD 49

>Sklu_2364.2 YGL004C, Contig c2364 1650-2885 reverse complement
          Length = 411

 Score = 28.1 bits (61), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 46/102 (45%), Gaps = 12/102 (11%)

Query: 48  IMETREGADAQKEYEFLVVPEFWDFDNIGVSRDLCQVTEDRDNAEFKFEWDGHTWELIHC 107
           I E +E    ++++   V P  ++ ++  V      +T+D D+ +F+   DG+ +  I  
Sbjct: 17  IYEVQERTSEKEKFYINVEPSVYEVEDYTV-----YITKDGDSIKFEVSGDGNNFNKIGD 71

Query: 108 QRYLACAECDRGPIGLLCEVQDANDHS--STRKICLLSIASV 147
             Y+A     +    ++      ND+S  S R I  L IA V
Sbjct: 72  GLYMAQLSGKKYKFKVI-----KNDYSLQSDRNITALDIAKV 108

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.135    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,707,931
Number of extensions: 187571
Number of successful extensions: 344
Number of sequences better than 10.0: 14
Number of HSP's gapped: 338
Number of HSP's successfully gapped: 14
Length of query: 148
Length of database: 16,596,109
Length adjustment: 92
Effective length of query: 56
Effective length of database: 13,411,253
Effective search space: 751030168
Effective search space used: 751030168
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 56 (26.2 bits)