Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0K02431g92491045240.0
Scas_707.4492991435620.0
YPR019W (CDC54)93385435270.0
Kwal_14.217590991333830.0
KLLA0C17512g89285832370.0
ADL026W88885931980.0
KLLA0E23276g8265928971e-107
ADR041W8135788921e-106
CAGL0J06424g9725808951e-105
Kwal_56.232827617228781e-105
AGR276W7347068731e-104
Scas_590.67677298611e-102
CAGL0F04939g7727368601e-102
KLLA0F10087g10035998721e-102
Kwal_47.1896610445778691e-101
Scas_712.4910195848671e-101
CAGL0M05423g8125258511e-100
AFR546W10055818621e-100
YGL201C (MCM6)10175888571e-99
Kwal_27.120028336188442e-99
Scas_721.368555258453e-99
KLLA0D09262g7466968374e-99
YBR202W (CDC47)8455608201e-95
Sklu_2098.48466018121e-94
Sklu_1863.19545878163e-94
YLR274W (CDC46)7757308011e-93
Scas_710.218746527842e-90
CAGL0J04444g8796457842e-90
KLLA0E22330g9315877802e-89
AFR178W8856857763e-89
KLLA0F12584g8776437702e-88
Kwal_14.20908606897682e-88
Sklu_2087.48846457632e-87
YBL023C (MCM2)8686557605e-87
Scas_499.29855967631e-86
Kwal_27.101749455897531e-85
AFR355C9435887512e-85
CAGL0L01397g9456517417e-84
YEL032W (MCM3)9715936987e-78
YOR036W (PEP12)28853702.8
CAGL0M03707g165953713.0
Scas_605.1255285694.0
Kwal_23.5699641112678.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0K02431g
         (910 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0K02431g complement(219027..221801) highly similar to sp|P30...  1747   0.0  
Scas_707.44                                                          1376   0.0  
YPR019W (CDC54) [5453] chr16 (596745..599546) Protein involved i...  1363   0.0  
Kwal_14.2175                                                         1307   0.0  
KLLA0C17512g complement(1537707..1540385) similar to sp|P30665 S...  1251   0.0  
ADL026W [1716] [Homologous to ScYPR019W (CDC54) - SH] complement...  1236   0.0  
KLLA0E23276g complement(2065845..2068325) similar to sp|P38132 S...   350   e-107
ADR041W [1782] [Homologous to ScYBR202W (CDC47) - SH] complement...   348   e-106
CAGL0J06424g complement(611935..614853) highly similar to sp|P53...   349   e-105
Kwal_56.23282                                                         342   e-105
AGR276W [4587] [Homologous to ScYLR274W (CDC46) - SH] complement...   340   e-104
Scas_590.6                                                            336   e-102
CAGL0F04939g 503890..506208 highly similar to sp|P29496 Saccharo...   335   e-102
KLLA0F10087g complement(935618..938629) similar to sp|P53091 Sac...   340   e-102
Kwal_47.18966                                                         339   e-101
Scas_712.49                                                           338   e-101
CAGL0M05423g 577097..579535 highly similar to sp|P38132 Saccharo...   332   e-100
AFR546W [3738] [Homologous to ScYGL201C (MCM6) - SH] complement(...   336   e-100
YGL201C (MCM6) [1794] chr7 complement(117856..120909) Protein in...   334   1e-99
Kwal_27.12002                                                         329   2e-99
Scas_721.36                                                           330   3e-99
KLLA0D09262g 780273..782513 similar to sp|P29496 Saccharomyces c...   327   4e-99
YBR202W (CDC47) [385] chr2 (625729..628266) Member of MCM/P1 fam...   320   1e-95
Sklu_2098.4 YBR202W, Contig c2098 6426-8966 reverse complement        317   1e-94
Sklu_1863.1 YEL032W, Contig c1863 2885-5749                           318   3e-94
YLR274W (CDC46) [3667] chr12 (691557..693884) Member of the MCM/...   313   1e-93
Scas_710.21                                                           306   2e-90
CAGL0J04444g 417656..420295 highly similar to sp|P29469 Saccharo...   306   2e-90
KLLA0E22330g 1981275..1984070 similar to sp|P24279 Saccharomyces...   305   2e-89
AFR178W [3370] [Homologous to ScYBL023C (MCM2) - SH] complement(...   303   3e-89
KLLA0F12584g complement(1165710..1168343) similar to sp|P29469 S...   301   2e-88
Kwal_14.2090                                                          300   2e-88
Sklu_2087.4 YBL023C, Contig c2087 7202-9856                           298   2e-87
YBL023C (MCM2) [172] chr2 complement(174885..177491) Member of t...   297   5e-87
Scas_499.2                                                            298   1e-86
Kwal_27.10174                                                         294   1e-85
AFR355C [3547] [Homologous to ScYEL032W (MCM3) - SH] (1082128..1...   293   2e-85
CAGL0L01397g 152718..155555 highly similar to sp|P24279 Saccharo...   290   7e-84
YEL032W (MCM3) [1393] chr5 (86937..89852) Member of the MCM/P1 f...   273   7e-78
YOR036W (PEP12) [4848] chr15 (400347..401213) Syntaxin homolog (...    32   2.8  
CAGL0M03707g 415143..420122 similar to sp|P48563 Saccharomyces c...    32   3.0  
Scas_605.12                                                            31   4.0  
Kwal_23.5699                                                           30   8.3  

>CAGL0K02431g complement(219027..221801) highly similar to sp|P30665
           Saccharomyces cerevisiae YPR019w Cell division control
           protein, start by similarity
          Length = 924

 Score = 1747 bits (4524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 860/910 (94%), Positives = 860/910 (94%)

Query: 1   MSNNPSSPVMGPIDEGSSSPGRNQPSSMGPNGDXXXXXXXXXXXXXXXXXXXXXVAPSSP 60
           MSNNPSSPVMGPIDEGSSSPGRNQPSSMGPNGD                     VAPSSP
Sbjct: 1   MSNNPSSPVMGPIDEGSSSPGRNQPSSMGPNGDPSSPALFFNSSSSQPQGDSQPVAPSSP 60

Query: 61  IHFPSSSNRPMSSDVHSQGRRSNRNHLAANRSSALGRFSDYGSDRQVLHSSSSNMGGYPS 120
           IHFPSSSNRPMSSDVHSQGRRSNRNHLAANRSSALGRFSDYGSDRQVLHSSSSNMGGYPS
Sbjct: 61  IHFPSSSNRPMSSDVHSQGRRSNRNHLAANRSSALGRFSDYGSDRQVLHSSSSNMGGYPS 120

Query: 121 QRTNLRRNDIHASDLSSPRRIVDFDXXXXXXXXXXXXXXXXXEATEPLRIIWGTNVSIQE 180
           QRTNLRRNDIHASDLSSPRRIVDFD                 EATEPLRIIWGTNVSIQE
Sbjct: 121 QRTNLRRNDIHASDLSSPRRIVDFDSRSGIQQPSSSSSSMPSEATEPLRIIWGTNVSIQE 180

Query: 181 CANSFRNFLMSFKYKYRRVLDGKTDITDDEAEEELYYVKQLNEMRELGTSNLNLDARNLL 240
           CANSFRNFLMSFKYKYRRVLDGKTDITDDEAEEELYYVKQLNEMRELGTSNLNLDARNLL
Sbjct: 181 CANSFRNFLMSFKYKYRRVLDGKTDITDDEAEEELYYVKQLNEMRELGTSNLNLDARNLL 240

Query: 241 AFKQTEELYYQLLNYPQEVISIMDQTIKDCMVSLVVDNQLEHELDEIESKFYKVRPYNVE 300
           AFKQTEELYYQLLNYPQEVISIMDQTIKDCMVSLVVDNQLEHELDEIESKFYKVRPYNVE
Sbjct: 241 AFKQTEELYYQLLNYPQEVISIMDQTIKDCMVSLVVDNQLEHELDEIESKFYKVRPYNVE 300

Query: 301 TQKGMRELNPNDIDKLISLKGLVLRATPVIPDMKVAFFKCNICDHTMAVEIDRGVIQEPA 360
           TQKGMRELNPNDIDKLISLKGLVLRATPVIPDMKVAFFKCNICDHTMAVEIDRGVIQEPA
Sbjct: 301 TQKGMRELNPNDIDKLISLKGLVLRATPVIPDMKVAFFKCNICDHTMAVEIDRGVIQEPA 360

Query: 361 RCERVDCNEANSMTLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRA 420
           RCERVDCNEANSMTLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRA
Sbjct: 361 RCERVDCNEANSMTLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRA 420

Query: 421 GDRIEVTGTFRSIPIKANSRQRVLKSLYKTYIDVVHVKKVSNTRIGVDVSTIEQELLQNK 480
           GDRIEVTGTFRSIPIKANSRQRVLKSLYKTYIDVVHVKKVSNTRIGVDVSTIEQELLQNK
Sbjct: 421 GDRIEVTGTFRSIPIKANSRQRVLKSLYKTYIDVVHVKKVSNTRIGVDVSTIEQELLQNK 480

Query: 481 LDNNDVEEVRQISDAEIEKIKQVAQRPDLYDLLARSIAPSIYELDDVKKGILLQLXXXXX 540
           LDNNDVEEVRQISDAEIEKIKQVAQRPDLYDLLARSIAPSIYELDDVKKGILLQL     
Sbjct: 481 LDNNDVEEVRQISDAEIEKIKQVAQRPDLYDLLARSIAPSIYELDDVKKGILLQLFGGTN 540

Query: 541 XXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDV 600
                  RYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDV
Sbjct: 541 KTFKKGGRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDV 600

Query: 601 DSKQLVLESGALVLSDGGICCIDEFDKMSESTRSVLHEVMEQQTISVAKAGIITTLNARS 660
           DSKQLVLESGALVLSDGGICCIDEFDKMSESTRSVLHEVMEQQTISVAKAGIITTLNARS
Sbjct: 601 DSKQLVLESGALVLSDGGICCIDEFDKMSESTRSVLHEVMEQQTISVAKAGIITTLNARS 660

Query: 661 SILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYIILDKVDESTDRDLAKHLTSLYL 720
           SILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYIILDKVDESTDRDLAKHLTSLYL
Sbjct: 661 SILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYIILDKVDESTDRDLAKHLTSLYL 720

Query: 721 EDKPAHVTTDDVLPIDFLTQYINYVKQNVHPLVTEQAKNELVKAYVGMRKMGDDSRSDEK 780
           EDKPAHVTTDDVLPIDFLTQYINYVKQNVHPLVTEQAKNELVKAYVGMRKMGDDSRSDEK
Sbjct: 721 EDKPAHVTTDDVLPIDFLTQYINYVKQNVHPLVTEQAKNELVKAYVGMRKMGDDSRSDEK 780

Query: 781 RITATTRQLESMIRLSEAHAKMRLSSTVDLEDVREAVRLMKSAIKDYATDPKTGKIDMNL 840
           RITATTRQLESMIRLSEAHAKMRLSSTVDLEDVREAVRLMKSAIKDYATDPKTGKIDMNL
Sbjct: 781 RITATTRQLESMIRLSEAHAKMRLSSTVDLEDVREAVRLMKSAIKDYATDPKTGKIDMNL 840

Query: 841 VQTGKSVIQRKLQEDLAREIIRILKEYPADSMSFNELIKQINEQAQDRVEPSQVSSTLSR 900
           VQTGKSVIQRKLQEDLAREIIRILKEYPADSMSFNELIKQINEQAQDRVEPSQVSSTLSR
Sbjct: 841 VQTGKSVIQRKLQEDLAREIIRILKEYPADSMSFNELIKQINEQAQDRVEPSQVSSTLSR 900

Query: 901 LQQEDKVIIL 910
           LQQEDKVIIL
Sbjct: 901 LQQEDKVIIL 910

>Scas_707.44
          Length = 929

 Score = 1376 bits (3562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 690/914 (75%), Positives = 765/914 (83%), Gaps = 13/914 (1%)

Query: 5   PSSPVMGPIDEGSSSPGRN------QPSS--MGPNGDXXXXXXXXXXXXXXXXXXXXXVA 56
           PSSPV G  +E SSSP         QPSS  +  N                         
Sbjct: 7   PSSPVTGARNE-SSSPAPTAGSIPAQPSSPALFYNSSSSQSDIFGRHGSQAGTARNNAAF 65

Query: 57  PSSPIHFPSSSNRPMSSDVHSQGRRSNRNHLAANRSSALGRFSDYGSDRQVLHSSSSNMG 116
            SSP+++PSSS    SSD+ +  RR+ R   ++  +    RFSD  SDR +  SSSS   
Sbjct: 66  GSSPMNYPSSSQN-QSSDLLNPQRRTRRPGGSSTNTPGTTRFSDIRSDRNIPSSSSSFGS 124

Query: 117 GYPSQRTNLRRNDIHASDLSSPRRIVDFDXXXXXXXXXXXXXXXXXEATEPLRIIWGTNV 176
              + R  +RRNDIHASDLSSPRRIVDFD                 +A EPLRIIWGTNV
Sbjct: 125 SRNNIR--MRRNDIHASDLSSPRRIVDFDSHSGVHTSSSSAVPTS-DANEPLRIIWGTNV 181

Query: 177 SIQECANSFRNFLMSFKYKYRRVLDGKTDITDDEAEEELYYVKQLNEMRELGTSNLNLDA 236
           SIQECA  FRNFLMSFKYK+R+ LD +    +   +EELYYV+QLNEMRE+G  NLNLDA
Sbjct: 182 SIQECATKFRNFLMSFKYKFRKTLDEREQFINSTTDEELYYVQQLNEMREVGNCNLNLDA 241

Query: 237 RNLLAFKQTEELYYQLLNYPQEVISIMDQTIKDCMVSLVVDNQLEHELDEIESKFYKVRP 296
           RNLLAFKQTEELYYQLLNYPQEVISIMDQTIKDCMVSLVVDN L+  LD+IE+KFYKVRP
Sbjct: 242 RNLLAFKQTEELYYQLLNYPQEVISIMDQTIKDCMVSLVVDNHLDFNLDDIETKFYKVRP 301

Query: 297 YNVETQKGMRELNPNDIDKLISLKGLVLRATPVIPDMKVAFFKCNICDHTMAVEIDRGVI 356
           YNV T KGMRELNPNDIDKLISLKGLVLRATPVIPDMKVAFFKCN+CDHTM VEIDRGVI
Sbjct: 302 YNVGTVKGMRELNPNDIDKLISLKGLVLRATPVIPDMKVAFFKCNVCDHTMVVEIDRGVI 361

Query: 357 QEPARCERVDCNEANSMTLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLCVYDELVD 416
           QEPARCERVDC E NSM+LIHNRCSFADKQVIKLQETPDLVPDGQTPH+VSLCVYDELVD
Sbjct: 362 QEPARCERVDCGEQNSMSLIHNRCSFADKQVIKLQETPDLVPDGQTPHAVSLCVYDELVD 421

Query: 417 SCRAGDRIEVTGTFRSIPIKANSRQRVLKSLYKTYIDVVHVKKVSNTRIGVDVSTIEQEL 476
           SCRAGDRIEVTGTFRSIPI+ANSRQR+LKSLYKTYIDVVH+KKVS+TR+GVD STIEQEL
Sbjct: 422 SCRAGDRIEVTGTFRSIPIRANSRQRILKSLYKTYIDVVHIKKVSDTRLGVDTSTIEQEL 481

Query: 477 LQNKLDNNDVEEVRQISDAEIEKIKQVAQRPDLYDLLARSIAPSIYELDDVKKGILLQLX 536
           +QNKLD+N+VEEV++I+D +I KI+ VA R DLYD+L+RSIAPSI+ELDDVKKGILLQL 
Sbjct: 482 MQNKLDHNEVEEVKKITDQDIAKIRDVANREDLYDVLSRSIAPSIFELDDVKKGILLQLF 541

Query: 537 XXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYV 596
                      RYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAY+
Sbjct: 542 GGANKVFKKGGRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYI 601

Query: 597 TRDVDSKQLVLESGALVLSDGGICCIDEFDKMSESTRSVLHEVMEQQTISVAKAGIITTL 656
           TRDVD+KQLVLESGALVLSDGGICCIDEFDKMS+STRSVLHEVMEQQTIS+AKAGIITTL
Sbjct: 602 TRDVDTKQLVLESGALVLSDGGICCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTL 661

Query: 657 NARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYIILDKVDESTDRDLAKHLT 716
           NARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVY++LDKVDESTDR+LAKHLT
Sbjct: 662 NARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDESTDRELAKHLT 721

Query: 717 SLYLEDKPAHVTTDDVLPIDFLTQYINYVKQNVHPLVTEQAKNELVKAYVGMRKMGDDSR 776
           SLYL+DKP HV+  D+LP++FLT YINY K+++HP++ E+AK ELV+AYVGMRK+GDDSR
Sbjct: 722 SLYLQDKPEHVSNADILPVEFLTMYINYAKEHIHPVILEEAKIELVRAYVGMRKLGDDSR 781

Query: 777 SDEKRITATTRQLESMIRLSEAHAKMRLSSTVDLEDVREAVRLMKSAIKDYATDPKTGKI 836
           SDEKRITATTRQLESMIRL+EAHAKMRLS+ V LEDV+EAVRLMKSAIKDYATDPKTGKI
Sbjct: 782 SDEKRITATTRQLESMIRLAEAHAKMRLSNEVQLEDVQEAVRLMKSAIKDYATDPKTGKI 841

Query: 837 DMNLVQTGKSVIQRKLQEDLAREIIRILKEYPADSMSFNELIKQINEQAQDRVEPSQVSS 896
           DMNLVQTGKSVIQRKLQEDL RE++R+L  + +DSMSFNELIKQINE +QDRVE S +S 
Sbjct: 842 DMNLVQTGKSVIQRKLQEDLTREVLRVLTNHTSDSMSFNELIKQINEHSQDRVESSDISD 901

Query: 897 TLSRLQQEDKVIIL 910
            LSRLQQEDKVI+L
Sbjct: 902 VLSRLQQEDKVIVL 915

>YPR019W (CDC54) [5453] chr16 (596745..599546) Protein involved in
           DNA synthesis initiation, member of the MCM family of
           DNA-dependent ATPases required for initiation of DNA
           replication [2802 bp, 933 aa]
          Length = 933

 Score = 1363 bits (3527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 667/854 (78%), Positives = 752/854 (88%), Gaps = 3/854 (0%)

Query: 58  SSPIHFPSSSNRPMSSDVHSQGRRSNRNHLAANRSSALGRFSDYGSDRQVLHSSSSNMGG 117
           SSP++FPSSS R  S    SQGR+  R   +A+ S      SD  SDR  L +SSS++G 
Sbjct: 68  SSPLNFPSSSQRQNSDVFQSQGRQG-RIRSSASASGRSRYHSDLRSDR-ALPTSSSSLGR 125

Query: 118 YPSQRTNLRRNDIHASDLSSPRRIVDFDXXXXXXXX-XXXXXXXXXEATEPLRIIWGTNV 176
               R ++RRNDIH SDLSSPRRIVDFD                  EA+EPLRIIWGTNV
Sbjct: 126 NGQNRVHMRRNDIHTSDLSSPRRIVDFDTRSGVNTLDTSSSSAPPSEASEPLRIIWGTNV 185

Query: 177 SIQECANSFRNFLMSFKYKYRRVLDGKTDITDDEAEEELYYVKQLNEMRELGTSNLNLDA 236
           SIQEC  +FRNFLMSFKYK+R++LD + +  ++  +EELYY+KQLNEMRELGTSNLNLDA
Sbjct: 186 SIQECTTNFRNFLMSFKYKFRKILDEREEFINNTTDEELYYIKQLNEMRELGTSNLNLDA 245

Query: 237 RNLLAFKQTEELYYQLLNYPQEVISIMDQTIKDCMVSLVVDNQLEHELDEIESKFYKVRP 296
           RNLLA+KQTE+LY+QLLNYPQEVISIMDQTIKDCMVSL+VDN L+++LDEIE+KFYKVRP
Sbjct: 246 RNLLAYKQTEDLYHQLLNYPQEVISIMDQTIKDCMVSLIVDNNLDYDLDEIETKFYKVRP 305

Query: 297 YNVETQKGMRELNPNDIDKLISLKGLVLRATPVIPDMKVAFFKCNICDHTMAVEIDRGVI 356
           YNV + KGMRELNPNDIDKLI+LKGLVLR+TPVIPDMKVAFFKCN+CDHTMAVEIDRGVI
Sbjct: 306 YNVGSCKGMRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAVEIDRGVI 365

Query: 357 QEPARCERVDCNEANSMTLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLCVYDELVD 416
           QEPARCER+DCNE NSM+LIHNRCSFADKQVIKLQETPD VPDGQTPHS+SLCVYDELVD
Sbjct: 366 QEPARCERIDCNEPNSMSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLCVYDELVD 425

Query: 417 SCRAGDRIEVTGTFRSIPIKANSRQRVLKSLYKTYIDVVHVKKVSNTRIGVDVSTIEQEL 476
           SCRAGDRIEVTGTFRSIPI+ANSRQRVLKSLYKTY+DVVHVKKVS+ R+ VD STIEQEL
Sbjct: 426 SCRAGDRIEVTGTFRSIPIRANSRQRVLKSLYKTYVDVVHVKKVSDKRLDVDTSTIEQEL 485

Query: 477 LQNKLDNNDVEEVRQISDAEIEKIKQVAQRPDLYDLLARSIAPSIYELDDVKKGILLQLX 536
           +QNK+D+N+VEEVRQI+D ++ KI++VA R DLY LLARSIAPSIYEL+DVKKGILLQL 
Sbjct: 486 MQNKVDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQLF 545

Query: 537 XXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYV 596
                      RYRGDINILLCGDPSTSKSQILQYVHKI PRGVYTSGKGSSAVGLTAY+
Sbjct: 546 GGTNKTFTKGGRYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYI 605

Query: 597 TRDVDSKQLVLESGALVLSDGGICCIDEFDKMSESTRSVLHEVMEQQTISVAKAGIITTL 656
           TRDVD+KQLVLESGALVLSDGG+CCIDEFDKMS+STRSVLHEVMEQQTIS+AKAGIITTL
Sbjct: 606 TRDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTL 665

Query: 657 NARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYIILDKVDESTDRDLAKHLT 716
           NARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVY++LDKVDE  DR+LAKHLT
Sbjct: 666 NARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLT 725

Query: 717 SLYLEDKPAHVTTDDVLPIDFLTQYINYVKQNVHPLVTEQAKNELVKAYVGMRKMGDDSR 776
           +LYLEDKP H++ DDVLP++FLT YI+Y K+++HP++TE AK ELV+AYVGMRKMGDDSR
Sbjct: 726 NLYLEDKPEHISQDDVLPVEFLTMYISYAKEHIHPIITEAAKTELVRAYVGMRKMGDDSR 785

Query: 777 SDEKRITATTRQLESMIRLSEAHAKMRLSSTVDLEDVREAVRLMKSAIKDYATDPKTGKI 836
           SDEKRITATTRQLESMIRL+EAHAKM+L + V+LEDV+EAVRL++SAIKDYATDPKTGKI
Sbjct: 786 SDEKRITATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAIKDYATDPKTGKI 845

Query: 837 DMNLVQTGKSVIQRKLQEDLAREIIRILKEYPADSMSFNELIKQINEQAQDRVEPSQVSS 896
           DMNLVQTGKSVIQRKLQEDL+REI+ +LK+  +DSMSFNELIKQINE +QDRVE S +  
Sbjct: 846 DMNLVQTGKSVIQRKLQEDLSREIMNVLKDQASDSMSFNELIKQINEHSQDRVESSDIQE 905

Query: 897 TLSRLQQEDKVIIL 910
            LSRLQQEDKVI+L
Sbjct: 906 ALSRLQQEDKVIVL 919

>Kwal_14.2175
          Length = 909

 Score = 1307 bits (3383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 651/913 (71%), Positives = 749/913 (82%), Gaps = 21/913 (2%)

Query: 1   MSNNPSSPVMGPIDEGSSSPGRNQPSSMGPNGDXXXXXXXXXXX-XXXXXXXXXXVAPSS 59
           MS N SSPV     EG+SSP    PSS G +                           SS
Sbjct: 1   MSENRSSPV----HEGASSPMAAPPSSFGGSSPPLFYNPSSSSQPDTYESQQRQRTVGSS 56

Query: 60  PIHFPSSS-NRP-MSSDVHSQGRRSNRNHLAANRSSALGRFSDYGSDRQVLHSSSSNMGG 117
           P  +PSSS + P ++SD  +   R+ R       SS  GRF+D+ SD  +L SS S  G 
Sbjct: 57  PFRYPSSSQDHPHVTSDTFASQSRTQR-------SSGPGRFTDFSSDGGILSSSLSGRG- 108

Query: 118 YPSQRTNLRRNDIHASDLSSPRRIVDFDXXXXXXXXXXXXXXXXXEATEPLRIIWGTNVS 177
             SQ    RR+D+HASDLSSPRR+VD D                 EATEPLRIIWGTNVS
Sbjct: 109 --SQHAAQRRSDLHASDLSSPRRMVDLDSQPPPNSSSDPVS----EATEPLRIIWGTNVS 162

Query: 178 IQECANSFRNFLMSFKYKYRRVLDGKTDITDDEAEEELYYVKQLNEMRELGTSNLNLDAR 237
           IQECA +FRNFLMSFKYK+R+ LDG  D  ++  +EELYYVK+LN+MRE+G+ NLNLDAR
Sbjct: 163 IQECATNFRNFLMSFKYKFRKTLDGNEDFLNETDDEELYYVKRLNQMREMGSLNLNLDAR 222

Query: 238 NLLAFKQTEELYYQLLNYPQEVISIMDQTIKDCMVSLVVDNQLEHELDEIESKFYKVRPY 297
           NLL+FK TE+LYYQL++YPQE+ISIMDQT+KDCMVSLVVDN LE  LDEIESKFYK+RPY
Sbjct: 223 NLLSFKATEKLYYQLMSYPQEIISIMDQTVKDCMVSLVVDNNLESGLDEIESKFYKIRPY 282

Query: 298 NVETQKGMRELNPNDIDKLISLKGLVLRATPVIPDMKVAFFKCNICDHTMAVEIDRGVIQ 357
           N+ETQKGMRELNPNDIDKLIS+KGLVLR+TP+IPDMKVAFFKCNICDHT  VEIDRGVIQ
Sbjct: 283 NIETQKGMRELNPNDIDKLISVKGLVLRSTPIIPDMKVAFFKCNICDHTAVVEIDRGVIQ 342

Query: 358 EPARCERVDCNEANSMTLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLCVYDELVDS 417
           EPARC RV CN+ NSMTL+HNRCSFADKQVIKLQETPD VPDGQTPHSVSLCVYDELVDS
Sbjct: 343 EPARCPRVACNQQNSMTLVHNRCSFADKQVIKLQETPDTVPDGQTPHSVSLCVYDELVDS 402

Query: 418 CRAGDRIEVTGTFRSIPIKANSRQRVLKSLYKTYIDVVHVKKVSNTRIGVDVSTIEQELL 477
           CRAGDRIE+TG FRSIPI+A++ QR LKSLYKTY+DVVHVKKV+N R+G D ST+EQELL
Sbjct: 403 CRAGDRIEITGIFRSIPIRASTTQRALKSLYKTYLDVVHVKKVTNDRLGADTSTVEQELL 462

Query: 478 QNKLDNNDVEEVRQISDAEIEKIKQVAQRPDLYDLLARSIAPSIYELDDVKKGILLQLXX 537
           QN+++++DV+E+ QI+D +I K+  +A R D+Y++LARS+APSI+ELDD+KKGILLQL  
Sbjct: 463 QNEMNHSDVQEIPQITDEQIRKLHAIAARDDVYEVLARSVAPSIFELDDIKKGILLQLFG 522

Query: 538 XXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVT 597
                     RYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAY+T
Sbjct: 523 GTNKTFTKGGRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYIT 582

Query: 598 RDVDSKQLVLESGALVLSDGGICCIDEFDKMSESTRSVLHEVMEQQTISVAKAGIITTLN 657
           RD+D+KQLVLESGALVLSDGG+CCIDEFDKMS+STRSVLHEVMEQQTIS+AKAGIITTLN
Sbjct: 583 RDIDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLN 642

Query: 658 ARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYIILDKVDESTDRDLAKHLTS 717
           AR+SILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVY++LDKVDE+TDR+LAKHLT+
Sbjct: 643 ARTSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDENTDRELAKHLTN 702

Query: 718 LYLEDKPAHVTTDDVLPIDFLTQYINYVKQNVHPLVTEQAKNELVKAYVGMRKMGDDSRS 777
           LYLED P + T  DVLP++ LT YINY KQ   P++ EQAK ELV+AYV MRKMGDDSRS
Sbjct: 703 LYLEDAPTNETDGDVLPVELLTLYINYAKQQYAPVIIEQAKTELVRAYVTMRKMGDDSRS 762

Query: 778 DEKRITATTRQLESMIRLSEAHAKMRLSSTVDLEDVREAVRLMKSAIKDYATDPKTGKID 837
           DEKRITATTRQLESMIRL+EAHAKMRLS TV+L+DV+EAVRL+KSAIKDYATDPKTGKID
Sbjct: 763 DEKRITATTRQLESMIRLAEAHAKMRLSQTVELQDVQEAVRLIKSAIKDYATDPKTGKID 822

Query: 838 MNLVQTGKSVIQRKLQEDLAREIIRILKEYPADSMSFNELIKQINEQAQDRVEPSQVSST 897
           MNLVQTGKSVIQRKLQEDLARE++ IL      ++S+NEL++ INEQ+QD+VE + +S  
Sbjct: 823 MNLVQTGKSVIQRKLQEDLAREVVSILGARSNLTISYNELLRSINEQSQDKVEAADISEA 882

Query: 898 LSRLQQEDKVIIL 910
           L RLQQEDKV++L
Sbjct: 883 LVRLQQEDKVVVL 895

>KLLA0C17512g complement(1537707..1540385) similar to sp|P30665
           Saccharomyces cerevisiae YPR019w CDC54 member of the
           CDC46P/MCM2P/MCM3P family, start by similarity
          Length = 892

 Score = 1251 bits (3237), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 615/858 (71%), Positives = 712/858 (82%), Gaps = 24/858 (2%)

Query: 58  SSPIHFPSSSNRPMSSDVH----SQGRRSNRNHLAANRSSALGRFSDYGSDRQVLHSSSS 113
           SSP H+PSSS+            S G RSN         S+    S   S R+  HS S 
Sbjct: 40  SSPFHYPSSSSNATQETARAAPSSSGLRSNNLRSDLLNYSS----SLSSSAREGRHSRS- 94

Query: 114 NMGGYPSQRTNLRRNDIHASDLSSPRRIVDFDXXXXXXXXXXXXXXXXXEAT-EPLRIIW 172
                       RR +I+ASDLSSPRRIV F+                 EA  +PL+IIW
Sbjct: 95  ------------RRGEINASDLSSPRRIVTFNNLSSSDNGFSSSSRPASEAADQPLKIIW 142

Query: 173 GTNVSIQECANSFRNFLMSFKYKYRRVLDGKTDITDDEAEEELYYVKQLNEMRELGTSNL 232
           GTNVSIQEC NSFR FLMSFK KYR+ LD +    ++  ++ELYYV QLN+MR+LGTSNL
Sbjct: 143 GTNVSIQECGNSFREFLMSFKLKYRKELDDQEIFINETTDQELYYVNQLNQMRQLGTSNL 202

Query: 233 NLDARNLLAFKQTEELYYQLLNYPQEVISIMDQTIKDCMVSLVVDNQLEHELDEIESKFY 292
           NLD RNLLA+K TE+L++Q+L YPQE+I+IMDQT+KDCMVSL +DN LE  L+EIESK +
Sbjct: 203 NLDIRNLLAYKHTEKLFHQILYYPQEIIAIMDQTVKDCMVSLALDNGLESYLNEIESKLF 262

Query: 293 KVRPYNVETQKGMRELNPNDIDKLISLKGLVLRATPVIPDMKVAFFKCNICDHTMAVEID 352
           KVRPYNVET+KGMRELNPNDIDKL+S+KGLVLR+TP+IPDM VAFFKCN+C+HT+ VEID
Sbjct: 263 KVRPYNVETKKGMRELNPNDIDKLVSIKGLVLRSTPIIPDMSVAFFKCNVCNHTVEVEID 322

Query: 353 RGVIQEPARCERVDCNEANSMTLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLCVYD 412
           RG+IQEP RC RV CN  NSM L+HNRC+F D+QVIKLQETPDLVPDGQTPHSVSLCVYD
Sbjct: 323 RGIIQEPVRCPRVVCNSPNSMVLVHNRCTFQDRQVIKLQETPDLVPDGQTPHSVSLCVYD 382

Query: 413 ELVDSCRAGDRIEVTGTFRSIPIKANSRQRVLKSLYKTYIDVVHVKKVSNTRIGVDVSTI 472
           ELVDSCRAGDRIEV+G FRSIPI++N +QR LKSLYKTYIDVVH++KV+  R+GVD ST+
Sbjct: 383 ELVDSCRAGDRIEVSGIFRSIPIRSNPKQRALKSLYKTYIDVVHIQKVAKDRVGVDTSTV 442

Query: 473 EQELLQNKLDNNDVEEVRQISDAEIEKIKQVAQRPDLYDLLARSIAPSIYELDDVKKGIL 532
           EQ+LLQN++DN  VEE+R +S  +I +IK+ A+R D+YD+L+RSIAPSIYELDDVKKGIL
Sbjct: 443 EQQLLQNQIDN--VEEIRTLSSEDIRRIKETARRSDVYDVLSRSIAPSIYELDDVKKGIL 500

Query: 533 LQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGL 592
           LQL            RYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGL
Sbjct: 501 LQLFGGANKTFKKGGRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGL 560

Query: 593 TAYVTRDVDSKQLVLESGALVLSDGGICCIDEFDKMSESTRSVLHEVMEQQTISVAKAGI 652
           TAYVTRDVD+KQLVLESGALVLSDGG+CCIDEFDKM+++TRSVLHEVMEQQTIS+AKAGI
Sbjct: 561 TAYVTRDVDTKQLVLESGALVLSDGGVCCIDEFDKMNDNTRSVLHEVMEQQTISIAKAGI 620

Query: 653 ITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYIILDKVDESTDRDLA 712
           ITTLNAR+SILASANPI SRYNPNLPVTENIDLPPPLLSRFDLVY++LDKV+E++DR+LA
Sbjct: 621 ITTLNARTSILASANPINSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVNEASDRELA 680

Query: 713 KHLTSLYLEDKPAHVTTDDVLPIDFLTQYINYVKQNVHPLVTEQAKNELVKAYVGMRKMG 772
           KHLTSLYLED+P  V+  D+LP++FLT YINY KQN+HP++TE AK ELV+AYVGMRKMG
Sbjct: 681 KHLTSLYLEDRPDSVSQGDILPVEFLTAYINYAKQNIHPVITESAKTELVRAYVGMRKMG 740

Query: 773 DDSRSDEKRITATTRQLESMIRLSEAHAKMRLSSTVDLEDVREAVRLMKSAIKDYATDPK 832
           DDSRSDEKRITATTRQLESMIRLSEAHAKMRLS  V+LEDV EAVRL+KSAIKDYATDPK
Sbjct: 741 DDSRSDEKRITATTRQLESMIRLSEAHAKMRLSERVELEDVEEAVRLIKSAIKDYATDPK 800

Query: 833 TGKIDMNLVQTGKSVIQRKLQEDLAREIIRILKEYPADSMSFNELIKQINEQAQDRVEPS 892
           TGKIDMNLVQTGKSV+QRKL EDLAREI++IL E   D++SFNEL K INEQ+QD+VE  
Sbjct: 801 TGKIDMNLVQTGKSVVQRKLLEDLAREILKILTERTTDTISFNELSKLINEQSQDKVESI 860

Query: 893 QVSSTLSRLQQEDKVIIL 910
           ++S+ L+RLQQEDKV+IL
Sbjct: 861 ELSNALTRLQQEDKVVIL 878

>ADL026W [1716] [Homologous to ScYPR019W (CDC54) - SH]
           complement(653657..656323) [2667 bp, 888 aa]
          Length = 888

 Score = 1236 bits (3198), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 604/859 (70%), Positives = 708/859 (82%), Gaps = 32/859 (3%)

Query: 58  SSPIHFPSSSNRPMSSDVHSQGRRSNRNHLAANRSSALGRFSDYGSDRQVLHSSSSNMGG 117
           SSP H+PSSS          Q  RSNR           G FS  G  R     + S++ G
Sbjct: 42  SSPFHYPSSSQ-------SQQNTRSNRG----------GAFSSQGVPRSERSYAGSSLPG 84

Query: 118 YPSQRTNLR---RNDIHASDLSSPRRIVDFDXXXXXXXXXXXXXXXXXEATEPLRIIWGT 174
             + RT L+   R+DIHASDLSSPRR+V+F+                 E  EP+RIIWGT
Sbjct: 85  --TARTRLQHYGRSDIHASDLSSPRRMVNFNSPSTLSSSDPPS-----ENDEPMRIIWGT 137

Query: 175 NVSIQECANSFRNFLMSFKYKYRRVLDGKTDITDDEAEEELYYVKQLNEMRELGTSNLNL 234
           NVSIQE A +F+NFLM+FKYKYR++ D +    ++  +EELYYV QL++MR+LGT NLNL
Sbjct: 138 NVSIQEVACTFKNFLMTFKYKYRKIKDEQELFINETTDEELYYVNQLHQMRQLGTCNLNL 197

Query: 235 DARNLLAFKQTEELYYQLLNYPQEVISIMDQTIKDCMVSLVVD---NQLEHELDEIESKF 291
           D RNL++F  TE+LY+QLLNYPQEVISIMDQ +KDCMV L VD    +    L E+ESK 
Sbjct: 198 DVRNLISFPGTEKLYHQLLNYPQEVISIMDQAVKDCMVQLAVDIDGAEGNENLIEVESKI 257

Query: 292 YKVRPYNVETQKGMRELNPNDIDKLISLKGLVLRATPVIPDMKVAFFKCNICDHTMAVEI 351
           YK+RPYN+++++GMRELNPNDIDKL+S+KGLVLR+TPVIPDMK+AFFKC++CDHT AVEI
Sbjct: 258 YKIRPYNLDSERGMRELNPNDIDKLVSIKGLVLRSTPVIPDMKLAFFKCSVCDHTTAVEI 317

Query: 352 DRGVIQEPARCERVDCNEANSMTLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLCVY 411
           DRG+IQEP RC RV CN+ NSM+LIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLC+Y
Sbjct: 318 DRGIIQEPLRCPRVACNQRNSMSLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLCIY 377

Query: 412 DELVDSCRAGDRIEVTGTFRSIPIKANSRQRVLKSLYKTYIDVVHVKKVSNTRIGVDVST 471
           DELVDSCRAGDRIEVTG FRSIPI+AN RQR LKSLYKTY+DVVHV+KVS  R+ +D ST
Sbjct: 378 DELVDSCRAGDRIEVTGIFRSIPIRANQRQRALKSLYKTYLDVVHVRKVSARRLDIDTST 437

Query: 472 IEQELLQNKLDNNDVEEVRQISDAEIEKIKQVAQRPDLYDLLARSIAPSIYELDDVKKGI 531
           +EQ++LQN++DN  VEE+R+++D +I KI  VA RPD+Y++LARSIAPSIYELDD+KKGI
Sbjct: 438 VEQQILQNQMDN--VEELRKVTDEDIAKINAVAARPDVYEVLARSIAPSIYELDDIKKGI 495

Query: 532 LLQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVG 591
           LLQL            RYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVG
Sbjct: 496 LLQLFGGTNKTFTKGGRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVG 555

Query: 592 LTAYVTRDVDSKQLVLESGALVLSDGGICCIDEFDKMSESTRSVLHEVMEQQTISVAKAG 651
           LTAY+TRD D+KQ VLESGALVLSDGG+CCIDEFDKMS+STRSVLHEVM+QQ ISVAKAG
Sbjct: 556 LTAYITRDADTKQSVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMKQQPISVAKAG 615

Query: 652 IITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYIILDKVDESTDRDL 711
           IITTLNAR+SILASANPIGSRYN NLPVTENIDLPPPLLSRFDLVY++LDKV ESTDR+L
Sbjct: 616 IITTLNARTSILASANPIGSRYNTNLPVTENIDLPPPLLSRFDLVYLVLDKVSESTDREL 675

Query: 712 AKHLTSLYLEDKPAHVTTDDVLPIDFLTQYINYVKQNVHPLVTEQAKNELVKAYVGMRKM 771
           AKHLTSLYLEDKPAHV+  D+LP+ FLT YINY KQ++HP++TE AK ELV+AYV MR M
Sbjct: 676 AKHLTSLYLEDKPAHVSESDILPVHFLTMYINYAKQHIHPVITEGAKTELVRAYVNMRSM 735

Query: 772 GDDSRSDEKRITATTRQLESMIRLSEAHAKMRLSSTVDLEDVREAVRLMKSAIKDYATDP 831
           GDDSR+DEKRITATTRQLESMIRLSEAHAK+RLS  V++ DV+EAVRL+KSAIKDYA DP
Sbjct: 736 GDDSRADEKRITATTRQLESMIRLSEAHAKVRLSQQVEVSDVQEAVRLIKSAIKDYAIDP 795

Query: 832 KTGKIDMNLVQTGKSVIQRKLQEDLAREIIRILKEYPADSMSFNELIKQINEQAQDRVEP 891
           KTGKIDMNL+QTGKSVIQRKLQEDLAREI+R+L E  AD +++NEL + +NE +QDR++ 
Sbjct: 796 KTGKIDMNLIQTGKSVIQRKLQEDLAREIVRLLTERSADVITYNELARLLNENSQDRLDN 855

Query: 892 SQVSSTLSRLQQEDKVIIL 910
             +S  L+RLQQEDK+++L
Sbjct: 856 MTISDALNRLQQEDKIVVL 874

>KLLA0E23276g complement(2065845..2068325) similar to sp|P38132
           Saccharomyces cerevisiae YBR202w CDC47 cell division
           control protein, start by similarity
          Length = 826

 Score =  350 bits (897), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 222/592 (37%), Positives = 335/592 (56%), Gaps = 57/592 (9%)

Query: 293 KVRPYNVETQKGMRELNPNDIDKLISLKGLVLRATPVIPDMKVAFFKCNICDHTMAVEID 352
           K++P +V      RE+  + + KLI+++G++ R + V P + V  + C+ C H +  E++
Sbjct: 212 KLKPMSV------REIKGSYLGKLITVRGIITRVSDVKPSVTVNAYTCDQCGHEVFQEVN 265

Query: 353 RGVIQEPARCERVDC--NEANSMTLIHNRCS-FADKQVIKLQETPDLVPDGQTPHSVSLC 409
           +        C    C  N+      +  R S F+  Q  K+QE  D VP G  P ++++ 
Sbjct: 266 KRTFTPIIECPSAQCSENQTKGQLFMSTRASKFSAFQECKIQELSDQVPIGHIPRTLTIH 325

Query: 410 VYDELVDSCRAGDRIEVTGTFRSIPIKANSRQRVLKS--LYKTYIDV----VHVKKVSNT 463
           +   L  S   GD ++VTG +   P       R LK+  L +TY++      H KK ++ 
Sbjct: 326 INGPLTRSMIPGDVVDVTGIYLPSPYTGF---RALKAGLLTETYLETQFVYQHKKKFASF 382

Query: 464 RIGVDVSTIEQELLQNKLDNNDVEEVRQISDAEIEKIKQVAQRPDLYDLLARSIAPSIYE 523
                                      Q+ D   E++ ++  + D+Y+ LA+SIAP IY 
Sbjct: 383 ---------------------------QVDDQLKERVAKIVNQGDVYNRLAKSIAPEIYG 415

Query: 524 LDDVKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTS 583
             DVKK +LL L            + RGDINI L GDP  +KSQ+L+ + KI+PRGVYT+
Sbjct: 416 NLDVKKSLLLLLVGGVEKKVGDGLKIRGDINICLMGDPGVAKSQLLKSICKISPRGVYTT 475

Query: 584 GKGSSAVGLTAYVTRDVDSKQLVLESGALVLSDGGICCIDEFDKMSESTRSVLHEVMEQQ 643
           GKGSS VGLTA V +D  + ++VLE GALVL+D GICCIDEFDKM ES R+ +HEVMEQQ
Sbjct: 476 GKGSSGVGLTAAVMKDPVTDEMVLEGGALVLADNGICCIDEFDKMDESDRTAIHEVMEQQ 535

Query: 644 TISVAKAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYIILDKV 703
           TIS++KAGI TTLNAR+SILA+ANP+  RYNP L   ENI+LP  LLSRFD+++++LD  
Sbjct: 536 TISISKAGINTTLNARASILAAANPLYGRYNPRLSPLENINLPAALLSRFDIMFLLLDMP 595

Query: 704 DESTDRDLAKHLTSLYLEDKPAHVTTDDVLPIDFLTQYINYVKQNVHPLVTEQAKNELVK 763
            +  D  LA+H+T +++ D+      + + P   + +YI Y K    P+++      +V 
Sbjct: 596 SKENDEKLAEHVTYVHMYDRQPDFGFEPI-PSSEMREYIAYAKTK-RPVLSADVNEHIVL 653

Query: 764 AYVGMRKMGDDSRSDEKRIT---ATTRQLESMIRLSEAHAKMRLSSTVDLEDVREAVRLM 820
           +Y  MR+  D  ++ + + +   AT R L ++IRLS+A AK+RLS TV++EDV EA+RL+
Sbjct: 654 SYTRMRQ--DSKKALDSKFSFGQATPRTLLAIIRLSQALAKLRLSDTVEIEDVDEALRLV 711

Query: 821 KSAIKDYATDPKTGKIDMNLVQTGKSVIQRKLQEDLAREIIRILKEYPADSM 872
           + + +   +D K    D N      ++I++     +A E  R  K  P D++
Sbjct: 712 EVSKESLYSDRKNPYEDENPTTRIYTIIKK-----MATENGRFNKRLPYDAI 758

>ADR041W [1782] [Homologous to ScYBR202W (CDC47) - SH]
           complement(777754..780195) [2442 bp, 813 aa]
          Length = 813

 Score =  348 bits (892), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 213/578 (36%), Positives = 325/578 (56%), Gaps = 47/578 (8%)

Query: 306 RELNPNDIDKLISLKGLVLRATPVIPDMKVAFFKCNICDHTMAVEIDRGVIQEPARCERV 365
           RE+  + + KLI++ G+V R + V P + V  + C+ C   +  E+++        C   
Sbjct: 215 REVKGSHLGKLITVSGIVTRISDVKPAVLVTAYTCDQCGAEVFQEVNKRTFTPFLECTSR 274

Query: 366 DC--NEANSMTLIHNRCS-FADKQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRAGD 422
            C  N+      +  R S F+  Q  K+QE    VP G  P ++++ V   LV S   GD
Sbjct: 275 QCQQNQNKGQLFMSTRASKFSAFQECKIQEMSHQVPIGHIPRTLTIHVNGPLVRSMVPGD 334

Query: 423 RIEVTGTFRSIPIKANSRQRVLKS--LYKTYIDVVHV----KKVSNTRIGVDVSTIEQEL 476
            ++VTG +   P       + LK+  L +TY++  +V    KK S+  I  DV       
Sbjct: 335 IVDVTGIYLPAPYTGF---KALKAGLLTETYLEAQYVRQHKKKFSSFEITSDVE------ 385

Query: 477 LQNKLDNNDVEEVRQISDAEIEKIKQVAQRPDLYDLLARSIAPSIYELDDVKKGILLQLX 536
                                +++  + Q+ D+Y  LA+SIAP IY   DVKK +LL + 
Sbjct: 386 ---------------------KRVMSIVQQGDVYTRLAKSIAPEIYGNLDVKKALLLLMV 424

Query: 537 XXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYV 596
                      + RGDINI L GDP  +KSQ+L+ + KI PRGVYT+GKGSS VGLTA V
Sbjct: 425 GGVHKTVGDGMKIRGDINICLMGDPGVAKSQLLKSICKITPRGVYTTGKGSSGVGLTAAV 484

Query: 597 TRDVDSKQLVLESGALVLSDGGICCIDEFDKMSESTRSVLHEVMEQQTISVAKAGIITTL 656
            +D  + ++VLE GALVL+D GICCIDEFDKM ES R+ +HEVMEQQTIS++KAGI TTL
Sbjct: 485 MKDPVTDEMVLEGGALVLADNGICCIDEFDKMDESDRTAIHEVMEQQTISISKAGINTTL 544

Query: 657 NARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYIILDKVDESTDRDLAKHLT 716
           NAR+SILA+ANP+  RYNP L   ENI+LP  LLSRFD+++++LD      D  LA+H+ 
Sbjct: 545 NARTSILAAANPVYGRYNPRLSPLENINLPAALLSRFDIMFLLLDMPHRENDEKLAEHVA 604

Query: 717 SLYLEDKPAHVTTDDVLPIDFLTQYINYVKQNVHPLVTEQAKNELVKAYVGMRKMGDDSR 776
            +++ ++   +  + + P   + ++I + K    P++T++    +V++Y+ MR+   +  
Sbjct: 605 YVHMHNRQPELDFEPIEPAA-MREFIAFAKTK-RPIMTQEVNELVVQSYIRMRQDSKNVT 662

Query: 777 SDEKRI-TATTRQLESMIRLSEAHAKMRLSSTVDLEDVREAVRLMKSAIKDYATDPKTGK 835
             +++   AT R L ++IR+S+A AK+R S  VD+EDV EA+RL++ +      D +T  
Sbjct: 663 DPKQQFGQATPRTLLAVIRISQALAKLRFSDQVDVEDVEEALRLIQVSKDSLYNDTQTRA 722

Query: 836 IDMNLVQTGKSVIQRKLQEDLAREIIRILKEYPADSMS 873
            D        ++I++     +A E  R+ K  P D+++
Sbjct: 723 DDETPTTKIFTIIKK-----MAMETARLNKNLPMDTIT 755

>CAGL0J06424g complement(611935..614853) highly similar to sp|P53091
           Saccharomyces cerevisiae YGL201c MCM6, start by
           similarity
          Length = 972

 Score =  349 bits (895), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 217/580 (37%), Positives = 318/580 (54%), Gaps = 54/580 (9%)

Query: 290 KFYKVRPYNVETQKGMRELNPNDIDKLISLKGLVLRATPVIPDMKVAFFKCNICDHTMAV 349
           + +++  +N+ T   +RE+  + I  L+ + G V R + V P++  A F C++C   M  
Sbjct: 248 RLFQISFFNLPTVHRIREIRSDKIGSLMCISGTVTRTSEVRPELYKASFTCDMC-RAMVD 306

Query: 350 EIDRGV-IQEPARCERVDCNEANSMTLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSL 408
            +++     EP  C    C      TL  +R  F D Q +++QE  + +P+G  P ++ +
Sbjct: 307 NVEQSFKYTEPTFCPNPACENRAFWTLNVSRSKFLDWQKVRIQENTNEIPNGSMPRTLDV 366

Query: 409 CVYDELVDSCRAGDRIEVTGTFRSIP---------IKA----------------NSRQRV 443
            +  + VD  + GD+ + TG    +P         +K                 NS    
Sbjct: 367 ILRGDAVDRAKPGDKCQFTGVEIVVPDVSQLMLPGVKPSSSLDTRGIARSSEGLNSGVTG 426

Query: 444 LKSL------YKTYIDVVHVKKVSNTRIGVDVSTIEQEL-LQNKLDNNDVEEVRQ----- 491
           LKSL      YK      HV  V +     + S+ E  L   +KL NND+   R+     
Sbjct: 427 LKSLGVRDLTYKITFLGSHVVSVGSNMNPNENSSAETNLQFISKLQNNDIYSDREKDQEI 486

Query: 492 ----ISDAEIEKIKQVAQRPDLYDLLARSIAPSIYELDDVKKGILLQLXXXXXXXXXXXX 547
               +S  EI +++ + +   +YD L RSIAPS++  + +KKGILLQ+            
Sbjct: 487 FLSSLSPDEINELQDMVKDDHVYDKLVRSIAPSVFGHEAIKKGILLQMLGGVHKTTVEGI 546

Query: 548 RYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDSKQLVL 607
           + RGDINI + GDPSTSKSQ L+YV + APR VYTSGK SSA GLTA V RD +     +
Sbjct: 547 KLRGDINICIVGDPSTSKSQFLKYVCRFAPRSVYTSGKASSAAGLTAAVVRDEEGGDYTI 606

Query: 608 ESGALVLSDGGICCIDEFDKMSESTRSVLHEVMEQQTISVAKAGIITTLNARSSILASAN 667
           E+GAL+L+D GICCIDEFDKM  S +  +HE MEQQTIS+AKAGI  TLNAR+SILA+AN
Sbjct: 607 EAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTSILAAAN 666

Query: 668 PIGSRYNPNLPVTENIDLPPPLLSRFDLVYIILDKVDESTDRDLAKHLTSLYLEDKPAHV 727
           PIG RYN    +  N+++  P++SRFDL +++LD  +E  D +LA H+  L+++   A  
Sbjct: 667 PIGGRYNRKTSLRANLNMTAPIMSRFDLFFVVLDDCNEKIDTELASHIIDLHMKQDEAIT 726

Query: 728 TTDDVLPIDFLTQYINYVKQNVHPLVTEQAKNELVKAYVGMRKMGDDSRSDEK---RITA 784
           +       + L +YI Y K    P++ ++A+  LV+ Y  +RK  DD++   +   RI  
Sbjct: 727 SP---YSAEQLQRYIKYAK-TFKPVINKEARKFLVEKYKALRK--DDAQGYSRSSYRI-- 778

Query: 785 TTRQLESMIRLSEAHAKMRLSSTVDLEDVREAVRLMKSAI 824
           T RQLESM+RLSEA A+   S  +  E V EA  L+K +I
Sbjct: 779 TVRQLESMVRLSEAIARANCSDEITPEFVAEAYDLLKQSI 818

>Kwal_56.23282
          Length = 761

 Score =  342 bits (878), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 222/722 (30%), Positives = 363/722 (50%), Gaps = 80/722 (11%)

Query: 180 ECANSFRNFLMSFKYKYRRVLDGKTDITDDEAEEELYYVKQLNEMRELGTSNLNLDARNL 239
           E   SF NF++ F+      LD               Y +QL     +   ++ +D  +L
Sbjct: 26  EIVKSFHNFVLEFR------LDA-----------HFVYREQLRSNLLVKNYSITVDTAHL 68

Query: 240 LAFKQTEELYYQLLNYPQEVISIMDQTIKDCMVSLVV---------DNQLEHELDEIESK 290
           + +   E+LY +L + P +V+ + +Q +      + +         +NQLE+   +    
Sbjct: 69  IGYN--EDLYKRLYDEPTDVLPLFEQAVSQVARRIALLSRDPNMDPNNQLENASTDDAPN 126

Query: 291 FYKVRPYNVET----------QKGMRELNPNDIDKLISLKGLVLRATPVIPDMKVAFFKC 340
                 +++ T          +  +R L   ++ K++ + G+V+ A+ +          C
Sbjct: 127 SGASLAFDIPTCQVMLISDSSETSLRVLGSENVSKIVRVSGIVVSASVLSSRATFLTLMC 186

Query: 341 NICDHTMAVEIDR------GVIQEPARCERVDCNEANS-------MTLIHNRCSFADKQV 387
             C H   + ++         +  P  C      E  S         ++H    F D+Q 
Sbjct: 187 RNCRHVTTMHLNSFGSLGGNHVSLPRNCLADHSRETGSNPCGQDPYMIVHESSRFVDQQF 246

Query: 388 IKLQETPDLVPDGQTPHSVSLCVYDELVDSCRAGDRIEVTGTFRSIPIKANSRQRVLKSL 447
           +KLQE P+LVP G+ P ++ +     L +    G R  + G +               S+
Sbjct: 247 LKLQEIPELVPVGEMPRNILMSCDRYLTNRIVPGTRATIVGIY---------------SI 291

Query: 448 YKTYIDVVHVKKVSNTRIGVDVSTIEQELLQNKLDNNDVEEVRQISDAEIEKIKQVAQRP 507
           Y+               + +    ++   +Q  LD N +      +D E E+   +++RP
Sbjct: 292 YQAKSRGAGTAASGGKAVAIRNPYVKILGIQTDLDGNPMSNTVVFTDEEEEQFLTLSRRP 351

Query: 508 DLYDLLARSIAPSIYELDDVKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQ 567
           DLY++  +SIAPSIY  +D+KK I+  L            R RGDIN+LL GDP T+KSQ
Sbjct: 352 DLYEIFTKSIAPSIYGNEDIKKAIVCLLMGGSKKLLPDGMRLRGDINVLLLGDPGTAKSQ 411

Query: 568 ILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDSKQLVLESGALVLSDGGICCIDEFDK 627
           +L++V K++P  VYTSGKGSSA GLTA V RD  +++  LE GA+VL+DGG+ CIDEFDK
Sbjct: 412 LLKFVEKVSPISVYTSGKGSSAAGLTASVQRDPATREFYLEGGAMVLADGGVVCIDEFDK 471

Query: 628 MSESTRSVLHEVMEQQTISVAKAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPP 687
           M +  R  +HE MEQQTIS+AKAGI T LN+R+S+LA+ANPI  RY+      ENID   
Sbjct: 472 MRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIYGRYDDLKSPGENIDFQT 531

Query: 688 PLLSRFDLVYIILDKVDESTDRDLAKHLTSLY----LEDKPAHVTTDDVLPIDFLTQYIN 743
            +LSRFD+++I+ D  +E  D  +A H+ +++      ++       + +PI+ + +YI 
Sbjct: 532 TILSRFDMIFIVKDHHNEERDISIANHVMNIHTGRTATNEEEREAAANEIPIEKMKRYIT 591

Query: 744 YVKQNVHPLVTEQAKNELVKAYVGMRK--MGDDSRSDEK-RITATTRQLESMIRLSEAHA 800
           Y +    P ++ QA  +L   +VG+RK  + ++ +S+++  I  T RQLE++IR+SE+ A
Sbjct: 592 YCRMKCAPRLSPQAAEKLSSHFVGIRKKLLINELQSEQRSSIPITVRQLEAIIRISESLA 651

Query: 801 KMRLSSTVDLEDVREAVRLMKSAIKDYATDPKTGKIDMN--LVQTGKSVIQRKLQEDLAR 858
           K+ LS       V EA+RL +++  D A+    G +  N  LVQ       R+++E+L R
Sbjct: 652 KLELSPVAHERHVDEAIRLFQASTMDAASQDPIGGLGQNQDLVQD-----VRRIEEELKR 706

Query: 859 EI 860
            +
Sbjct: 707 RL 708

>AGR276W [4587] [Homologous to ScYLR274W (CDC46) - SH]
           complement(1257348..1259552) [2205 bp, 734 aa]
          Length = 734

 Score =  340 bits (873), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 228/706 (32%), Positives = 360/706 (50%), Gaps = 75/706 (10%)

Query: 180 ECANSFRNFLMSFKYKYRRVLDGKTDITDDEAEEELYYVKQLNEMRELGTSNLNLDARNL 239
           E   SFR+F++ F+   R V                 Y +QL     +    L ++  +L
Sbjct: 26  EVVRSFRDFVLEFRLDARFV-----------------YREQLRNNLLVRRYALRVNTEHL 68

Query: 240 LAFKQTEELYYQLLNYPQEVISIMDQTIKDCMVSLVVDNQLEHELDEIESKFYKVRPYNV 299
           + +   E LY  + + P E + + +Q + +    +    +L  E D       +V   + 
Sbjct: 69  IGYN--EALYKLVRDEPVETVPLFEQAVTEIARRMA---RLRAE-DAGALPAVQVELQSA 122

Query: 300 ETQKGMRELNPNDIDKLISLKGLVLRATPVIPDMKVAFFKCNICDHTMAVEIDR------ 353
             +  +R+L+   + +L+ L G+V+  + +          C  C HT A++++       
Sbjct: 123 AAETALRQLDSQSVSRLVRLSGIVVSTSVLTSRATHVALMCRNCRHTTALDLNNFQSLAG 182

Query: 354 GVIQEPARCERVDCNEANSMT----------LIHNRCSFADKQVIKLQETPDLVPDGQTP 403
             +  P  C     N+  S            ++H    F D+Q +KLQE P+ VP G+ P
Sbjct: 183 SNVALPRACLADHSNDDGSAAGNPCGQDPYMIVHESSRFVDQQFLKLQEVPESVPIGEMP 242

Query: 404 HSVSLCVYDELVDSCRAGDRIEVTGTFRSIPIKANSRQRVLKSLYKTYIDVVHVKKVSNT 463
            ++ L     L +    G R+ V G +     K         ++   Y+ V+ ++  + +
Sbjct: 243 RNLLLTCDRYLTNRVVPGTRVTVVGIYAIYQSKGGQGGARAVAIRNPYVKVLGIEAQAGS 302

Query: 464 RIGVDVSTIEQELLQNKLDNNDVEEVRQISDAEIEKIKQVAQRPDLYDLLARSIAPSIYE 523
             GV                     +   S+ E E+  ++A+ P+LY L A SIAPSIY 
Sbjct: 303 PAGV---------------------LSMFSEEEEEEFLRLARTPNLYQLFAESIAPSIYG 341

Query: 524 LDDVKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTS 583
            +D+KK I+  L            R RGDIN+LL GDP T+KSQ+L++V K++P  VYTS
Sbjct: 342 NEDIKKAIVCLLMGGSKKLLPDGMRLRGDINVLLLGDPGTAKSQLLKFVEKVSPIAVYTS 401

Query: 584 GKGSSAVGLTAYVTRDVDSKQLVLESGALVLSDGGICCIDEFDKMSESTRSVLHEVMEQQ 643
           GKGSSA GLTA V RD ++++  LE GA+VL+DGG+ CIDEFDKM +  R  +HE MEQQ
Sbjct: 402 GKGSSAAGLTASVQRDPNTREFYLEGGAMVLADGGVVCIDEFDKMRDEDRVAIHEAMEQQ 461

Query: 644 TISVAKAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYIILDKV 703
           TIS+AKAGI T LN+R+S+LA+ANPI  RY+      ENID    +LSRFD+++I+ D+ 
Sbjct: 462 TISIAKAGITTVLNSRTSVLAAANPIYGRYDELKSPGENIDFQTTILSRFDMIFIVKDEH 521

Query: 704 DESTDRDLAKHLTSLY-----LEDKPAHVTTDDVLPIDFLTQYINYVKQNVHPLVTEQAK 758
           +E  D  +A+H+ +++     + D  A    D  +PID + +YI Y +    P ++  A 
Sbjct: 522 NEQRDMSIAQHVMNIHTGRTAVPDAGA-AGADREIPIDKMRRYITYCRSKCAPRLSTHAA 580

Query: 759 NELVKAYVGMRK--MGDDSRSDEK-RITATTRQLESMIRLSEAHAKMRLSSTVDLEDVRE 815
            +L   +V +RK  + ++  S EK  I  T RQLE++IR+SE+ AK+ LSS  +   V E
Sbjct: 581 EKLSSHFVTIRKQLLINELESKEKSSIPITVRQLEAIIRISESLAKLELSSVAEERHVDE 640

Query: 816 AVRLMKSAIKDYAT-DPKTGKIDMNLVQTGKSVIQRKLQEDLAREI 860
           A+RL +++  D A+ DP  G  + N+V        R L+ +L R +
Sbjct: 641 AIRLFQASTMDAASQDPIGGMQNSNVVSE-----VRNLEAELKRRL 681

>Scas_590.6
          Length = 767

 Score =  336 bits (861), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 223/729 (30%), Positives = 373/729 (51%), Gaps = 88/729 (12%)

Query: 180 ECANSFRNFLMSFKYKYRRVLDGKTDITDDEAEEELYYVKQLNEMRELGTSNLNLDARNL 239
           E   SF+NF++ F+                  + +  Y  QL     +   +LN++  +L
Sbjct: 26  EIIKSFKNFILEFRL-----------------DSQFIYRDQLRNSLLVKNYSLNVNMEHL 68

Query: 240 LAFKQTEELYYQLLNYPQEVISIMDQTIKDCMVSLVV-------DNQLEHELDEIESKF- 291
           + +   E+L+ +L + P +VI + +  I      + +       +N   +E D+++++  
Sbjct: 69  IGYN--EDLFKRLSDGPSDVIPLFETAITQVAKRITLLNRSSQNENGTANETDDLDTRNS 126

Query: 292 --------YKVRPYNVETQKGMRELNPNDIDKLISLKGLVLRATPVIPDMKVAFFKCNIC 343
                   +++   +   Q  +R L+   + K++ L G+++ A+ +          C  C
Sbjct: 127 ISSALIPNFQLILTSTANQTPLRSLDSEHVSKIVRLSGIIISASVLSSRATHLSLMCRSC 186

Query: 344 DHTMAVEIDR------GVIQEPARCERV--------DCNEANS----MTLIHNRCSFADK 385
            HT +++ID         +  P  C           D N  N       +IH   +F D+
Sbjct: 187 RHTTSIKIDNFNSITGNSVTLPHACLSSVTATDTGDDSNNKNCGPDPYLIIHESSTFIDQ 246

Query: 386 QVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRAGDRIEVTGTFRSIPIKANSRQRVLK 445
           Q +KLQE P+LVP G+ P ++++     L +    G R+ + G                 
Sbjct: 247 QFLKLQEIPELVPVGEMPRNITMSCDRYLTNRVIPGTRVTIVG----------------- 289

Query: 446 SLYKTYIDVVHVKKVSNTRIGVDVST--IEQELLQNKLDNNDV-EEVRQISDAEIEKIKQ 502
            +Y  Y         +N   GV +    I+   +Q  ++ + +   V   S+ E E+  Q
Sbjct: 290 -IYSIYSSKKRGYNSNNDGGGVAIRNPFIKVLGIQTDVETSSIWNSVTMFSEEEEEEFLQ 348

Query: 503 VAQRPDLYDLLARSIAPSIYELDDVKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPS 562
           +++R DLY++L +SIAPSI+  +D+KK I+  L            R RGDIN+LL GDP 
Sbjct: 349 LSRREDLYEVLTKSIAPSIFGNEDIKKAIVCLLMGGSKKLLPDGMRLRGDINVLLLGDPG 408

Query: 563 TSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDSKQLVLESGALVLSDGGICCI 622
           T+KSQ+L++V K++P  VYTSGKGSSA GLTA V RD  +++  LE GA+VL+DGG+ CI
Sbjct: 409 TAKSQLLKFVEKVSPIAVYTSGKGSSAAGLTASVQRDPATREFYLEGGAMVLADGGVVCI 468

Query: 623 DEFDKMSESTRSVLHEVMEQQTISVAKAGIITTLNARSSILASANPIGSRYNPNLPVTEN 682
           DEFDKM +  R  +HE MEQQTIS+AKAGI T LN+R+S+LA+ANPI  RY+      EN
Sbjct: 469 DEFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIYGRYDDLKSPGEN 528

Query: 683 IDLPPPLLSRFDLVYIILDKVDESTDRDLAKHLTSLYLEDKPAHVTTD-----DVLPIDF 737
           ID    +LSRFD+++I+ D+ +E+ D  +A H+ +++  +       D       L ++ 
Sbjct: 529 IDFQTTILSRFDMIFIVKDEHNEARDISIANHVINIHTGNSTTQQDQDLENSGSELSMEK 588

Query: 738 LTQYINYVKQNVHPLVTEQAKNELVKAYVGMRK---MGDDSRSDEKRITATTRQLESMIR 794
           + +YI Y +    P ++ QA  +L   +V +RK   + +   ++   I  T RQLE++IR
Sbjct: 589 MKRYITYCRIKCAPRLSVQAAEKLSSQFVTIRKQLLINELESTERSSIPITIRQLEAIIR 648

Query: 795 LSEAHAKMRLSSTVDLEDVREAVRLMKSAIKDYAT-DPKTGKIDMNLVQTGKSVIQ--RK 851
           ++E+ AK+ LS       V EA+RL +++  D A+ DP  G   +N    G +++   R+
Sbjct: 649 ITESLAKLELSPVAHERHVEEAIRLFQASTMDAASQDPIGG---LNQTGNGSNIMAEIRR 705

Query: 852 LQEDLAREI 860
           ++ +L R +
Sbjct: 706 IESELKRRL 714

>CAGL0F04939g 503890..506208 highly similar to sp|P29496
           Saccharomyces cerevisiae YLR274w CDC46 cell division
           control protein, start by similarity
          Length = 772

 Score =  335 bits (860), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 231/736 (31%), Positives = 374/736 (50%), Gaps = 97/736 (13%)

Query: 180 ECANSFRNFLMSFKYKYRRVLDGKTDITDDEAEEELYYVKQLNEMRELGTSNLNLDARNL 239
           E   +F+ F++ F+                  + +  Y  QL     +   +L++D  +L
Sbjct: 26  EIIKAFKRFILEFRL-----------------DSQFLYRDQLRNSLLVKNYSLSVDLEHL 68

Query: 240 LAFKQTEELYYQLLNYPQEVISIMDQTIKDCMVSLVVDNQLEHE---LDEIESK------ 290
           + +   E+LY +L + P +VI + +  I      +++ N+  +    LD+I+        
Sbjct: 69  IGYN--EDLYKRLSDEPSDVIPLFETAITQVAKRIMILNKSSNTNDGLDDIDENSNDLAD 126

Query: 291 ---------FYKVRPYNVETQKGMRELNPNDIDKLISLKGLVLRATPVIPDMKVAFFKCN 341
                     +++   +   Q  +R+LN   +  ++ L G+++ A+ +          C 
Sbjct: 127 DEDGITDIPVFQLILSSRANQVSLRQLNSEHVSNIVRLSGIIVSASVLSQRATHLSLMCR 186

Query: 342 ICDHTMAVEIDR------GVIQEPARCERVDCNEANSMT--------------------- 374
            C HTM++ I+         +  P  C+  + N   +                       
Sbjct: 187 NCRHTMSLNINNFNSITGNSVTLPHSCQSTNNNSTAAYIHDTGDDPTGSGAASKNCGPDP 246

Query: 375 --LIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRAGDRIEVTGTFRS 432
             +IH    F D+Q +KLQE P+LVP  + P ++++     L +    G R+ + G + S
Sbjct: 247 YIIIHESSKFIDQQFLKLQEVPELVPVSEMPRNITMTCDRYLTNRVNPGTRVTIEGIY-S 305

Query: 433 IPIKANSRQR---VLKSLYKTYIDVVHVKKVSNTRIGVDVSTIEQELLQNKLDNNDVEEV 489
           I    NS++R     +S     I   ++K V   +  V+ S+I   +             
Sbjct: 306 I---YNSKKRSGAAGQSGSGVAIRTPYIK-VLGIQTDVEASSIWNSMTM----------- 350

Query: 490 RQISDAEIEKIKQVAQRPDLYDLLARSIAPSIYELDDVKKGILLQLXXXXXXXXXXXXRY 549
              S+ E E+  Q+++RPD+Y+LLA SIAPSI+   D+KK I+  L            R 
Sbjct: 351 --FSEEEEEEFLQLSRRPDIYELLANSIAPSIFGNQDIKKAIVCLLMGGSKKLLPDGMRL 408

Query: 550 RGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDSKQLVLES 609
           RGDIN+LL GDP T+KSQ+L++V K++P  VYTSGKGSSA GLTA V RD  +K+  LE 
Sbjct: 409 RGDINVLLLGDPGTAKSQLLKFVEKVSPIAVYTSGKGSSAAGLTASVQRDPITKEFFLEG 468

Query: 610 GALVLSDGGICCIDEFDKMSESTRSVLHEVMEQQTISVAKAGIITTLNARSSILASANPI 669
           GA+VL+DGG+ CIDEFDKM +  R  +HE MEQQTIS+AKAGI T LN+R+S+LA+ANPI
Sbjct: 469 GAMVLADGGVVCIDEFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPI 528

Query: 670 GSRYNPNLPVTENIDLPPPLLSRFDLVYIILDKVDESTDRDLAKHLTSLYLEDKPAHVTT 729
             RY+      ENID    +LSRFD+++I+ D+ +E  D  +A H+ +++     A +  
Sbjct: 529 YGRYDELKSPGENIDFQTTILSRFDMIFIVKDEHNEERDISIANHVMNIHTGHTDAQLEA 588

Query: 730 DDV-LPIDFLTQYINYVKQNVHPLVTEQAKNELVKAYVGMRK---MGDDSRSDEKRITAT 785
           +   L I+ + +YI Y K    P +T +A  +L   +V +RK   + +   ++   I  T
Sbjct: 589 NGSELSIEKMKRYITYCKSRCAPRLTPEAAEKLSSQFVTIRKQLLINELESTERSSIPIT 648

Query: 786 TRQLESMIRLSEAHAKMRLSSTVDLEDVREAVRLMKSAIKDYAT-DPKTGKIDMNLVQTG 844
            RQLE++IR++E+ AK+ LS   +   V EA+RL +++  D A  DP  G   MN  QT 
Sbjct: 649 IRQLEAIIRITESLAKLELSPIAEERHVDEAIRLFQASTMDAAAQDPIGG---MN--QTN 703

Query: 845 KSVIQRKLQEDLAREI 860
                R+++++L R +
Sbjct: 704 SLSDIRRVEQELKRRL 719

>KLLA0F10087g complement(935618..938629) similar to sp|P53091
           Saccharomyces cerevisiae YGL201c MCM6 involved in
           replication, start by similarity
          Length = 1003

 Score =  340 bits (872), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 210/599 (35%), Positives = 319/599 (53%), Gaps = 79/599 (13%)

Query: 285 DEIESKFYKVRPYNVETQKGMRELNPNDIDKLISLKGLVLRATPVIPDMKVAFFKCNICD 344
           D++E +  ++   N+ T   +R++  N I  L+++ G V R + + P++  A F C +C 
Sbjct: 239 DQVE-RVLQISFLNLPTVHRIRDIRANKIGSLMAISGTVTRTSEIRPELYKASFTCELCR 297

Query: 345 HTMAVEIDRGVIQEPARCERVDCNEANSMTLIHNRCSFADKQVIKLQETPDLVPDGQTPH 404
             +          EP  C    C   +  +L  NR  F D Q +++QE  + +P G  P 
Sbjct: 298 AVIDNVEQVFKYTEPTSCPNPTCENQSFWSLNVNRSKFLDWQKVRIQENSNEIPSGSMPR 357

Query: 405 SVSLCVYDELVDSCRAGDRIEVTGTFRSIP---------IKA----------------NS 439
           ++ + +  + V+  + GDR +  GT   +P         +KA                NS
Sbjct: 358 TLDIILRGDCVERAKPGDRCKFIGTEIVVPDVSQLGLPGVKASSTPDSRGISRTTEGLNS 417

Query: 440 RQRVLKSL------YKTYIDVVHVKKVSNTRIGVDV------------------------ 469
               LKSL      YK      HV+ V  +  G  +                        
Sbjct: 418 GISGLKSLGVRDLTYKISFLACHVENVGTSFNGSRINEEDADKTSKFDYINLRNYQNYEM 477

Query: 470 -STIEQELLQNKLDNNDVEEVRQISDAEIEKIKQVAQRPDLYDLLARSIAPSIYELDDVK 528
            +  +QE+   +LD++           EI ++K++ +  ++YD L +SIAP+++  + +K
Sbjct: 478 AAETDQEIFLTRLDSD-----------EINELKEMVKDENIYDKLVKSIAPAVFGHETIK 526

Query: 529 KGILLQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSS 588
           KGILLQ+            + RGDINI + GDPSTSKSQ L+YV   +PR VYTSGK SS
Sbjct: 527 KGILLQMLSGVHKTTVEGIKLRGDINICIVGDPSTSKSQFLKYVCNFSPRAVYTSGKASS 586

Query: 589 AVGLTAYVTRDVDSKQLVLESGALVLSDGGICCIDEFDKMSESTRSVLHEVMEQQTISVA 648
           A GLTA V +D +     +E+GAL+L+D G+CCIDEFDKM  + +  +HE MEQQTIS+A
Sbjct: 587 AAGLTAAVVKDEEGGDFTIEAGALMLADNGVCCIDEFDKMDIADQVAIHEAMEQQTISIA 646

Query: 649 KAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYIILDKVDESTD 708
           KAGI  TLNAR+SILA+ANP+G RYN  L +  N+++  P++SRFDL ++ILD  +E  D
Sbjct: 647 KAGIHATLNARTSILAAANPVGGRYNRKLTLRSNLNMSAPIMSRFDLFFVILDDCNEKID 706

Query: 709 RDLAKHLTSLYLEDKPAHVTTDDVLPIDFLTQYINYVKQNVHPLVTEQAKNELVKAYVGM 768
            +LA H+  L+++   A    +     + L++YINY K    P++T++A++ LVK Y  +
Sbjct: 707 TELASHIVDLHMKRDSA---INPPFSAEQLSRYINYAK-TFKPVMTKEARDYLVKRYTEL 762

Query: 769 RKMGDDSRSDEK---RITATTRQLESMIRLSEAHAKMRLSSTVDLEDVREAVRLMKSAI 824
           RK  DD++   K   RI  T RQLES+IRLSEA A+      +    V EA  L++ +I
Sbjct: 763 RK--DDAQGYSKSSYRI--TVRQLESLIRLSEAIARANCVDEIVPSFVAEAYDLLRQSI 817

>Kwal_47.18966
          Length = 1044

 Score =  339 bits (869), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 209/577 (36%), Positives = 308/577 (53%), Gaps = 50/577 (8%)

Query: 290 KFYKVRPYNVETQKGMRELNPNDIDKLISLKGLVLRATPVIPDMKVAFFKCNICDHTMAV 349
           + +++  +N+ T   +R++    I  L+S+ G V R + V P++  A F C +C   +  
Sbjct: 278 RIFQISFFNLPTVNRIRDIRAEKIGSLMSISGTVTRTSEVRPELYKASFTCEMCRAVVDN 337

Query: 350 EIDRGVIQEPARCERVDCNEANSMTLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLC 409
                   +P  C    C      TL   R  F D Q +++QE  + +P G  P ++ + 
Sbjct: 338 VEQVFKYTQPTYCPNPSCENQAFWTLSVGRSKFLDWQKVRIQENANEIPTGSMPRTLDVV 397

Query: 410 VYDELVDSCRAGDRIEVTGTFRSIP---------IKA----------------NSRQRVL 444
           +  + V+  + GDR + TGT   +P         +K                 N+    L
Sbjct: 398 LRGDCVERAKPGDRCKFTGTEIVVPDITQLGLPGVKPSSTMDNRGIARSSEGLNTGVSGL 457

Query: 445 KSL------YKTYIDVVHV----KKVSNTRIGVDVSTIEQELLQNKLDNNDVEE----VR 490
           KSL      YK      HV    K  +N     D       +  N + N+D  +    + 
Sbjct: 458 KSLGVRDLTYKISFLACHVTPTGKDANNNANAQDEGGDLLSMQVNNVGNDDERDQEIFLN 517

Query: 491 QISDAEIEKIKQVAQRPDLYDLLARSIAPSIYELDDVKKGILLQLXXXXXXXXXXXXRYR 550
            ++  EI ++K++ +   +YD L RSIAP+++  + VKKGILLQ+              R
Sbjct: 518 SLNSQEINELKEMVKDEQIYDKLVRSIAPAVFGHNTVKKGILLQMLGGVHKTTVEGINLR 577

Query: 551 GDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDSKQLVLESG 610
           GDINI + GDPSTSKSQ L+YV   APR VYTSGK SSA GLTA V +D ++    +E+G
Sbjct: 578 GDINICIVGDPSTSKSQFLKYVCGFAPRAVYTSGKASSAAGLTAAVVKDEEAGDFTIEAG 637

Query: 611 ALVLSDGGICCIDEFDKMSESTRSVLHEVMEQQTISVAKAGIITTLNARSSILASANPIG 670
           AL+L+D GICCIDEFDKM  S +  +HE MEQQTIS+AKAGI  TLNAR+SILA+ANP+G
Sbjct: 638 ALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTSILAAANPVG 697

Query: 671 SRYNPNLPVTENIDLPPPLLSRFDLVYIILDKVDESTDRDLAKHLTSLYLEDKPAHVTTD 730
            RYN  L +  N+++  P++SRFDL +++LD  +E  D +LA H+  L+++   A    D
Sbjct: 698 GRYNRKLTLRGNLNMTAPIMSRFDLFFVVLDDCNEKIDTELAAHIVDLHMKRDEA---ID 754

Query: 731 DVLPIDFLTQYINYVKQNVHPLVTEQAKNELVKAYVGMRKMGDDSRSDEK---RITATTR 787
                + L +YI Y +    P++ E+A+N LV+ Y  +R+  DD++   K   RI  T R
Sbjct: 755 PPFTAEQLRRYIKYAR-TFKPVMNEEARNYLVEKYKELRR--DDAQGFSKSSYRI--TVR 809

Query: 788 QLESMIRLSEAHAKMRLSSTVDLEDVREAVRLMKSAI 824
           QLESMIRLSE  A+      +    V EA  L++ +I
Sbjct: 810 QLESMIRLSEGIARANCVDEITPNFVAEAYDLLRQSI 846

>Scas_712.49
          Length = 1019

 Score =  338 bits (867), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 213/584 (36%), Positives = 312/584 (53%), Gaps = 54/584 (9%)

Query: 286 EIESKFYKVRPYNVETQKGMRELNPNDIDKLISLKGLVLRATPVIPDMKVAFFKCNICDH 345
           E   + +++  +N+ T   +R++    I  L+S+ G V R + V P++  A F C++C  
Sbjct: 245 EQSERIFQISFFNLPTVFRIRDIRSEKIGSLLSISGTVTRTSEVRPELYKASFTCDLCRA 304

Query: 346 TMAVEIDRGVIQEPARCERVDCNEANSMTLIHNRCSFADKQVIKLQETPDLVPDGQTPHS 405
            +          EP  C    C      TL   R  F D Q +++QE  + +P G  P +
Sbjct: 305 QVDNVEQSFKYTEPTFCPNPSCENRAFWTLNVTRSKFLDWQKVRIQENANEIPSGSMPRT 364

Query: 406 VSLCVYDELVDSCRAGDRIEVTGTFRSIP---------IKANSRQRV------------- 443
           + + +  + V+  + GDR + TGT   +P         IK  S                 
Sbjct: 365 LDVILRGDCVERAKPGDRCKFTGTEIVVPDVTQLGLPGIKPTSSMDTRGIARSTEGLNNG 424

Query: 444 ---LKSL------YKTYIDVVHVKKV-SNTRIGVDVSTIEQELLQNKLDNNDVEE----- 488
              L++L      YK      HV  + SNT    + +T  +  L   L  ++V +     
Sbjct: 425 VSGLRALGVRDLTYKISFLACHVISIGSNTDASSNGNTENELQLAATLHGSNVYQDYEKD 484

Query: 489 ----VRQISDAEIEKIKQVAQRPDLYDLLARSIAPSIYELDDVKKGILLQLXXXXXXXXX 544
               +  ++  EI ++K++ +   +YD L RSIAP+++  + VKKGILLQ+         
Sbjct: 485 QEVFLNSLNSEEINELKEMVKDEHIYDKLVRSIAPAVFGHEAVKKGILLQMLGGVHKSTV 544

Query: 545 XXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDSKQ 604
              + RGDINI + GDPSTSKSQ L+YV    PR VYTSGK SSA GLTA V RD +   
Sbjct: 545 EGIKLRGDINICIVGDPSTSKSQFLKYVCGFVPRSVYTSGKASSAAGLTAAVVRDEEGGD 604

Query: 605 LVLESGALVLSDGGICCIDEFDKMSESTRSVLHEVMEQQTISVAKAGIITTLNARSSILA 664
             +E+GAL+L+D GICCIDEFDKM  S +  +HE MEQQTIS+AKAGI  TLNAR+SILA
Sbjct: 605 YTIEAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTSILA 664

Query: 665 SANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYIILDKVDESTDRDLAKHLTSLYLE-DK 723
           +ANPIG RYN  L +  N+++  P++SRFDL ++ILD  +E  D +LA H+  L+++ D 
Sbjct: 665 AANPIGGRYNRKLSLRGNLNMTAPIMSRFDLFFVILDDCNEKIDTELASHIVDLHMKRDA 724

Query: 724 PAHVTTDDVLPIDFLTQYINYVKQNVHPLVTEQAKNELVKAYVGMRKMGDDSRSDEK--- 780
             H         + L +YI Y +    P++T++A+  LV+ Y  +RK  DD++   K   
Sbjct: 725 AIH----SPFTAEQLRRYIRYAR-TFKPILTKEARQYLVEKYKDLRK--DDAQGYSKSSY 777

Query: 781 RITATTRQLESMIRLSEAHAKMRLSSTVDLEDVREAVRLMKSAI 824
           RIT   RQLESMIRLSEA A+      +    + EA  L++ +I
Sbjct: 778 RITV--RQLESMIRLSEAIARANCVDEITPAFIAEAYDLLRQSI 819

>CAGL0M05423g 577097..579535 highly similar to sp|P38132
           Saccharomyces cerevisiae YBR202w CDC47, start by
           similarity
          Length = 812

 Score =  332 bits (851), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 204/525 (38%), Positives = 307/525 (58%), Gaps = 38/525 (7%)

Query: 305 MRELNPNDIDKLISLKGLVLRATPVIPDMKVAFFKCNICDHTMAVEIDRGVIQEPARCER 364
           +R++    + +LI+++G++ R + V P + V  + C+ C + +  E++         C  
Sbjct: 221 VRQIKGELLGELITVRGIITRVSDVKPAVTVIAYTCDQCGYEIFQEVNSKTFTPLVECTS 280

Query: 365 VDC--NEANSMTLIHNRCS-FADKQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRAG 421
            +C  N+      +  R S F   Q  K+QE    VP G  P S+++ V   LV S   G
Sbjct: 281 RECSQNQTKGQLFMSTRASKFNAFQECKIQELSQQVPVGHIPRSLTIHVNGPLVRSVTPG 340

Query: 422 DRIEVTGTFRSIPIKANSRQRVLKS--LYKTYIDVVHVKKVSNTRIGVDVSTIEQELLQN 479
           D +++ G F   P       + LK+  L +TY++  HV++         ++         
Sbjct: 341 DIVDIAGIFLPSPYTGF---KALKAGLLTETYLEAHHVRQHKKKFASFQMTP-------- 389

Query: 480 KLDNNDVEEVRQISDAEIEKIKQVAQRPDLYDLLARSIAPSIYELDDVKKGILLQLXXXX 539
                   +VR   DA       +AQ  ++Y+ LA+SIAP IY   DVKK +LL L    
Sbjct: 390 --------QVRSNVDA-------LAQSGNVYERLAKSIAPEIYGNLDVKKALLLLLVGGV 434

Query: 540 XXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRD 599
                   + RGDINI L GDP  +KSQ+L+ + KI PRGVYT+GKGSS VGLTA V +D
Sbjct: 435 DKRVGDGMKIRGDINICLMGDPGVAKSQLLKAICKITPRGVYTTGKGSSGVGLTAAVMKD 494

Query: 600 VDSKQLVLESGALVLSDGGICCIDEFDKMSESTRSVLHEVMEQQTISVAKAGIITTLNAR 659
             + +++LE GALVL+D GICCIDEFDKM ES R+ +HEVMEQQTIS++KAGI TTLNAR
Sbjct: 495 PVTDEMILEGGALVLADNGICCIDEFDKMDESDRTAIHEVMEQQTISISKAGINTTLNAR 554

Query: 660 SSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYIILDKVDESTDRDLAKHLTSLY 719
           +SILA+ANP+  RYNP L   ENI+LP  LLSRFD+++++LD  +   D  LA H+  ++
Sbjct: 555 TSILAAANPLYGRYNPRLSPLENINLPAALLSRFDVMFLLLDTPNRENDEQLANHVAYVH 614

Query: 720 LEDKPAHVTTDDVLPIDFLTQYINYVKQNVHPLVTEQAKNELVKAYVGMRKMGDDSRSDE 779
           + +K   +  + + P   + ++I Y +  + P++T +  + +V AY+ +R+  D  R  +
Sbjct: 615 MYNKQPDLDFEPIEPT-MMREFIAYAR-TMRPVMTAEINDHVVSAYIRLRQ--DSKREMD 670

Query: 780 KRIT---ATTRQLESMIRLSEAHAKMRLSSTVDLEDVREAVRLMK 821
            + +   AT R L ++IRLS+A AK+RLS TVD++DV EA+RL++
Sbjct: 671 SKFSFGQATPRTLLAIIRLSQALAKLRLSETVDIDDVEEALRLIR 715

>AFR546W [3738] [Homologous to ScYGL201C (MCM6) - SH]
           complement(1415577..1418594) [3018 bp, 1005 aa]
          Length = 1005

 Score =  336 bits (862), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 205/581 (35%), Positives = 307/581 (52%), Gaps = 57/581 (9%)

Query: 290 KFYKVRPYNVETQKGMRELNPNDIDKLISLKGLVLRATPVIPDMKVAFFKCNICDHTMAV 349
           + +++  +N+     +R++    +  L+++ G V R + V P++  A F C++C   +  
Sbjct: 267 RIFQISFFNIPVTNRIRDIRAEKVGTLMTISGTVTRTSEVRPELFKASFTCDMCRAVVDN 326

Query: 350 EIDRGVIQEPARCERVDCNEANSMTLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLC 409
                   EP  C    C      TL   R  F D Q +++QE  + +P G  P ++ + 
Sbjct: 327 VEQVFKFTEPTFCPNPSCENQAFWTLNIGRSRFLDWQRVRIQENSNEIPTGSMPRTLDVI 386

Query: 410 VYDELVDSCRAGDRIEVTGTFRSIP---------IKA----------------NSRQRVL 444
           +  + V+  + GDR   TGT   +P         +K                 NS    L
Sbjct: 387 LRGDCVERAKPGDRCRFTGTEIVMPDVTQLGLAGMKPSSAPDTRGISRTMEGLNSGVSGL 446

Query: 445 KSL------YKTYIDVVHVKKVSNTRIGVDVSTIEQELLQNKLDNNDVEEVRQ------- 491
           K+L      YK      HV  V N       S  + ++L ++LD N ++ + +       
Sbjct: 447 KTLGVRDLTYKIAFLACHVMGVGNN------SNPQGDVLSHELDVNMLQHLNKGIDDTER 500

Query: 492 --------ISDAEIEKIKQVAQRPDLYDLLARSIAPSIYELDDVKKGILLQLXXXXXXXX 543
                   +S  EI ++K++ +   +YD L +SIAP+++  + VKKG+LLQ+        
Sbjct: 501 DQELFLNSLSSDEINELKEMVKDERIYDKLVQSIAPAVFGHETVKKGLLLQMLGGVHKTT 560

Query: 544 XXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDSK 603
               + RGDINI + GDPSTSKSQ L+YV    PR VYTSGK SSA GLTA V +D +  
Sbjct: 561 VEGIKLRGDINICIVGDPSTSKSQFLKYVCAFVPRAVYTSGKASSAAGLTAAVVKDEEGG 620

Query: 604 QLVLESGALVLSDGGICCIDEFDKMSESTRSVLHEVMEQQTISVAKAGIITTLNARSSIL 663
              +E+GAL+L+D GICCIDEFDKM  S +  +HE MEQQTIS+AKAGI  TLNAR+SIL
Sbjct: 621 DFTIEAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTSIL 680

Query: 664 ASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYIILDKVDESTDRDLAKHLTSLYLEDK 723
           A+ANP+G RYN  L +  N+++  P++SRFDL ++ILD  ++  D +LA H+ +L+++  
Sbjct: 681 AAANPVGGRYNRKLTLRGNLNMTAPIMSRFDLFFVILDDCNQKVDTELASHIVNLHMKCD 740

Query: 724 PAHVTTDDVLPIDFLTQYINYVKQNVHPLVTEQAKNELVKAYVGMRKMGDDSRSDEKRIT 783
            A    D    +D L +YI Y +    P++TE A+  LV+ Y  +RK  D     +    
Sbjct: 741 DA---IDPPFTMDQLRRYIKYAR-TFKPILTEDARQFLVEKYKELRK-NDIQGYSKSSYR 795

Query: 784 ATTRQLESMIRLSEAHAKMRLSSTVDLEDVREAVRLMKSAI 824
            T RQLESMIRLSEA A+      +    V EA  L++ +I
Sbjct: 796 ITVRQLESMIRLSEAIARANCVDEITPAFVAEAYDLLRQSI 836

>YGL201C (MCM6) [1794] chr7 complement(117856..120909) Protein
           involved in DNA replication, member of the MCM/P1 family
           of proteins [3054 bp, 1017 aa]
          Length = 1017

 Score =  334 bits (857), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 214/588 (36%), Positives = 314/588 (53%), Gaps = 66/588 (11%)

Query: 290 KFYKVRPYNVETQKGMRELNPNDIDKLISLKGLVLRATPVIPDMKVAFFKCNICDHTMAV 349
           + +++  +N+ T   +R++    I  L+S+ G V R + V P++  A F C++C   +  
Sbjct: 261 RVFQISFFNLPTVHRIRDIRSEKIGSLLSISGTVTRTSEVRPELYKASFTCDMCRAIVDN 320

Query: 350 EIDRGVIQEPARCERVDCNEANSMTLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLC 409
                   EP  C    C      TL   R  F D Q +++QE  + +P G  P ++ + 
Sbjct: 321 VEQSFKYTEPTFCPNPSCENRAFWTLNVTRSRFLDWQKVRIQENANEIPTGSMPRTLDVI 380

Query: 410 VYDELVDSCRAGDRIEVTGTFRSIP---------IKA----------------NSRQRVL 444
           +  + V+  + GDR + TG    +P         +K                 NS    L
Sbjct: 381 LRGDSVERAKPGDRCKFTGVEIVVPDVTQLGLPGVKPSSTLDTRGISKTTEGLNSGVTGL 440

Query: 445 KSL------YKTYIDVVHVKKVSNTRIGV-----DVSTIEQEL-LQNKLDNNDVEE---- 488
           +SL      YK      HV  +  + IG      + +  E EL +   L  N+V +    
Sbjct: 441 RSLGVRDLTYKISFLACHVISI-GSNIGASSPDANSNNRETELQMAANLQANNVYQDNER 499

Query: 489 -----VRQISDAEIEKIKQVAQRPDLYDLLARSIAPSIYELDDVKKGILLQLXXXXXXXX 543
                +  +S  EI ++K++ +   +YD L RSIAP+++  + VKKGILLQ+        
Sbjct: 500 DQEVFLNSLSSDEINELKEMVKDEHIYDKLVRSIAPAVFGHEAVKKGILLQMLGGVHKST 559

Query: 544 XXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDSK 603
               + RGDINI + GDPSTSKSQ L+YV   APR VYTSGK SSA GLTA V RD +  
Sbjct: 560 VEGIKLRGDINICVVGDPSTSKSQFLKYVVGFAPRSVYTSGKASSAAGLTAAVVRDEEGG 619

Query: 604 QLVLESGALVLSDGGICCIDEFDKMSESTRSVLHEVMEQQTISVAKAGIITTLNARSSIL 663
              +E+GAL+L+D GICCIDEFDKM  S +  +HE MEQQTIS+AKAGI  TLNAR+SIL
Sbjct: 620 DYTIEAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTSIL 679

Query: 664 ASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYIILDKVDESTDRDLAKHLTSLYLEDK 723
           A+ANP+G RYN  L +  N+++  P++SRFDL ++ILD  +E  D +LA H+  L     
Sbjct: 680 AAANPVGGRYNRKLSLRGNLNMTAPIMSRFDLFFVILDDCNEKIDTELASHIVDL----- 734

Query: 724 PAHVTTDDVLPIDF----LTQYINYVKQNVHPLVTEQAKNELVKAYVGMRKMGDDSRSDE 779
             H+  D+ +   F    L +YI Y +    P++T++A++ LV+ Y  +RK  DD++   
Sbjct: 735 --HMKRDEAIEPPFSAEQLRRYIKYAR-TFKPILTKEARSYLVEKYKELRK--DDAQGFS 789

Query: 780 K---RITATTRQLESMIRLSEAHAKMRLSSTVDLEDVREAVRLMKSAI 824
           +   RI  T RQLESMIRLSEA A+      +    + EA  L++ +I
Sbjct: 790 RSSYRI--TVRQLESMIRLSEAIARANCVDEITPSFIAEAYDLLRQSI 835

>Kwal_27.12002
          Length = 833

 Score =  329 bits (844), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 220/618 (35%), Positives = 342/618 (55%), Gaps = 59/618 (9%)

Query: 277 DNQLEHELDEIESKFYK---VRPYNVETQK-------------GMRELNPNDIDKLISLK 320
           D++L  E+ E ES  +     R YN+  +               +R++  + +  LI+ +
Sbjct: 173 DDELMREIAEQESDLFPPKLTRRYNLYFKPLSSAYAKKWLQPLSVRQIRGDLLGNLITAR 232

Query: 321 GLVLRATPVIPDMKVAFFKCNICDHTMAVEIDRGVIQEPARCERVDC--NEANSMTLIHN 378
           G+V R + V P + V  + C+ C + +  E++       A C    C  N+      +  
Sbjct: 233 GIVTRVSDVKPSVMVNAYTCDQCGYEVFQEVNSRTFTPLAECTSEQCSQNQTKGQLFMST 292

Query: 379 RCS-FADKQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRAGDRIEVTGTFRSIPIKA 437
           R S F+  Q  K+QE  + VP G  P ++++ +   LV S   GD ++VTG +   P   
Sbjct: 293 RASKFSAFQECKIQEMSEQVPIGHIPRTLTIHINGALVRSLTPGDVVDVTGIYMPAPYTG 352

Query: 438 NSRQRVLKS--LYKTYIDVVHVKKVSNTRIGVDVSTIEQELLQNKLDNNDVEEVRQISDA 495
               + LK+  L +TY++  +V                    Q+K      E    I+  
Sbjct: 353 F---KALKAGLLTETYLEAQYV-------------------FQHKKKFATFE----ITPE 386

Query: 496 EIEKIKQVAQRPDLYDLLARSIAPSIYELDDVKKGILLQLXXXXXXXXXXXXRYRGDINI 555
              ++  +A++ D+Y+ LA+SIAP IY   DVKK +LL L            + RGDINI
Sbjct: 387 TEARVFNIARQGDVYNRLAKSIAPEIYGNLDVKKALLLLLVGGVDKKVGDGMKIRGDINI 446

Query: 556 LLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDSKQLVLESGALVLS 615
            L GDP  +KSQ+L+ + KI+PRGVYT+GKGSS VGLTA V +D  + ++VLE GALVLS
Sbjct: 447 CLMGDPGVAKSQLLKSICKISPRGVYTTGKGSSGVGLTAAVMKDPVTDEMVLEGGALVLS 506

Query: 616 DGGICCIDEFDKMSESTRSVLHEVMEQQTISVAKAGIITTLNARSSILASANPIGSRYNP 675
           D GICCIDEFDKM E  R+ +HEVMEQQTIS++KAGI TTLNAR+SILA+ANP+  RYNP
Sbjct: 507 DNGICCIDEFDKMDEGDRTAIHEVMEQQTISISKAGINTTLNARTSILAAANPLYGRYNP 566

Query: 676 NLPVTENIDLPPPLLSRFDLVYIILDKVDESTDRDLAKHLTSLYLEDKPAHVTTDDVLPI 735
            L   ENI+LP  LLSRFD+++++LD  +   D  LA+H+  +++ +K   +  + + P 
Sbjct: 567 RLSPLENINLPAALLSRFDILFLLLDTPNREDDEKLAEHVAFVHMHNKQPDLGFEPIEPS 626

Query: 736 DFLTQYINYVKQNVHPLVTEQAKNELVKAYVGMRKMGDDSRSDEKRIT---ATTRQLESM 792
           D + ++I Y K    P ++ +    +V++Y+ MR+  D  ++ + R +   AT R L ++
Sbjct: 627 D-MREFIAYAKTK-RPTMSSEVNEYVVQSYIRMRQ--DSKKAMDSRFSFGQATPRTLLAI 682

Query: 793 IRLSEAHAKMRLSSTVDLEDVREAVRLMKSAIKDYATDPKTGKIDMNLVQTGKSVIQRKL 852
           IRLS+  AK+R S  V+++D+ EA+RL++ + +    + K  + D N      ++I+   
Sbjct: 683 IRLSQGLAKLRFSDIVEVDDIEEALRLIQVSKESLYQENKKSREDDNPTTKIYTIIK--- 739

Query: 853 QEDLAREIIRILKEYPAD 870
             +LAR+   I +  P D
Sbjct: 740 --NLARDGPHIQQSLPYD 755

>Scas_721.36
          Length = 855

 Score =  330 bits (845), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 200/525 (38%), Positives = 306/525 (58%), Gaps = 38/525 (7%)

Query: 305 MRELNPNDIDKLISLKGLVLRATPVIPDMKVAFFKCNICDHTMAVEIDRGVIQEPARCER 364
           +RE+  + + +LI+++G+V R + V P + V  + C+ C + +  E+          C  
Sbjct: 227 VREIKGDFLGQLITVRGIVTRVSDVKPSVLVIAYTCDQCGYEVFQEVHSRTFTPLIDCTS 286

Query: 365 VDC--NEANSMTLIHNRCS-FADKQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRAG 421
            +C  N+      +  R S F+  Q +K+QE    VP G  P S+S+ V   LV S   G
Sbjct: 287 EECAQNQTKGQLFMSTRASKFSAFQEVKIQELSQQVPVGHIPRSLSIHVNGALVRSMTPG 346

Query: 422 DRIEVTGTFRSIPIKANSRQRVLKS--LYKTYIDVVHVKKVSNTRIGVDVSTIEQELLQN 479
           D ++V+G F   P       + LK+  L +TY++   V++        D+S+  ++    
Sbjct: 347 DIVDVSGIFLPSPYTGF---KALKAGLLTETYLEAQFVRQHKKKFASFDLSSGMED---- 399

Query: 480 KLDNNDVEEVRQISDAEIEKIKQVAQRPDLYDLLARSIAPSIYELDDVKKGILLQLXXXX 539
                              ++ ++  + D+Y+ +A+SIAP IY   DVKK +LL L    
Sbjct: 400 -------------------RVTEMIAQGDVYNRMAKSIAPEIYGNLDVKKALLLLLVGGV 440

Query: 540 XXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRD 599
                   + RGDIN+ L GDP  +KSQ+L+ + KI+PRGVYT+GKGSS VGLTA V +D
Sbjct: 441 DKKVGDGMKIRGDINVCLMGDPGVAKSQLLKAICKISPRGVYTTGKGSSGVGLTAAVMKD 500

Query: 600 VDSKQLVLESGALVLSDGGICCIDEFDKMSESTRSVLHEVMEQQTISVAKAGIITTLNAR 659
             + +++LE GALVL+D GICCIDEFDKM ES R+ +HEVMEQQTIS++KAGI TTLNAR
Sbjct: 501 PVTDEMILEGGALVLADNGICCIDEFDKMDESDRTAIHEVMEQQTISISKAGINTTLNAR 560

Query: 660 SSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYIILDKVDESTDRDLAKHLTSLY 719
           +SILA+ANP+  RYNP L   ENI+LP  LLSRFD+++++LD  +   D  LA+H+  ++
Sbjct: 561 ASILAAANPLYGRYNPRLSPLENINLPAALLSRFDILFLLLDTPNRENDEKLAEHVAYVH 620

Query: 720 LEDKPAHVTTDDVLPIDFLTQYINYVKQNVHPLVTEQAKNELVKAYVGMRKMGDDSRSDE 779
           +      +  + + P   + +YI + K    P++ E     +++AY+ +R+  D  R  +
Sbjct: 621 MHQSQPDLEFEPIEPAR-MREYIAFAKSK-RPVMNEAVNEYVIQAYIRLRQ--DSKREMD 676

Query: 780 KRIT---ATTRQLESMIRLSEAHAKMRLSSTVDLEDVREAVRLMK 821
            + +   AT R L  +IRLS+  AK+RLS TVD++DV EA+RL++
Sbjct: 677 SKFSFGQATPRTLLGIIRLSQGLAKLRLSDTVDIDDVEEALRLVR 721

>KLLA0D09262g 780273..782513 similar to sp|P29496 Saccharomyces
           cerevisiae YLR274w CDC46 cell division control protein,
           start by similarity
          Length = 746

 Score =  327 bits (837), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 215/696 (30%), Positives = 367/696 (52%), Gaps = 72/696 (10%)

Query: 169 RIIWGTNVSIQECA---NSFRNFLMSFKYKYRRVLDGKTDITDDEAEEELYYVKQLNEMR 225
           R++ G  +S  E +    SF++F++ F+                  +    Y +QL    
Sbjct: 12  RVLAGEELSSNENSEIIKSFKSFILEFRL-----------------DSNFVYREQLRNNL 54

Query: 226 ELGTSNLNLDARNLLAFKQTEELYYQLLNYPQEVISIMDQTIKDC---MVSLVVDNQLEH 282
            +    L+++  +L+ +   E+LY +L + P ++I + +Q I      +V L  D+ ++ 
Sbjct: 55  LVHKYFLDVNTEHLIGYN--EDLYKKLQDEPIDIIPLFEQAITQVAKRIVLLSQDSDIDP 112

Query: 283 ELDEIESKFYKVRPYNVETQKGMRELNPNDIDKLISLKGLVLRATPVIPDMKVAFFKCNI 342
           E         ++   +   +  +R L+ + + K++ + G+++ ++ +          C  
Sbjct: 113 ETALSNFPLCQLILNSSSMEIPLRSLDSDHVSKIVRITGIIISSSVLTSRATQLSLMCRS 172

Query: 343 CDHTMAVEIDRGVIQE------PARCERVDCNEANSMT---------LIHNRCSFADKQV 387
           C H   ++++            P  C     NE +            ++H    F D+Q 
Sbjct: 173 CKHMTTLKLNNFQNLNNNNVQLPRECLADRSNETDETAASCGPDPYLIVHESSQFIDQQF 232

Query: 388 IKLQETPDLVPDGQTPHSVSLCVYDELVDSCRAGDRIEVTGTF---RSIPIKANSRQRVL 444
           +KLQE P+ VP G+ P ++ +     L +    G R+ + G +   +S     NS     
Sbjct: 233 LKLQELPESVPIGELPRNLLMTCDRYLTNQVVPGTRVTIIGIYSIYQSKNKSINSSGNKA 292

Query: 445 KSLYKTYIDVVHVKKVSNTRIGVDVSTIEQELLQNKLDNNDVEEVRQISDAEIEKIKQVA 504
            ++   Y+ V+ +K +SN                N L+N+    +   S++E ++  +++
Sbjct: 293 VAIRNPYVKVIGIKHLSN----------------NPLNNS----LSMFSESEEQEFLELS 332

Query: 505 QRPDLYDLLARSIAPSIYELDDVKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPSTS 564
           QRPDLY+L A SIAPSIY   D+KK I+  L            R RGDIN+LL GDP T+
Sbjct: 333 QRPDLYELFANSIAPSIYGNTDIKKAIVCLLMGGSKKLLPDGMRLRGDINVLLLGDPGTA 392

Query: 565 KSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDSKQLVLESGALVLSDGGICCIDE 624
           KSQ+L++V K++P  VYTSGKGSSA GLTA V RD  +++  LE GA+VL+DGG+ CIDE
Sbjct: 393 KSQLLKFVEKVSPISVYTSGKGSSAAGLTASVQRDPTTREFYLEGGAMVLADGGVVCIDE 452

Query: 625 FDKMSESTRSVLHEVMEQQTISVAKAGIITTLNARSSILASANPIGSRYNPNLPVTENID 684
           FDKM +  R  +HE MEQQTIS+AKAGI T LN+R+S+LA+ANP+  RY+      ENID
Sbjct: 453 FDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPVYGRYDDLKSPGENID 512

Query: 685 LPPPLLSRFDLVYIILDKVDESTDRDLAKHLTSLYL-----EDKPAHVTTDDVLPIDFLT 739
               +LSRFD+++I+ D  +E+ D  +A H+ +++       D   +  +++ +PI+ + 
Sbjct: 513 FQTTILSRFDMIFIVKDDHNEARDIQIANHVMNIHTGRTQQNDPNDNSNSNNEIPIETMK 572

Query: 740 QYINYVKQNVHPLVTEQAKNELVKAYVGMRKMGDDS--RSDEK-RITATTRQLESMIRLS 796
           +Y++Y +    P ++ +A  +L   ++ +RK   +S   S+E+  I  T RQLE++IR++
Sbjct: 573 RYVSYCRLKCAPRLSPEAATKLSSHFITIRKQLQESERHSNERSSIPITVRQLEAIIRIT 632

Query: 797 EAHAKMRLSSTVDLEDVREAVRLMKSAIKDYAT-DP 831
           E+ AK+ L+     + V EA+RL +++  D A+ DP
Sbjct: 633 ESLAKLELNPVATEKHVDEAIRLFQASTMDAASQDP 668

>YBR202W (CDC47) [385] chr2 (625729..628266) Member of MCM/P1 family
           of proteins involved in DNA synthesis initiation [2538
           bp, 845 aa]
          Length = 845

 Score =  320 bits (820), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 205/560 (36%), Positives = 322/560 (57%), Gaps = 42/560 (7%)

Query: 305 MRELNPNDIDKLISLKGLVLRATPVIPDMKVAFFKCNICDHTMAVEIDRGVIQEPARCER 364
           +R++  + + +LI+++G++ R + V P ++V  + C+ C + +  E++       + C  
Sbjct: 227 VRQIKGDFLGQLITVRGIITRVSDVKPAVEVIAYTCDQCGYEVFQEVNSRTFTPLSECTS 286

Query: 365 VDC--NEANSMTLIHNRCS-FADKQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRAG 421
            +C  N+      +  R S F+  Q  K+QE    VP G  P S+++ V   LV S   G
Sbjct: 287 EECSQNQTKGQLFMSTRASKFSAFQECKIQELSQQVPVGHIPRSLNIHVNGTLVRSLSPG 346

Query: 422 DRIEVTGTFRSIPIKANSRQRVLKS--LYKTYIDVVHVKKVSNTRIGVDVSTIEQELLQN 479
           D ++VTG F   P       + LK+  L +TY++   V++         +++        
Sbjct: 347 DIVDVTGIFLPAPYTGF---KALKAGLLTETYLEAQFVRQHKKKFASFSLTS-------- 395

Query: 480 KLDNNDVEEVRQISDAEIEKIKQVAQRPDLYDLLARSIAPSIYELDDVKKGILLQLXXXX 539
                DVEE          ++ ++    D+Y+ LA+SIAP IY   DVKK +LL L    
Sbjct: 396 -----DVEE----------RVMELITSGDVYNRLAKSIAPEIYGNLDVKKALLLLLVGGV 440

Query: 540 XXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRD 599
                   + RGDIN+ L GDP  +KSQ+L+ + KI+PRGVYT+GKGSS VGLTA V +D
Sbjct: 441 DKRVGDGMKIRGDINVCLMGDPGVAKSQLLKAICKISPRGVYTTGKGSSGVGLTAAVMKD 500

Query: 600 VDSKQLVLESGALVLSDGGICCIDEFDKMSESTRSVLHEVMEQQTISVAKAGIITTLNAR 659
             + +++LE GALVL+D GICCIDEFDKM ES R+ +HEVMEQQTIS++KA I T   AR
Sbjct: 501 PVTDEMILEGGALVLADNGICCIDEFDKMDESDRTAIHEVMEQQTISISKAVINTNPGAR 560

Query: 660 SSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYIILDKVDESTDRDLAKHLTSLY 719
           +SILA+ANP+  R NP L   +NI+LP  LLSRFD+++++LD      D  LA+H+T ++
Sbjct: 561 TSILAAANPLYGRINPRLSPLDNINLPAALLSRFDILFLMLDIPSRDDDEKLAEHVTYVH 620

Query: 720 LEDKPAHVTTDDVLPID--FLTQYINYVKQNVHPLVTEQAKNELVKAYVGMRKMGDDSRS 777
           + +K   +   D  P++   + +YI Y K    P+++E   + +V+AY+ +R+  D  R 
Sbjct: 621 MHNKQPDL---DFTPVEPSKMREYIAYAKTK-RPVMSEAVNDYVVQAYIRLRQ--DSKRE 674

Query: 778 DEKRIT---ATTRQLESMIRLSEAHAKMRLSSTVDLEDVREAVRLMKSAIKDYATDPKTG 834
            + + +   AT R L  +IRLS+A AK+RL+  VD++DV EA+RL++ + +    +    
Sbjct: 675 MDSKFSFGQATPRTLLGIIRLSQALAKLRLADMVDIDDVEEALRLVRVSKESLYQETNKS 734

Query: 835 KIDMNLVQTGKSVIQRKLQE 854
           K D +      ++I++ LQE
Sbjct: 735 KEDESPTTKIFTIIKKMLQE 754

>Sklu_2098.4 YBR202W, Contig c2098 6426-8966 reverse complement
          Length = 846

 Score =  317 bits (812), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 216/601 (35%), Positives = 329/601 (54%), Gaps = 60/601 (9%)

Query: 277 DNQLEHELDEIESKFYKVR---PYNVETQK-------------GMRELNPNDIDKLISLK 320
           D+ L  EL E ES  +  R    YN+  +               +RE+    + +LI+++
Sbjct: 179 DDGLMRELAEEESNLFPARLTRRYNLYFRPLTAMYHSKYSAPLSVREIKGRYLGQLITVR 238

Query: 321 GLVLRATPVIPDMKVAFFKCNICDHTMAVEIDRGVIQEPARCERVDC--NEANSMTLIHN 378
           G++ R + V P + V  + C+ C   +  E++         C    C  N+      +  
Sbjct: 239 GIITRVSDVKPAVLVNAYTCDQCGFEVFQEVNSRTFTPLIECTSEQCSQNQTKGQLFMST 298

Query: 379 RCS-FADKQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRAGDRIEVTGTFRSIPIKA 437
           R S F+  Q  K+QE    V  G  P ++++ V   LV S   GD ++VTG +   P   
Sbjct: 299 RASKFSAFQECKIQELSQQVRIGHIPRTLTIHVNGSLVRSITPGDVVDVTGIYLPSPYTG 358

Query: 438 NSRQRVLKS--LYKTYIDVVHVKKVSNTRIGVDVSTIEQELLQNKLDNNDVEEVRQISDA 495
               + LK+  L +TY+ + +V++        +++                         
Sbjct: 359 F---KALKAGLLTETYLSMQYVRQHKKKFASFEIT------------------------P 391

Query: 496 EIE-KIKQVAQRPDLYDLLARSIAPSIYELDDVKKGILLQLXXXXXXXXXXXXRYRGDIN 554
           E+E  + ++A + D+Y+ LA+SIAP IY   DVKK +LL L            + RGDIN
Sbjct: 392 EVESNVMEIASQGDVYNRLAKSIAPEIYGHLDVKKALLLLLVGGVDKKVGDGMKIRGDIN 451

Query: 555 ILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDSKQLVLESGALVL 614
           I L GDP  +KSQ+L+ + KI+PR VYT+GKGSS VGLTA V RD  + ++VLE GALVL
Sbjct: 452 ICLMGDPGVAKSQLLKTICKISPRSVYTTGKGSSGVGLTAAVMRDPVTDEMVLEGGALVL 511

Query: 615 SDGGICCIDEFDKMSESTRSVLHEVMEQQTISVAKAGIITTLNARSSILASANPIGSRYN 674
           +D GICCIDEFDKM E  R+ +HEVMEQQTIS++KAGI TTLNAR+SILA+ANP+  RYN
Sbjct: 512 ADNGICCIDEFDKMDEGDRTAIHEVMEQQTISISKAGINTTLNARASILAAANPLYGRYN 571

Query: 675 PNLPVTENIDLPPPLLSRFDLVYIILDKVDESTDRDLAKHLTSLYLEDKPAHVTTDDVLP 734
           P L   +NI+LP  LLSRFD+++++LD  +   D  LA+H+  +++ +K  H T  D  P
Sbjct: 572 PRLSPLDNINLPAALLSRFDVMFLMLDTPNREDDEKLAEHVAYVHMHNK--HPTL-DFTP 628

Query: 735 ID--FLTQYINYVKQNVHPLVTEQAKNELVKAYVGMRKMGDDSRSDEKRIT---ATTRQL 789
           I+   + ++I + K    P + ++    LV++Y+ MR+  D  R  + + +   AT R L
Sbjct: 629 IEPSRMREFIAFAKTK-RPTMGQEVNEYLVQSYIRMRQ--DSKREMDSKFSFGQATPRTL 685

Query: 790 ESMIRLSEAHAKMRLSSTVDLEDVREAVRLMKSAIKDYATDPKTGKIDMNLVQTGKSVIQ 849
             +IRLS+A AK+R S +V+ +DV EA+RL++ + +    D    K D N      ++I+
Sbjct: 686 LGVIRLSQALAKLRFSDSVEADDVEEALRLIQVSKESLYQDGNKRKNDENPTTKIYTIIK 745

Query: 850 R 850
           +
Sbjct: 746 K 746

>Sklu_1863.1 YEL032W, Contig c1863 2885-5749
          Length = 954

 Score =  318 bits (816), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 203/587 (34%), Positives = 314/587 (53%), Gaps = 90/587 (15%)

Query: 306 RELNPNDIDKLISLKGLVLRATPVIPDM--------KVAFFKCNICDHTMAVEIDRGVIQ 357
           R LN + ++KLIS++G+V + + V P +        K   F     D+  A       I 
Sbjct: 143 RTLNSHHLNKLISIEGIVTKTSLVRPKLIRSVHYADKTGRFHYR--DYRDATTTLTTQIP 200

Query: 358 EPARCERVDCNEANSMTLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLCVYDELVDS 417
            PA     D  E N +T  +   ++ D Q I +QE P+  P GQ P S+ + + ++LVD 
Sbjct: 201 TPAIYPTEDP-EGNKLTTEYGYSTYIDHQRITVQEMPEKAPPGQLPRSIDVILDEDLVDK 259

Query: 418 CRAGDRIEVTGTFRSIPIKANSRQRVLKSLYKTYIDVVHVKKVSNTRIGVDVSTIEQELL 477
            + GDRI + G +              KS+    ++    K+ SN   G     +   + 
Sbjct: 260 TKPGDRINIVGVY--------------KSMGAGGLNGAATKEQSNALSGFRTLILGNTVY 305

Query: 478 QNKLDNNDVEEVRQISDAEIEKIKQVAQRPDLYDLLARSIAPSIYELDDVKKGILLQLXX 537
                +  V   + +SD++I  I +++++ D+++++++S+APSIY  + +KK ILL L  
Sbjct: 306 PLHARSTGVSAKQNLSDSDIRNINKLSKKSDIFEMMSQSLAPSIYGHEQIKKAILLMLLG 365

Query: 538 XXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVT 597
                       RGDIN+L+ GDPST+KSQ+L++V   A   + T+G+GSS VGLTA VT
Sbjct: 366 GVEKNLENGSHLRGDINLLMVGDPSTAKSQLLRFVLNTASLAIATTGRGSSGVGLTAAVT 425

Query: 598 RDVDSKQLVLESGALVLSDGGICCIDEFDKMSESTRSVLHEVMEQQTISVAKAGIITTLN 657
            D ++ +  LE+GA+VL+D GI CIDEFDKMS+  R  +HEVMEQQT+++AKAGI TTLN
Sbjct: 426 MDKETGERRLEAGAMVLADRGIVCIDEFDKMSDVDRVAIHEVMEQQTVTIAKAGIHTTLN 485

Query: 658 ARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYIILDKVDESTDRDLAKH--- 714
           AR S++A+ANP+  +Y+ N    +NI LP  LLSRFDL++++ D ++E  DR +++H   
Sbjct: 486 ARCSVIAAANPVFGQYDVNRDPHQNIALPDSLLSRFDLLFVVTDDINEIRDRAISEHVLR 545

Query: 715 ----LTSLYLEDKPAH--------VTTDDV------------------------------ 732
               L   YLE +P          V  DD+                              
Sbjct: 546 THRYLPPGYLEGEPIREAINLSLAVGDDDIEQMQDDEDDDEEGGKVFEKFNPLLHAGAKL 605

Query: 733 -----------LP----IDFLTQYINYVKQNVHPLVTEQAKNELVKAYVGMRKMGDDSRS 777
                      +P    I FL +Y+ Y K+ + P++T++A + +VK Y  +R   +DS +
Sbjct: 606 AKNRGNHHGSEIPQIVCIPFLRKYVQYAKERIAPVLTQEAIDVIVKTYSDLR---NDSNT 662

Query: 778 DEKRITATTRQLESMIRLSEAHAKMRLSSTVDLEDVREAVRLMKSAI 824
            +  ITA  R LE++IRLS AHAK+RLS  V+ +D R A  L++ A+
Sbjct: 663 KKSPITA--RTLETLIRLSSAHAKVRLSKIVERQDSRVAANLLRFAL 707

>YLR274W (CDC46) [3667] chr12 (691557..693884) Member of the MCM/P1
           family, component of the MCM complex that binds at ARS
           elements to initiate DNA replication [2328 bp, 775 aa]
          Length = 775

 Score =  313 bits (801), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 214/730 (29%), Positives = 357/730 (48%), Gaps = 82/730 (11%)

Query: 180 ECANSFRNFLMSFKYKYRRVLDGKTDITDDEAEEELYYVKQLNEMRELGTSNLNLDARNL 239
           E   SF+NF++ F+                  + +  Y  QL     +   +L ++  +L
Sbjct: 26  EIIKSFKNFILEFRL-----------------DSQFIYRDQLRNNILVKNYSLTVNMEHL 68

Query: 240 LAFKQTEELYYQLLNYPQEVISIMDQTIKDCMVSLVV----------DNQLEHELDEIES 289
           + +   E++Y +L + P ++I + +  I      + +          D   E+   + +S
Sbjct: 69  IGYN--EDIYKKLSDEPSDIIPLFETAITQVAKRISILSRAQSANNNDKDPENTSMDTDS 126

Query: 290 KFYKVRPY------NVETQKGMRELNPNDIDKLISLKGLVLRATPVIPDMKVAFFKCNIC 343
                 P       +   Q  +R+L+   + K++ L G+++  + +          C  C
Sbjct: 127 LLLNSLPTFQLILNSNANQIPLRDLDSEHVSKIVRLSGIIISTSVLSSRATYLSIMCRNC 186

Query: 344 DHTMAVEIDR------GVIQEPARC------ERVDCNEAN-------------SMTLIHN 378
            HT ++ I+         +  P  C      E    NE+N                +IH 
Sbjct: 187 RHTTSITINNFNSITGNTVSLPRSCLSTIESESSMANESNIGDESTKKNCGPDPYIIIHE 246

Query: 379 RCSFADKQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRAGDRIEVTGTFRSIPIKAN 438
              F D+Q +KLQE P+LVP G+ P ++++     L +    G R+ + G +     K  
Sbjct: 247 SSKFIDQQFLKLQEIPELVPVGEMPRNLTMTCDRYLTNKVIPGTRVTIVGIYSIYNSKNG 306

Query: 439 SRQRVLKSLYKTYIDVVHVKKVSNTRIGVDVSTIEQELLQNKLDNNDVEEVRQISDAEIE 498
           +               +    +    I  DV T           ++    V   ++ E E
Sbjct: 307 AGSGRSGGGNGGSGVAIRTPYIKILGIQSDVET-----------SSIWNSVTMFTEEEEE 355

Query: 499 KIKQVAQRPDLYDLLARSIAPSIYELDDVKKGILLQLXXXXXXXXXXXXRYRGDINILLC 558
           +  Q+++ P LY++L  SIAPSI+  +D+KK I+  L            R RGDIN+LL 
Sbjct: 356 EFLQLSRNPKLYEILTNSIAPSIFGNEDIKKAIVCLLMGGSKKILPDGMRLRGDINVLLL 415

Query: 559 GDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDSKQLVLESGALVLSDGG 618
           GDP T+KSQ+L++V K++P  VYTSGKGSSA GLTA V RD  +++  LE GA+VL+DGG
Sbjct: 416 GDPGTAKSQLLKFVEKVSPIAVYTSGKGSSAAGLTASVQRDPMTREFYLEGGAMVLADGG 475

Query: 619 ICCIDEFDKMSESTRSVLHEVMEQQTISVAKAGIITTLNARSSILASANPIGSRYNPNLP 678
           + CIDEFDKM +  R  +HE MEQQTIS+AKAGI T LN+R+S+LA+ANPI  RY+    
Sbjct: 476 VVCIDEFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIYGRYDDLKS 535

Query: 679 VTENIDLPPPLLSRFDLVYIILDKVDESTDRDLAKHLTSLYLEDKPAHVTTDD----VLP 734
             +NID    +LSRFD+++I+ D  +E  D  +A H+ +++  +  A     +     + 
Sbjct: 536 PGDNIDFQTTILSRFDMIFIVKDDHNEERDISIANHVINIHTGNANAMQNQQEENGSEIS 595

Query: 735 IDFLTQYINYVKQNVHPLVTEQAKNELVKAYVGMRK---MGDDSRSDEKRITATTRQLES 791
           I+ + +YI Y +    P ++ QA  +L   +V +RK   + +   ++   I  T RQLE+
Sbjct: 596 IEKMKRYITYCRLKCAPRLSPQAAEKLSSNFVTIRKQLLINELESTERSSIPITIRQLEA 655

Query: 792 MIRLSEAHAKMRLSSTVDLEDVREAVRLMKSAIKDYATDPKTGKIDMNLVQTGKSVIQ-R 850
           +IR++E+ AK+ LS       V EA+RL +++  D A+    G ++     +G S+ + R
Sbjct: 656 IIRITESLAKLELSPIAQERHVDEAIRLFQASTMDAASQDPIGGLNQ---ASGTSLSEIR 712

Query: 851 KLQEDLAREI 860
           + +++L R +
Sbjct: 713 RFEQELKRRL 722

>Scas_710.21
          Length = 874

 Score =  306 bits (784), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 201/652 (30%), Positives = 330/652 (50%), Gaps = 73/652 (11%)

Query: 217 YVKQLNEMRELGTSNLNLDARNLLAFKQTEELYYQLLNYPQEVISIMDQTIKDCMVSLVV 276
           Y  ++  + E+   +L ++ R+L   K    L+  L   P+E++ I D      +V++  
Sbjct: 229 YGARIRTLGEMNAESLEVNYRHLAESKAILALF--LAKCPEEMLKIFD------LVAMEA 280

Query: 277 DNQLEHELDEIESKFYKVRPYNVETQKGMRELNPNDIDKLISLKGLVLRATPVIPDMKVA 336
                 +   I S+ + VR  +  T   +REL  +++  L+ + G+V R T V P +K  
Sbjct: 281 TELHYPDYARIHSEIH-VRISDFPTIHSLRELRESNLSSLVRVTGVVTRRTGVFPQLKYV 339

Query: 337 FFKCNICDHTMAVEI-DRGVIQEPARCERVDCNEANSMTLIHNRCSFADKQVIKLQETPD 395
            F C  C   +     D     + + C  V+C      T+   +  + + Q I LQE+P 
Sbjct: 340 KFNCIKCGTILGPFFQDSNEEIKISYC--VNCKSKGPFTVNGEKTVYRNYQRITLQESPG 397

Query: 396 LVPDGQTPHSVSLCVYDELVDSCRAGDRIEVTGTFRSIPIKANSRQRVLKSLYKTYIDVV 455
            VP G+ P    + +  +LVD  + G+ +EVTG +++     N   +    ++ T ++  
Sbjct: 398 TVPAGRLPRHREVILLADLVDVSKPGEEVEVTGIYKN-NYDGNLNAKNGFPVFATILEAN 456

Query: 456 HVKKVSNTRIGVDVSTIEQELLQNKLDNNDVEEVRQISDAEIEKIKQVAQRPDLYDLLAR 515
            VK+    R G   +  E+ L           +V   ++ E  + +++++   + D +  
Sbjct: 457 SVKR----REGNSANEGEEGL-----------DVFGWTEEEEREFRKISRDRGIIDKIIS 501

Query: 516 SIAPSIYELDDVKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKI 575
           S+APSIY   D+K  +   L              RGDIN+LL GDP T+KSQIL+YV K 
Sbjct: 502 SMAPSIYGHRDIKTAVACSLFGGVPKNVNGKHSIRGDINVLLLGDPGTAKSQILKYVEKT 561

Query: 576 APRGVYTSGKGSSAVGLTAYVTRDVDSKQLVLESGALVLSDGGICCIDEFDKMSESTRSV 635
           A R V+ +G+G+SAVGLTA V +D  +K+  LE GALVL+D G+C IDEFDKM++  R+ 
Sbjct: 562 AHRAVFATGQGASAVGLTASVRKDPITKEWTLEGGALVLADKGVCLIDEFDKMNDQDRTS 621

Query: 636 LHEVMEQQTISVAKAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDL 695
           +HE MEQQ+IS++KAGI+TTL AR SI+A+ANP G RYN  +P+ +N+ L  P+LSRFD+
Sbjct: 622 IHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNSTIPLAQNVSLTEPILSRFDI 681

Query: 696 VYIILDKVDESTDRDLAKHLTSLYLEDKPAHV-------------------TTDDVLPI- 735
           + ++ D VDE  D  LA  +   +L   P ++                     D V P+ 
Sbjct: 682 LCVVRDLVDEEADERLATFVVDSHLRSHPENIDGNLTGEGQPDGDENMDGNNEDGVEPLS 741

Query: 736 ---------------------DFLTQYINYVKQNVHPLVTEQAKNELVKAYVGMRKMGDD 774
                                + L +YI+Y +  +HP + +   +++ + Y  +R+    
Sbjct: 742 ARQRRLQSQKKKEEEISPIPQELLMKYIHYARTKIHPKLHQMDMDKVSRVYADLRRESIS 801

Query: 775 SRSDEKRITATTRQLESMIRLSEAHAKMRLSSTVDLEDVREAVRLMKSAIKD 826
           + S       T R LES++R++E+ AKMRLS  V   D+  A++++  +  D
Sbjct: 802 TGS----FPITVRHLESILRIAESFAKMRLSEFVSSWDLDRAIKVVVDSFVD 849

>CAGL0J04444g 417656..420295 highly similar to sp|P29469
           Saccharomyces cerevisiae YBL023c MCM2, start by
           similarity
          Length = 879

 Score =  306 bits (784), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 199/645 (30%), Positives = 329/645 (51%), Gaps = 66/645 (10%)

Query: 217 YVKQLNEMRELGTSNLNLDARNLLAFKQTEELYYQLLNYPQEVISIMDQTIKDCMVSLVV 276
           Y  ++  + E+ + +L ++ R+L   K    L+  L   P+E++ I D      +V++  
Sbjct: 244 YGARIRVLGEMNSESLEVNFRHLAESKAILALF--LAKCPEEMLKIFD------LVAMEA 295

Query: 277 DNQLEHELDEIESKFYKVRPYNVETQKGMRELNPNDIDKLISLKGLVLRATPVIPDMKVA 336
                 +   I S+ + VR  +  T   +REL  +++  L+ + G+V R T V P +K  
Sbjct: 296 TELHYPDYSRIHSEIH-VRISDFPTIHNLRELRQSNLSTLVRVTGVVTRRTGVFPQLKYV 354

Query: 337 FFKCNICDHTMAVEI-DRGVIQEPARCERVDCNEANSMTLIHNRCSFADKQVIKLQETPD 395
            F C  C   +     D     + + C   +C      ++   +  + + Q I LQE P 
Sbjct: 355 KFNCLKCGSILGPFFQDSNEEIKISFC--TNCKSKGPFSINGEKTVYRNYQRITLQEAPG 412

Query: 396 LVPDGQTPHSVSLCVYDELVDSCRAGDRIEVTGTFRSIPIKANSRQRVLKSLYKTYIDVV 455
            VP G+ P    + +  +LVD  + G+ IEVTG +++     N   +    ++ T I+  
Sbjct: 413 TVPAGRLPRHREVILLADLVDVSKPGEEIEVTGIYKN-NYDGNLNAKNGFPVFATIIEAN 471

Query: 456 HVKKVSNTRIGVDVSTIEQELLQNKLDNNDVEEVRQISDAEIEKIKQVAQRPDLYDLLAR 515
            V++                 L N  +N +   V   ++ E  + +++++   + D +  
Sbjct: 472 AVRRREGN-------------LAN--ENEEGLNVFSWTEEEEREFRKLSKDRGIVDKIIA 516

Query: 516 SIAPSIYELDDVKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKI 575
           S+APSIY   D+K  +   L              RGDIN+L+ GDP T+KSQIL+YV K 
Sbjct: 517 SMAPSIYGHKDIKTAVACSLFSGVPKNINGKHAIRGDINVLVLGDPGTAKSQILKYVEKT 576

Query: 576 APRGVYTSGKGSSAVGLTAYVTRDVDSKQLVLESGALVLSDGGICCIDEFDKMSESTRSV 635
           A R V+ +G+G+SAVGLTA V +D  +K+  LE GALVL+D G+C IDEFDKM++  R+ 
Sbjct: 577 AHRAVFATGQGASAVGLTASVRKDPITKEWTLEGGALVLADKGVCLIDEFDKMNDQDRTS 636

Query: 636 LHEVMEQQTISVAKAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDL 695
           +HE MEQQ+IS++KAGI+TTL AR SI+A+ANP G RYN  LP+++N+ L  P+LSRFD+
Sbjct: 637 IHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNSTLPLSQNVSLTEPILSRFDI 696

Query: 696 VYIILDKVDESTDRDLAKHLTSLYLEDKPAHVTTDDV----------------------- 732
           + ++ D VDE +D  LA  +   ++   P + + DD                        
Sbjct: 697 LCVVRDVVDEESDERLASFVVDSHVRSHPGYDSIDDEEGKDGEQKNDDDIQLSNRQKRAE 756

Query: 733 -----------LPIDFLTQYINYVKQNVHPLVTEQAKNELVKAYVGMRKMGDDSRSDEKR 781
                      +P + L +YI+Y +  V+P + +   +++ K Y  +R+    + S    
Sbjct: 757 RQRKKEEEISPIPQELLIKYIHYARTKVYPRLHQMDMDKVSKVYADLRRESITTGS---- 812

Query: 782 ITATTRQLESMIRLSEAHAKMRLSSTVDLEDVREAVRLMKSAIKD 826
              T R LES++R++E+ AKMRLS  V   D+  A++++  +  D
Sbjct: 813 FPITVRHLESILRIAESFAKMRLSEFVSSWDLDRAIKVVVDSFVD 857

>KLLA0E22330g 1981275..1984070 similar to sp|P24279 Saccharomyces
           cerevisiae YEL032w MCM3 replication initiation protein,
           start by similarity
          Length = 931

 Score =  305 bits (780), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 200/587 (34%), Positives = 306/587 (52%), Gaps = 93/587 (15%)

Query: 306 RELNPNDIDKLISLKGLVLRATPVIPDMKVAFFKCNICDHTM------AVEIDRGVIQEP 359
           R LN   ++KLIS++G+V R + V P +  +        H        A       +  P
Sbjct: 148 RTLNSTHLNKLISVEGIVTRTSLVRPKLLRSVHYAQTTGHHHYRDYRDATTTLTTSVPTP 207

Query: 360 ARCERVDCNEANSMTLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCR 419
           A     D  E N +   +  C + D Q I +QE P+  P GQ P S+ + + D+LVD  +
Sbjct: 208 AIYPEED-QEGNKLVTEYGFCHYMDHQRITVQEMPEKAPPGQLPRSIDVILDDDLVDKTK 266

Query: 420 AGDRIEVTGTFRSIPIKA-------NSRQRVLKSLYKTYIDVVHVKKVSNTRIGVDVSTI 472
            GDRI + G ++S+           N +     S ++T +            IG  V  +
Sbjct: 267 PGDRINIVGVYKSLGAGGLTGGSNNNDKGNGALSGFRTVV------------IGNTVYPL 314

Query: 473 EQELLQNKLDNNDVEEVRQISDAEIEKIKQVAQRPDLYDLLARSIAPSIYELDDVKKGIL 532
                     +  V  V  +SD +I  I +++   +++D L++S+APSIY  + +KK IL
Sbjct: 315 HAR-------STGVSAVETLSDNDIRNINKLSMHDNIFDTLSQSLAPSIYGHEHIKKAIL 367

Query: 533 LQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGL 592
           L L              RGDINIL+ GDPST+KSQ+L++V   A   + T+G+GSS VGL
Sbjct: 368 LMLMGGVEKNLPNGSHLRGDINILMVGDPSTAKSQMLRFVLNTAALAIATTGRGSSGVGL 427

Query: 593 TAYVTRDVDSKQLVLESGALVLSDGGICCIDEFDKMSESTRSVLHEVMEQQTISVAKAGI 652
           TA VT D ++ +  LE+GA+VL+D GI CIDEFDKMS+  R  +HEVMEQQT+++AKAGI
Sbjct: 428 TAAVTTDKETGERRLEAGAMVLADRGIVCIDEFDKMSDVDRVAIHEVMEQQTVTIAKAGI 487

Query: 653 ITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYIILDKVDESTDRDLA 712
            TTLNAR S++A+ANP+  +Y+ N    +NI LP  LLSRFDL++++ D +++  DR ++
Sbjct: 488 HTTLNARCSVIAAANPVFGQYDVNKDPHKNIALPDSLLSRFDLLFVVTDDINDIRDRAIS 547

Query: 713 KH-------LTSLYLEDKPAHVTTD----------------------------------- 730
           +H       L   YLE +P     +                                   
Sbjct: 548 EHVLRTHRYLPPGYLEGEPVREQINLSLAVGEDIENEEEDDDEDVVFEKFNPLLHAGAKL 607

Query: 731 -------------DVLPIDFLTQYINYVKQNVHPLVTEQAKNELVKAYVGMRKMGDDSRS 777
                         ++ I F+ +YI Y K+ + P +T++A + ++K+Y  +R   +D  +
Sbjct: 608 AKNRGDSNGSELPQIVAIPFIRKYIQYAKERIIPQLTQEAVDVIIKSYSNLR---NDQNT 664

Query: 778 DEKRITATTRQLESMIRLSEAHAKMRLSSTVDLEDVREAVRLMKSAI 824
            +  ITA  R LE++IRLS AHAK+RLS  V+LED + A +L++ A+
Sbjct: 665 KKSPITA--RTLETLIRLSSAHAKVRLSKKVELEDAKVATQLLRFAL 709

>AFR178W [3370] [Homologous to ScYBL023C (MCM2) - SH]
           complement(763632..766289) [2658 bp, 885 aa]
          Length = 885

 Score =  303 bits (776), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 209/685 (30%), Positives = 341/685 (49%), Gaps = 82/685 (11%)

Query: 172 WGTNVSI-QECANSFRNFLMSFKYKYRRVLDGKTDITDDEAEEELYYVKQLNEMRELGTS 230
           W T  ++ +  A   ++FL+ +  +Y     GK+            Y  ++  + EL + 
Sbjct: 216 WITQPNVARTIARELKSFLLEYTDEY-----GKS-----------VYGARIRTLGELNSE 259

Query: 231 NLNLDARNLLAFKQTEELYYQLLNYPQEVISIMDQTIKDCMVSLVVDNQLEH-ELDEIES 289
           +L ++ R+L   K    L+  L   P+E++ I D    +         QL + E   I S
Sbjct: 260 SLEVNYRHLAESKAILALF--LARCPEEMLKIFDTVAMEA-------TQLHYPEYTRIHS 310

Query: 290 KFYKVRPYNVETQKGMRELNPNDIDKLISLKGLVLRATPVIPDMKVAFFKCNICDHTMAV 349
           + + VR  +  T   +REL   +++ L+ + G+V R T V P +K   F C  C   +  
Sbjct: 311 EIH-VRISDFPTIHNLRELREANLNSLVRVTGVVTRRTGVFPQLKYVKFNCLKCGSILGP 369

Query: 350 EI-DRGVIQEPARCERVDCNEANSMTLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSL 408
              D     + + C   +C           +  + + Q + LQE+P  VP G+ P    +
Sbjct: 370 YYQDSNEEIKISFC--TNCRSKGPFRTNMEKTLYRNYQRLTLQESPGTVPAGRLPRHREV 427

Query: 409 CVYDELVDSCRAGDRIEVTGTFRSIPIKANSRQRVLKSLYKTYIDVVHVKKVSNTRIGVD 468
            +  +LVD  + G+ +EVTG +++     N   R    ++ T ++   +K+         
Sbjct: 428 ILLWDLVDVAKPGEEVEVTGIYKNT-YDGNLNARNGFPVFATVLEANSIKRR-------- 478

Query: 469 VSTIEQELLQNKLDNNDVEEVRQISDAEIEKIKQVAQRPDLYDLLARSIAPSIYELDDVK 528
               E  L       ++  +V   ++ E  + +++++   + D +  SIAPSIY   D+K
Sbjct: 479 ----EGGLHSGDDAGDEGLDVFGWTEEEEREFRKMSRDRGIIDKIISSIAPSIYGHRDIK 534

Query: 529 KGILLQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSS 588
             +   L              RGDIN+LL GDP T+KSQIL+YV K A R V+ +G+G+S
Sbjct: 535 TAVACSLFGGVPKNVNGKHSIRGDINVLLLGDPGTAKSQILKYVEKTAHRAVFATGQGAS 594

Query: 589 AVGLTAYVTRDVDSKQLVLESGALVLSDGGICCIDEFDKMSESTRSVLHEVMEQQTISVA 648
           AVGLTA V +D  +K+  LE GALVL+D G+C IDEFDKM++  R+ +HE MEQQ+IS++
Sbjct: 595 AVGLTASVRKDPITKEWTLEGGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISIS 654

Query: 649 KAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYIILDKVDESTD 708
           KAGI+TTL AR SI+A+ANP G RYN  LP+++N+DL  P+LSRFD++ ++ D VDE +D
Sbjct: 655 KAGIVTTLQARCSIIAAANPNGGRYNSTLPLSQNVDLTEPILSRFDILCVVRDLVDEESD 714

Query: 709 RDLAKHLTSLYLEDKP---------------AHVTTDDV-------------------LP 734
             LA  +   ++   P               A   T  +                   +P
Sbjct: 715 ERLATFVVDSHIRSHPESDIHQEPADEDMEEADAGTAALSNRQKKLKRHRDKEGEISPIP 774

Query: 735 IDFLTQYINYVKQNVHPLVTEQAKNELVKAYVGMRKMGDDSRSDEKRITATTRQLESMIR 794
            + L +YI+Y +  V+P + +    ++ K Y  +R+    + S       T R LES++R
Sbjct: 775 QEVLMKYIHYARTKVNPKLHQMDMGKVSKVYADLRRESITTGS----FPITVRHLESILR 830

Query: 795 LSEAHAKMRLSSTVDLEDVREAVRL 819
           ++E+ AKMRLS  V   D+  A+++
Sbjct: 831 IAESFAKMRLSEFVSSWDLDRAIKV 855

>KLLA0F12584g complement(1165710..1168343) similar to sp|P29469
           Saccharomyces cerevisiae YBL023c MCM2 member of the
           MCM2P, MCM3P, CDC46P family, start by similarity
          Length = 877

 Score =  301 bits (770), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 201/643 (31%), Positives = 329/643 (51%), Gaps = 71/643 (11%)

Query: 217 YVKQLNEMRELGTSNLNLDARNLLAFKQTEELYYQLLNYPQEVISIMDQTIKDCMVSLVV 276
           Y  ++  + E+ + +L ++ R+L+  K    L+  L   P+E++ I D    +       
Sbjct: 237 YGARIRTLGEMNSESLEVNYRHLVESKAILALF--LAKSPEEMLKIFDTVAMEA------ 288

Query: 277 DNQLEH-ELDEIESKFYKVRPYNVETQKGMRELNPNDIDKLISLKGLVLRATPVIPDMKV 335
             QL + +   I S+ + VR  +  +   +R L    ++ L+ + G+V R T V P +K 
Sbjct: 289 -TQLHYPDYTRIHSEIH-VRISDFPSILNLRALRETHLNSLVRVSGVVTRRTGVFPQLKY 346

Query: 336 AFFKCNICDHTMAVEI-DRGVIQEPARCERVDCNEANSMTLIHNRCSFADKQVIKLQETP 394
             F C  C  T+     D     + + C   +C       +   +  + + Q I +QE+P
Sbjct: 347 VKFNCLKCGATLGPYYQDSNEEIKISFC--TNCRSKGPFRINMEKTLYRNYQRITIQESP 404

Query: 395 DLVPDGQTPHSVSLCVYDELVDSCRAGDRIEVTGTFRSIPIKANSRQRVLKSLYKTYIDV 454
             VP G+ P    + +  +LVD  + G+ +EVTG +++     N   +    ++ T ++ 
Sbjct: 405 GSVPAGRLPRHREVILLWDLVDIAKPGEEVEVTGIYKNT-YDGNLNAKNGFPVFATVLEA 463

Query: 455 VHVKKVSNTRIGVDVSTIEQELLQNKLDNNDVEEVRQISDAEIEKIKQVAQRPDLYDLLA 514
             VK+              +  L +  ++  ++      D E E  +++++   + D + 
Sbjct: 464 NSVKR-------------REGGLHDGDEHEGLDAFSWTEDEERE-FRKMSRDRGIIDKII 509

Query: 515 RSIAPSIYELDDVKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHK 574
            S+APSIY   D+K  I   L              RGDINILL GDP T+KSQIL+YV K
Sbjct: 510 SSMAPSIYGHRDIKTAIACSLFGGVPKNINGKHSIRGDINILLLGDPGTAKSQILKYVEK 569

Query: 575 IAPRGVYTSGKGSSAVGLTAYVTRDVDSKQLVLESGALVLSDGGICCIDEFDKMSESTRS 634
            A R V+ +G+G+SAVGLTA V +D  +K+  LE GALVL+D G+C IDEFDKM++  R+
Sbjct: 570 TANRAVFATGQGASAVGLTASVRKDQITKEWTLEGGALVLADKGVCLIDEFDKMNDQDRT 629

Query: 635 VLHEVMEQQTISVAKAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFD 694
            +HE MEQQ+IS++KAGI+TTL AR SILA+ANPIG RYN  LP+++N++L  P+LSRFD
Sbjct: 630 SIHEAMEQQSISISKAGIVTTLQARCSILAAANPIGGRYNSTLPLSQNVNLTEPILSRFD 689

Query: 695 LVYIILDKVDESTDRDLAKHLTSLYLEDKP---------AHVTT---------------- 729
           ++ ++ D VDE +D  LA  +   ++   P          +V T                
Sbjct: 690 ILCVVRDLVDEESDNRLASFVVDSHIRSHPDKDLDDFDDGNVPTENPNGEGDEETPLSAK 749

Query: 730 -----------DDVLPID--FLTQYINYVKQNVHPLVTEQAKNELVKAYVGMRKMGDDSR 776
                      +++ PI    L +YI+Y +  V+P + +   +++ + Y  +R+    + 
Sbjct: 750 QRRLQNLRKREEEISPISQHMLMKYIHYARTKVYPKLHQMDMDKVSRVYADLRRESVTTG 809

Query: 777 SDEKRITATTRQLESMIRLSEAHAKMRLSSTVDLEDVREAVRL 819
           S       T R LES++R++EA AKMRLS  V   D+  A+++
Sbjct: 810 S----FPITVRHLESILRIAEAFAKMRLSEFVSSWDLDRAIKV 848

>Kwal_14.2090
          Length = 860

 Score =  300 bits (768), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 212/689 (30%), Positives = 340/689 (49%), Gaps = 89/689 (12%)

Query: 172 WGT--NVSIQECANSFRNFLMSFKYKYRRVLDGKTDITDDEAEEELYYVKQLNEMRELGT 229
           W T  NVS +  A   ++FL+ +  ++ R +                Y  ++  + EL +
Sbjct: 187 WITQPNVS-RTIARELKSFLLEYTDEWGRSV----------------YGARIRTLGELNS 229

Query: 230 SNLNLDARNLLAFKQTEELYYQLLNYPQEVISIMDQTIKDCMVSLVVDNQLEH-ELDEIE 288
            +L ++ R+L   K    L+  L   P+E++ I D    D         QL + +   I 
Sbjct: 230 ESLEVNYRHLAESKAILALF--LAKCPEEMLKIFDIVAMDA-------TQLHYPDYARIH 280

Query: 289 SKFYKVRPYNVETQKGMRELNPNDIDKLISLKGLVLRATPVIPDMKVAFFKCNICDHTMA 348
           ++ + VR  +  T   +REL  ++++ L+ + G+V R T V P +K   F C  C   + 
Sbjct: 281 AEIH-VRISDFPTVLNLRELRESNLNSLVRVTGVVTRRTGVFPQLKYVKFNCLKCGAVLG 339

Query: 349 VEI-DRGVIQEPARCERVDCNEANSMTLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVS 407
               D     + + C   +C           +  + + Q + LQE P  VP G+ P    
Sbjct: 340 PYFQDSNEEIKISFC--TNCRSKGPFRTNAEKTLYRNYQRLTLQEAPGTVPAGRLPRHRE 397

Query: 408 LCVYDELVDSCRAGDRIEVTGTFRSIPIKANSRQRVLKSLYKTYIDVVHVKKVSNTRIGV 467
           + +  +LVD  + G+ IEVTG +++     N   R    ++ T I+   V++    R   
Sbjct: 398 VILLWDLVDIAKPGEEIEVTGIYKNT-YDGNLNARNGFPVFATIIEANAVRRREGGRRSG 456

Query: 468 DVSTIEQELLQNKLDNNDVEEVRQISDAEIEKIKQVAQRPDLYDLLARSIAPSIYELDDV 527
           D    ++E L          +V   ++ E  + +++++   + D +  SIAPSIY   D+
Sbjct: 457 D----DEEGL----------DVFGWTEEEEREFRKLSRDRGIIDKVISSIAPSIYGHKDI 502

Query: 528 KKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGS 587
           K  +   L              RGDIN+LL GDP T+KSQIL+YV K A R V+ +G+G+
Sbjct: 503 KTAVACALFSGVPKNVNGKHSIRGDINVLLLGDPGTAKSQILKYVEKTAHRAVFATGQGA 562

Query: 588 SAVGLTAYVTRDVDSKQLVLESGALVLSDGGICCIDEFDKMSESTRSVLHEVMEQQTISV 647
           SAVGLTA V +D  +++  LE GALVL+D G+C IDEFDKM++  R+ +HE MEQQ IS+
Sbjct: 563 SAVGLTASVRKDPITREWTLEGGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQNISI 622

Query: 648 AKAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYIILDKVDEST 707
           +KAGI+T+L AR SI+A+ANP G RYN  LP+ +N+DL  P+LSRFD++ ++ D VDE  
Sbjct: 623 SKAGIVTSLQARCSIIAAANPNGGRYNSALPLAQNVDLTEPILSRFDILCVVRDLVDEVK 682

Query: 708 DRDLAKHLTSLYLEDKPAH--------------VTTDDV--------------------- 732
           D  LA+ +   +L   P H                 +D                      
Sbjct: 683 DERLARFVVDSHLRSHPLHDRLDDGDDDDGDNDAMNEDANEPLSARQRRQQKDREREEEI 742

Query: 733 --LPIDFLTQYINYVKQNVHPLVTEQAKNELVKAYVGMRKMGDDSRSDEKRITATTRQLE 790
             +P + L +YI Y +  V P + +   +++ + Y  +R+    + S       T R LE
Sbjct: 743 SPIPQETLMKYIQYARTRVFPKLHQMDMDKVSRVYADLRRESITTGS----FPITVRHLE 798

Query: 791 SMIRLSEAHAKMRLSSTVDLEDVREAVRL 819
           S++R+SE+ AKMRLS  V   D+  A+++
Sbjct: 799 SILRISESFAKMRLSEFVSSWDLDRAIKV 827

>Sklu_2087.4 YBL023C, Contig c2087 7202-9856
          Length = 884

 Score =  298 bits (763), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 201/645 (31%), Positives = 328/645 (50%), Gaps = 69/645 (10%)

Query: 217 YVKQLNEMRELGTSNLNLDARNLLAFKQTEELYYQLLNYPQEVISIMDQTIKDCMVSLVV 276
           Y  ++  + E+ + +L ++ R+L   K    L+  L   P+E++ I D      +V++  
Sbjct: 235 YGARIRTLGEVNSESLEVNYRHLAESKAILALF--LAKCPEEMLKIFD------LVAMEA 286

Query: 277 DNQLEHELDEIESKFYKVRPYNVETQKGMRELNPNDIDKLISLKGLVLRATPVIPDMKVA 336
                 +   I S+ + VR  +  T   +REL  ++++ L+ + G+V R T V P +K  
Sbjct: 287 TELHYPDYSRIHSEIH-VRISDFPTVHNLRELRESNLNSLVRVTGVVTRRTGVFPQLKYV 345

Query: 337 FFKCNICDHTMAVEI-DRGVIQEPARCERVDCNEANSMTLIHNRCSFADKQVIKLQETPD 395
            F C  C   +     D     + + C   +C           +  + + Q I LQE P 
Sbjct: 346 KFNCLKCGSILGPFFQDSNEEVKISFC--TNCRSKGPFRTNAEKTLYRNYQRITLQEAPG 403

Query: 396 LVPDGQTPHSVSLCVYDELVDSCRAGDRIEVTGTFRSIPIKANSRQRVLKSLYKTYIDVV 455
            VP G+ P    + +  +LVD  + G+ +EVTG +++     N   +    ++ T I+  
Sbjct: 404 TVPAGRLPRHREVILLWDLVDVAKPGEEVEVTGVYKNT-YDGNLNAKNGFPVFATVIEAN 462

Query: 456 HVKKVSNTRIGVDVSTIEQELLQNKLDNNDVEEVRQISDAEIEKIKQVAQRPDLYDLLAR 515
            +K+    RI  +  +IE E     LD     E  +     + + + +       D +  
Sbjct: 463 SIKRREGGRISNE--SIEDE---EGLDPFSWTEEEEREFRRMSRDRAI------IDKIIS 511

Query: 516 SIAPSIYELDDVKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKI 575
           S+APSIY   D+K  +   L              RGDIN+LL GDP T+KSQIL+Y+ K 
Sbjct: 512 SMAPSIYGHKDIKTAVACSLFGGVPKNVNGKHSIRGDINVLLLGDPGTAKSQILKYIEKT 571

Query: 576 APRGVYTSGKGSSAVGLTAYVTRDVDSKQLVLESGALVLSDGGICCIDEFDKMSESTRSV 635
           A R V+ +G+G+SAVGLTA V +D  +++  LE GALVL+D G+C IDEFDKM++  R+ 
Sbjct: 572 AHRAVFATGQGASAVGLTASVRKDPITREWTLEGGALVLADKGVCLIDEFDKMNDQDRTS 631

Query: 636 LHEVMEQQTISVAKAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDL 695
           +HE MEQQ+IS++KAGI+TTL AR SI+A+ANP G RYN  LP+ +N+DL  P+LSRFD+
Sbjct: 632 IHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNSTLPLAQNVDLTEPILSRFDI 691

Query: 696 VYIILDKVDESTDRDLAKHLTSLYL---------------------------EDKPAHVT 728
           + ++ D VDE  D  LA  + S ++                           +D+PA ++
Sbjct: 692 LCVVRDLVDEEADERLATFVVSSHVRSHPDSDRLREDPQDDDLDQQTEDEREDDEPAPMS 751

Query: 729 T------------DDVLPI--DFLTQYINYVKQNVHPLVTEQAKNELVKAYVGMRKMGDD 774
                         ++ PI  D L +YI+Y +  ++P + +   +++ + Y  +R+    
Sbjct: 752 ARQKRLQRQREKEGEISPIPQDTLMKYIHYARIKIYPKLHQMDMDKVSRVYADLRRESIT 811

Query: 775 SRSDEKRITATTRQLESMIRLSEAHAKMRLSSTVDLEDVREAVRL 819
           + S       T R LES++R++E+ AKMRLS  V   D+  A+++
Sbjct: 812 TGS----FPITVRHLESILRIAESFAKMRLSEFVSSWDLDRAIKV 852

>YBL023C (MCM2) [172] chr2 complement(174885..177491) Member of the
           MCM/P1 family that acts as a complex at ARS sequences to
           initiate DNA replication [2607 bp, 868 aa]
          Length = 868

 Score =  297 bits (760), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 196/655 (29%), Positives = 328/655 (50%), Gaps = 79/655 (12%)

Query: 217 YVKQLNEMRELGTSNLNLDARNLLAFKQTEELYYQLLNYPQEVISIMDQTIKDCMVSLVV 276
           Y  ++  + E+ + +L ++ R+L   K    L+  L   P+E++ I D      +V++  
Sbjct: 227 YGARIRTLGEMNSESLEVNYRHLAESKAILALF--LAKCPEEMLKIFD------LVAMEA 278

Query: 277 DNQLEHELDEIESKFYKVRPYNVETQKGMRELNPNDIDKLISLKGLVLRATPVIPDMKVA 336
                 +   I S+ + VR  +  T   +REL  +++  L+ + G+V R T V P +K  
Sbjct: 279 TELHYPDYARIHSEIH-VRISDFPTIYSLRELRESNLSSLVRVTGVVTRRTGVFPQLKYV 337

Query: 337 FFKCNICDHTMAVEIDRGVIQEPARCERV----DCNEANSMTLIHNRCSFADKQVIKLQE 392
            F C  C   +         Q+     R+    +C       +   +  + + Q + LQE
Sbjct: 338 KFNCLKCGSILG-----PFFQDSNEEIRISFCTNCKSKGPFRVNGEKTVYRNYQRVTLQE 392

Query: 393 TPDLVPDGQTPHSVSLCVYDELVDSCRAGDRIEVTGTFRSIPIKANSRQRVLKSLYKTYI 452
            P  VP G+ P    + +  +LVD  + G+ +EVTG +++     N   +    ++ T I
Sbjct: 393 APGTVPPGRLPRHREVILLADLVDVSKPGEEVEVTGIYKN-NYDGNLNAKNGFPVFATII 451

Query: 453 DVVHVKKVSNTRIGVDVSTIEQELLQNKLDNNDVEEVRQISDAEIEKIKQVAQRPDLYDL 512
           +   +K+    R G   +  E+ L           +V   ++ E  + +++++   + D 
Sbjct: 452 EANSIKR----REGNTANEGEEGL-----------DVFSWTEEEEREFRKISRDRGIIDK 496

Query: 513 LARSIAPSIYELDDVKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYV 572
           +  S+APSIY   D+K  +   L              RGDIN+LL GDP T+KSQIL+YV
Sbjct: 497 IISSMAPSIYGHRDIKTAVACSLFGGVPKNVNGKHSIRGDINVLLLGDPGTAKSQILKYV 556

Query: 573 HKIAPRGVYTSGKGSSAVGLTAYVTRDVDSKQLVLESGALVLSDGGICCIDEFDKMSEST 632
            K A R V+ +G+G+SAVGLTA V +D  +K+  LE GALVL+D G+C IDEFDKM++  
Sbjct: 557 EKTAHRAVFATGQGASAVGLTASVRKDPITKEWTLEGGALVLADKGVCLIDEFDKMNDQD 616

Query: 633 RSVLHEVMEQQTISVAKAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSR 692
           R+ +HE MEQQ+IS++KAGI+TTL AR SI+A+ANP G RYN  LP+ +N+ L  P+LSR
Sbjct: 617 RTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNSTLPLAQNVSLTEPILSR 676

Query: 693 FDLVYIILDKVDESTDRDLAKHLTSLYLEDKPAH------------------VTTDDV-- 732
           FD++ ++ D VDE  D  LA  +   ++   P +                     D++  
Sbjct: 677 FDILCVVRDLVDEEADERLATFVVDSHVRSHPENDEDREGEELKNNGESAIEQGEDEINE 736

Query: 733 ---------------------LPIDFLTQYINYVKQNVHPLVTEQAKNELVKAYVGMRKM 771
                                +P + L +YI+Y +  ++P + +   +++ + Y  +R+ 
Sbjct: 737 QLNARQRRLQRQRKKEEEISPIPQELLMKYIHYARTKIYPKLHQMDMDKVSRVYADLRRE 796

Query: 772 GDDSRSDEKRITATTRQLESMIRLSEAHAKMRLSSTVDLEDVREAVRLMKSAIKD 826
              + S       T R LES++R++E+ AKMRLS  V   D+  A++++  +  D
Sbjct: 797 SISTGS----FPITVRHLESILRIAESFAKMRLSEFVSSYDLDRAIKVVVDSFVD 847

>Scas_499.2
          Length = 985

 Score =  298 bits (763), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 206/596 (34%), Positives = 310/596 (52%), Gaps = 104/596 (17%)

Query: 306 RELNPNDIDKLISLKGLVLRATPVIPDM--------KVAFFKCNICDHTMAVEIDRGVIQ 357
           R LN   ++KLIS++G+V R + V P +        K   F     D+T A       I 
Sbjct: 177 RTLNSQFLNKLISIEGIVTRTSLVRPKLIRSVHYAEKTGRFHYR--DYTDATTTLTTKIP 234

Query: 358 EPARCERVDCNEANSMTLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLCVYDELVDS 417
            PA     D  + N +   +   +F D Q I +QE P++ P GQ P S+ + + D+LVD 
Sbjct: 235 TPAIYPTEDT-DGNKLITEYGYSTFVDHQRITIQEMPEMAPAGQLPRSIDVILDDDLVDK 293

Query: 418 CRAGDRIEVTGTFRSIPIKANSRQRVLK--------SLYKTYIDVVHVKKVSNTRIGVDV 469
            + GDR+ V G F+S+     +              S ++T I            IG  V
Sbjct: 294 TKPGDRVNVIGVFKSLGAGGLNNGGNGGGADSGASMSGFRTLI------------IGNTV 341

Query: 470 STIEQELLQNKLDNNDVEEVRQISDAEIEKIKQVAQRPDLYDLLARSIAPSIYELDDVKK 529
             +          +  V   + ++D +I  I +++++ D++D+LA+S+APSIY  + +K+
Sbjct: 342 YPLHAR-------STGVSARQTLTDFDIRNINKLSKKKDIFDVLAQSLAPSIYGHEHIKR 394

Query: 530 GILLQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSA 589
            ILL L              RGDINIL+ GDPST+KSQ+L++V   A   + T+G+GSS 
Sbjct: 395 AILLMLMGGVEKNLENGSHLRGDINILMVGDPSTAKSQLLRFVLNTASLAIATTGRGSSG 454

Query: 590 VGLTAYVTRDVDSKQLVLESGALVLSDGGICCIDEFDKMSESTRSVLHEVMEQQTISVAK 649
           VGLTA VT D ++ +  LE+GA+VL+D G+ CIDEFDKM++  R  +HEVMEQQT+++AK
Sbjct: 455 VGLTAAVTNDRETGERRLEAGAMVLADRGVVCIDEFDKMTDVDRVAIHEVMEQQTVTIAK 514

Query: 650 AGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYIILDKVDESTDR 709
           AGI TTLNAR S++A+ANP+  +Y+ N    +NI LP  LLSRFDL++++ D ++E  DR
Sbjct: 515 AGIHTTLNARCSVIAAANPVFGQYDVNRDPHQNIALPDSLLSRFDLLFVVTDDINEIRDR 574

Query: 710 DLAKH-------LTSLYLEDKPAH--------VTTDD----------------------- 731
            +++H       L   YLE +P          V  DD                       
Sbjct: 575 SISEHVLRTHRYLPPGYLEGEPIRERLNLSLAVGVDDNINEENKDGGEEDEEDQVFEKFN 634

Query: 732 -----------------------VLPIDFLTQYINYVKQNVHPLVTEQAKNELVKAYVGM 768
                                  ++ I FL +Y+ Y K+ V P +T+QA + +VK Y  +
Sbjct: 635 PLLQAGAKLAKNKGNHNGTEIPKLVTIPFLRKYVQYAKERVIPQLTQQAIDVIVKNYADL 694

Query: 769 RKMGDDSRSDEKRITATTRQLESMIRLSEAHAKMRLSSTVDLEDVREAVRLMKSAI 824
           R   +D  + +  ITA  R LE++IRL+ AHAK+RLS TV+  D   A  L++ A+
Sbjct: 695 R---NDENTKKSPITA--RTLETLIRLATAHAKVRLSKTVNKRDANVAAGLLRYAL 745

>Kwal_27.10174
          Length = 945

 Score =  294 bits (753), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 198/589 (33%), Positives = 303/589 (51%), Gaps = 94/589 (15%)

Query: 306 RELNPNDIDKLISLKGLVLRATPVIPDMKVAFF------KCNICDHTMAVEIDRGVIQEP 359
           R LN + ++KL+S++G+V + + V P +  +        + +  D+  A       I  P
Sbjct: 137 RTLNSHYLNKLLSIEGIVTKVSLVRPKLLRSVHYAEKTGRFHYRDYRDATTTLITQIPTP 196

Query: 360 ARCERVDCNEANSMTLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCR 419
           A     D  E N +T  +   ++ D Q I +QE P+  P GQ P S+ + + ++LVD  +
Sbjct: 197 AIYPTEDP-EGNKLTTEYGYSTYIDHQRITVQEMPEKAPPGQLPRSIDVIMDEDLVDKTK 255

Query: 420 AGDRIEVTGTFRSIPIKANSRQRVLKSLYKTYIDVVHVKKVSNTRIGVDVSTIEQELLQN 479
            GDRI + G                  +YK+          S+   G  +S     +L N
Sbjct: 256 PGDRINIVG------------------IYKSLGGGGLSSSGSSNDQGSSLSGFRTMVLAN 297

Query: 480 -----KLDNNDVEEVRQISDAEIEKIKQVAQRPDLYDLLARSIAPSIYELDDVKKGILLQ 534
                   +  V   + ++D++I  I +++++ D++DLL++S+APSIY  D +KK ILL 
Sbjct: 298 TAYPLHARSTGVAARQALTDSDIRNINKLSKKDDIFDLLSQSLAPSIYGHDHIKKAILLM 357

Query: 535 LXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTA 594
           L              RGDIN+L+ GDPST+KSQ+L++V   A   + T+G+GSS VGLTA
Sbjct: 358 LMGGVEKNLENGSHLRGDINLLMVGDPSTAKSQLLRFVLNTASLAIATTGRGSSGVGLTA 417

Query: 595 YVTRDVDSKQLVLESGALVLSDGGICCIDEFDKMSESTRSVLHEVMEQQTISVAKAGIIT 654
            VT D ++ +  LE+GA+VL+D GI CIDEFDKMS+  R  +HEVMEQQT+++AKAGI T
Sbjct: 418 AVTMDKETGERRLEAGAMVLADRGIVCIDEFDKMSDVDRVAIHEVMEQQTVTIAKAGIHT 477

Query: 655 TLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYIILDKVDESTDRDLAKH 714
           TLNAR S++A+ANP+  +Y+ N     NI LP  LLSRFDL++++ D ++E+TDR +++H
Sbjct: 478 TLNARCSVIAAANPVFGQYDLNKDPHYNIALPDSLLSRFDLLFVVTDDINENTDRAISEH 537

Query: 715 -------LTSLYLEDKPAHVTTDDVLPIDFLTQYINY----------VKQNVHPLVTEQA 757
                  L   YLE +P     +  L +     + N           V +  +PL+   A
Sbjct: 538 VLRTHRYLPPGYLEGEPIGEAINLSLSVGDDNGFANEEEDDDDDEGKVFEKFNPLLHAGA 597

Query: 758 K------------------------------------------NELVKAYVGMRKMGDDS 775
           K                                          N +V+ Y  +R     +
Sbjct: 598 KLARNKGNRQGTELPQIVSIPFLRKYVQYAKERVVPMLSQEAVNIVVRTYTELR-----N 652

Query: 776 RSDEKRITATTRQLESMIRLSEAHAKMRLSSTVDLEDVREAVRLMKSAI 824
             + K+   T R LE++IRL+ AHAK+RLS TVD ED R A  L++ A+
Sbjct: 653 DQNTKKSPITPRTLETLIRLASAHAKVRLSKTVDREDARVAAHLLRFAL 701

>AFR355C [3547] [Homologous to ScYEL032W (MCM3) - SH]
           (1082128..1084959) [2832 bp, 943 aa]
          Length = 943

 Score =  293 bits (751), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 203/588 (34%), Positives = 304/588 (51%), Gaps = 93/588 (15%)

Query: 306 RELNPNDIDKLISLKGLVLRATPVIPDM-KVAFFKCNICDH----------TMAVEIDRG 354
           R L    +++L+S++G+V R + V P + +      N   H          T+  E+   
Sbjct: 138 RTLMATHLNQLVSIEGIVTRTSIVRPKLLRSVHLSKNTGAHYYRDYRDATTTLVTEV--- 194

Query: 355 VIQEPARCERVDCNEANSMTLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLCVYDEL 414
               PA     D  E N +   +   ++ D Q + +QE P+  P GQ P SV + + D+L
Sbjct: 195 --PTPAIYPEADP-EGNPLNTEYGYSTYMDHQRVTVQEMPEKAPPGQLPRSVDVILDDDL 251

Query: 415 VDSCRAGDRIEVTGTFRSIPIKANSRQRVLKSLYKTYIDVVHVKKVSNTRIGVDVSTIEQ 474
           VD  + GDR+ + G F+SI     S                     +N   G     I  
Sbjct: 252 VDKTKPGDRVNIVGVFKSIGAGGMSGGSS-------------SDHGNNGLAGFKTLIIGN 298

Query: 475 ELLQNKLDNNDVEEVRQISDAEIEKIKQVAQRPDLYDLLARSIAPSIYELDDVKKGILLQ 534
            +      +  V    ++SD +I  I ++A+  D++DLLA+S+APSIY  + +KK +LL 
Sbjct: 299 TVYPLHARSTGVAASERLSDTDIRNINKLAKSADVFDLLAQSLAPSIYGHEHIKKAVLLM 358

Query: 535 LXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTA 594
           L              RGDINIL+ GDPST+KSQ+L++V   A   + T+G+GSS VGLTA
Sbjct: 359 LMGGVEKNLENGSHLRGDINILMVGDPSTAKSQMLRFVLNTAALAIATTGRGSSGVGLTA 418

Query: 595 YVTRDVDSKQLVLESGALVLSDGGICCIDEFDKMSESTRSVLHEVMEQQTISVAKAGIIT 654
            VT D ++ +  LE+GA+VL+D GI CIDEFDKMS+  R  +HEVMEQQT+++AKAGI T
Sbjct: 419 AVTMDRETGERRLEAGAMVLADRGIVCIDEFDKMSDVDRVAIHEVMEQQTVTIAKAGIHT 478

Query: 655 TLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYIILDKVDESTDRDLAKH 714
           TLNAR S++A+ANP+  +Y+ N    +NI LP  LLSRFDL++++ D +++  DR +++H
Sbjct: 479 TLNARCSVIAAANPVFGQYDVNKDPHKNIALPDSLLSRFDLLFVVTDDINDVRDRAISEH 538

Query: 715 -------LTSLYLEDKPAH--------VTTDDV--------------------------- 732
                  L   Y+E +P          V TD V                           
Sbjct: 539 VLRTHRYLPPGYMEGEPIREAINLSLSVGTDGVSIDPDADDDTTDKVFEKYDPLLHAGAK 598

Query: 733 ------------LP----IDFLTQYINYVKQNVHPLVTEQAKNELVKAYVGMRKMGDDSR 776
                       LP    I F+ +Y+ Y K+ + P++T+ A N +VK Y  +R   +D  
Sbjct: 599 LAKNRGDHRGAELPKVVSIPFIRKYVQYAKERIVPVLTQDAVNIIVKTYCDLR---NDQN 655

Query: 777 SDEKRITATTRQLESMIRLSEAHAKMRLSSTVDLEDVREAVRLMKSAI 824
           + +  ITA  R LE++IRLS AHAK+RLS  V+  D   A +L++ A+
Sbjct: 656 TKKSPITA--RTLETLIRLSNAHAKVRLSKLVEARDANVAAQLLRFAL 701

>CAGL0L01397g 152718..155555 highly similar to sp|P24279
           Saccharomyces cerevisiae YEL032w MCM3 replication
           initiation protein, hypothetical start
          Length = 945

 Score =  290 bits (741), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 205/651 (31%), Positives = 337/651 (51%), Gaps = 103/651 (15%)

Query: 247 ELYYQLLNYPQEVISIMDQTIKDCMVSLVVDNQLEHELDEIESKFYKVRPYNVETQK--G 304
           + +  +LN P   I   ++ + +   +L  D+   + +D + +K    RP+ +  +   G
Sbjct: 102 KFWRGVLNEPAYYIPPAERALSEIATAL--DDSPRNTVDAVSAK----RPWRLSFKGSFG 155

Query: 305 MRELNPNDID-----KLISLKGLVLRATPVIPD-MKVAFF-----KCNICDHTMAVEIDR 353
              L+P  ++     KL+S++G+V + + V P  M+   +     + +  D+T +     
Sbjct: 156 SHTLSPGTLNAMYLNKLVSIEGIVTKTSLVRPKLMRSVHYAEKTGRFHYRDYTDSTTSLT 215

Query: 354 GVIQEPARCERVDCNEANSMTLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLCVYDE 413
             +  PA     D  + N +T  +   ++ D Q I +QE P++   G  P SV + + D+
Sbjct: 216 TRVPTPAIYPTEDP-DGNKLTTEYGFSTYIDHQRITVQEMPEMAQVGPVPRSVDIILDDD 274

Query: 414 LVDSCRAGDRIEVTGTFRSIPIKANSRQRVLKSLYKTYIDVVHVKKVSNTRIGVDVSTIE 473
           LVD  + GDRI V G F+S+     ++                    SNT  G     I 
Sbjct: 275 LVDKTKPGDRINVVGVFKSVGAGGLNQGE------------------SNTLNGFRTLIIG 316

Query: 474 QELLQNKLDNNDVEEVRQISDAEIEKIKQVAQRPDLYDLLARSIAPSIYELDDVKKGILL 533
             +      +  V     ++D +I  I ++++R D++++LA+S+APSIY  +++K+ +LL
Sbjct: 317 NSVYPLHARSTGVSAKETLNDLDIRNINKLSKRGDIFEILAQSLAPSIYGHENIKRAVLL 376

Query: 534 QLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLT 593
            L              RGDINIL+ GDPST+KSQ+L++V   A   + T+G+GSS VGLT
Sbjct: 377 MLFGGVEKNLENGSHLRGDINILMVGDPSTAKSQMLRFVLNTASLAIATTGRGSSGVGLT 436

Query: 594 AYVTRDVDSKQLVLESGALVLSDGGICCIDEFDKMSESTRSVLHEVMEQQTISVAKAGII 653
           A VT D ++ +  LE+GA+VL+D GI CIDEFDKM++  R  +HEVMEQQT+++AKAGI 
Sbjct: 437 AAVTTDRETGERRLEAGAMVLADRGIVCIDEFDKMTDVDRVAIHEVMEQQTVTIAKAGIH 496

Query: 654 TTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYIILDKVDESTDRDLA- 712
           TTLN+R S++A+ANP+  +Y+ N    +NI LP  LLSRFDL++++ D ++E+ DR ++ 
Sbjct: 497 TTLNSRCSVIAAANPVFGQYDVNRDPHQNIALPDSLLSRFDLLFVVTDDINEARDRSISE 556

Query: 713 ------KHLTSLYLEDKPAH--------VTTDD--------------------------- 731
                 ++L+   +E +P          V TD+                           
Sbjct: 557 HVLRTHRYLSPGMVEGEPVRDRLNLSLAVGTDEDDENANDNTNQDEEDQVFEKFNPLLQA 616

Query: 732 ------------------VLPIDFLTQYINYVKQNVHPLVTEQAKNELVKAYVGMRKMGD 773
                             ++ I FL +Y+ Y K+ V P +T +A + +VK Y  +R   +
Sbjct: 617 GAMLAKNRGNYNGTEIPKLVKISFLRKYVQYAKERVVPQLTTEAVDVIVKNYTDLR---N 673

Query: 774 DSRSDEKRITATTRQLESMIRLSEAHAKMRLSSTVDLEDVREAVRLMKSAI 824
           D  + +  ITA  R LE++IRL+ AHAK+RLS TVD  D   A  L++ ++
Sbjct: 674 DENTKKSPITA--RTLETLIRLATAHAKVRLSRTVDKVDATVAANLLRFSL 722

>YEL032W (MCM3) [1393] chr5 (86937..89852) Member of the MCM/P1
           family, part of the MCM complex that assembles at ARS
           elements to initiate replication [2916 bp, 971 aa]
          Length = 971

 Score =  273 bits (698), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 196/593 (33%), Positives = 304/593 (51%), Gaps = 98/593 (16%)

Query: 306 RELNPNDIDKLISLKGLVLRATPVIPDM------KVAFFKCNICDHTMAVEIDRGVIQEP 359
           R L    ++KL+S++G+V + + V P +           + +  D+T A       I  P
Sbjct: 169 RTLTAQHLNKLVSVEGIVTKTSLVRPKLIRSVHYAAKTGRFHYRDYTDATTTLTTRIPTP 228

Query: 360 ARCERVDCNEANSMTLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCR 419
           A     D  E N +T  +   +F D Q I +QE P++ P GQ P S+ + + D+LVD  +
Sbjct: 229 AIYPTEDT-EGNKLTTEYGYSTFIDHQRITVQEMPEMAPAGQLPRSIDVILDDDLVDKTK 287

Query: 420 AGDRIEVTGTFRSIPIKANSRQRVLKSLYKTYIDVVHVKKVSNTRIGVDVSTIEQELLQN 479
            GDR+ V G F+S+     ++                    SNT IG     +   +   
Sbjct: 288 PGDRVNVVGVFKSLGAGGMNQSN------------------SNTLIGFKTLILGNTVYPL 329

Query: 480 KLDNNDVEEVRQISDAEIEKIKQVAQRPDLYDLLARSIAPSIYELDDVKKGILLQLXXXX 539
              +  V   + ++D +I  I +++++ D++D+L++S+APSIY  D +KK ILL L    
Sbjct: 330 HARSTGVAARQMLTDFDIRNINKLSKKKDIFDILSQSLAPSIYGHDHIKKAILLMLMGGV 389

Query: 540 XXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRD 599
                     RGDINIL+ GDPST+KSQ+L++V   A   + T+G+GSS VGLTA VT D
Sbjct: 390 EKNLENGSHLRGDINILMVGDPSTAKSQLLRFVLNTASLAIATTGRGSSGVGLTAAVTTD 449

Query: 600 VDSKQLVLESGALVLSDGGICCIDEFDKMSESTRSVLHEVMEQQTISVAKAGIITTLNAR 659
            ++ +  LE+GA+VL+D G+ CIDEFDKM++  R  +HEVMEQQT+++AKAGI TTLNAR
Sbjct: 450 RETGERRLEAGAMVLADRGVVCIDEFDKMTDVDRVAIHEVMEQQTVTIAKAGIHTTLNAR 509

Query: 660 SSILASANPIGSRY--------NPNLP------------VTENID--------------- 684
            S++A+ANP+  +Y        N  LP            VT++I+               
Sbjct: 510 CSVIAAANPVFGQYDVNRDPHQNIALPDSLLSRFDLLFVVTDDINEIRDRSISEHVLRTH 569

Query: 685 --LPP------PLLSRFDLVYIILDKVD-------------ESTDRDLAKHLTSLY---- 719
             LPP      P+  R +L   + +  D             E+   D   H+   +    
Sbjct: 570 RYLPPGYLEGEPVRERLNLSLAVGEDADINPEEHSNSGAGVENEGEDDEDHVFEKFNPLL 629

Query: 720 ------LEDKPAHVTTD--DVLPIDFLTQYINYVKQNVHPLVTEQAKNELVKAYVGMRKM 771
                  ++K  +  T+   ++ I FL +Y+ Y K+ V P +T++A N +VK Y  +R  
Sbjct: 630 QAGAKLAKNKGNYNGTEIPKLVTIPFLRKYVQYAKERVIPQLTQEAINVIVKNYTDLRN- 688

Query: 772 GDDSRSDEKRITATTRQLESMIRLSEAHAKMRLSSTVDLEDVREAVRLMKSAI 824
            DD   + K+   T R LE++IRL+ AHAK+RLS TV+  D + A  L++ A+
Sbjct: 689 -DD---NTKKSPITARTLETLIRLATAHAKVRLSKTVNKVDAKVAANLLRFAL 737

>YOR036W (PEP12) [4848] chr15 (400347..401213) Syntaxin homolog
           (t-SNARE) involved in Golgi to vacuole transport [867
           bp, 288 aa]
          Length = 288

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 33/53 (62%)

Query: 854 EDLAREIIRILKEYPADSMSFNELIKQINEQAQDRVEPSQVSSTLSRLQQEDK 906
           E L R++    +E+      F +++KQ+NE+A++ +E S++++  + L +E +
Sbjct: 113 EKLVRDVSYSFQEFQGIQRQFTQVMKQVNERAKESLEASEMANDAALLDEEQR 165

>CAGL0M03707g 415143..420122 similar to sp|P48563 Saccharomyces
            cerevisiae YNL297c MON2, hypothetical start
          Length = 1659

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 482  DNNDVEEVRQISDAEIEKIKQVAQRPDLYDLLARSI--APSIYELDDVKKGIL 532
            + +D+ E  Q S     K        D YDLL R+I  A  IYE DD++K IL
Sbjct: 1440 EKSDLSEFDQYSQLFKNKSLMPLFTSDHYDLLVRNIWDASLIYEFDDIQKAIL 1492

>Scas_605.12
          Length = 552

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 36/85 (42%), Gaps = 11/85 (12%)

Query: 309 NPNDIDKLISLKGLVLRATPVIPDMKVAFFKCNI-----CDHTMAVEIDRGVIQEPARCE 363
           NPN +   +  K  V+     I D+K   F  +I      D  +  E D+  I +P  C+
Sbjct: 37  NPNKVGFYLEPKAAVMNKAASIEDIKYLLFSQHIQKFKETDDAILKEEDKIAITQPLTCK 96

Query: 364 RVDCNEANSMTLIHN----RCSFAD 384
           R  CN+A    +  N    R SF D
Sbjct: 97  R--CNDAIHQNIYDNEEFKRISFFD 119

>Kwal_23.5699
          Length = 641

 Score = 30.4 bits (67), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 55/112 (49%), Gaps = 13/112 (11%)

Query: 402 TPHSVSLCVYDELV--DSCR---AGDRIEVTGTFRSIPIKANSRQRVLKSLYKTYIDVVH 456
           TP  V L   D L+  DS +   A   I + GTF+S        +RV+ S  K Y ++V 
Sbjct: 348 TPVVVELGGKDALIALDSVKDLPALSSIIMRGTFQSSGQNCIGIERVIVSA-KNYDELVS 406

Query: 457 V--KKVSNTRIGVDVSTIEQELLQNKLDNNDVEEV-RQISDAEIEKIKQVAQ 505
           +  K+V   R+G D+  +E   +   + +N  EE+ R + DA    IKQ A+
Sbjct: 407 ILEKRVGQLRLGSDIDNLEDVDMGAMISDNRFEELERMVQDA----IKQGAR 454

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.132    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 27,673,465
Number of extensions: 1189130
Number of successful extensions: 5091
Number of sequences better than 10.0: 80
Number of HSP's gapped: 5146
Number of HSP's successfully gapped: 99
Length of query: 910
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 799
Effective length of database: 12,753,511
Effective search space: 10190055289
Effective search space used: 10190055289
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)