Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0J11792g51050226340.0
YML043C (RRN11)5074858061e-102
Kwal_56.225274814477046e-87
KLLA0C05852g4824836942e-85
ACL020W5394896531e-78
Scas_611.0d153912093e-19
ABR149W1226164760.34
YJL039C (NUP192)168351711.4
YLR417W (VPS36)56655692.1
Sklu_765.221047646.0
KLLA0B08657g79152649.5
CAGL0G07623g563133649.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J11792g
         (502 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J11792g complement(1148628..1150160) similar to sp|Q04712 S...  1019   0.0  
YML043C (RRN11) [3925] chr13 complement(190244..191767) Componen...   315   e-102
Kwal_56.22527                                                         275   6e-87
KLLA0C05852g 518508..519956 weakly similar to sp|Q04712 Saccharo...   271   2e-85
ACL020W [1029] [Homologous to ScYML043C (RRN11) - NSH] complemen...   256   1e-78
Scas_611.0d                                                            85   3e-19
ABR149W [742] [Homologous to ScYBL047C (EDE1) - SH] complement(6...    34   0.34 
YJL039C (NUP192) [2872] chr10 complement(368664..373715) Nuclear...    32   1.4  
YLR417W (VPS36) [3793] chr12 (955006..956706) Component of the e...    31   2.1  
Sklu_765.2 YGL079W, Contig c765 563-1195 reverse complement            29   6.0  
KLLA0B08657g 764962..767337 gi|4760392|gb|AAD29121.1|AF120714_1 ...    29   9.5  
CAGL0G07623g complement(722781..724472) similar to sp|P37302 Sac...    29   9.8  

>CAGL0J11792g complement(1148628..1150160) similar to sp|Q04712
           Saccharomyces cerevisiae YML043c RRN11 RNA polymerase I
           specific transcription initiation factor, hypothetical
           start
          Length = 510

 Score = 1019 bits (2634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/502 (97%), Positives = 489/502 (97%)

Query: 1   MFEVPITYNCRRLNVERRVRYQYINILSRKYHAKRRSKRRRQANSLPTPENSAVENDQSE 60
           MFEVPITYNCRRLNVERRVRYQYINILSRKYHAKRRSKRRRQANSLPTPENSAVENDQSE
Sbjct: 1   MFEVPITYNCRRLNVERRVRYQYINILSRKYHAKRRSKRRRQANSLPTPENSAVENDQSE 60

Query: 61  SQLPSREQIKEKKMKLGEDYSDSEAETSSEGEDTTKDDNEFANDMNKFEKLFYRKYEKPE 120
           SQLPSREQIKEKKMKLGEDYSDSEAETSSEGEDTTKDDNEFANDMNKFEKLFYRKYEKPE
Sbjct: 61  SQLPSREQIKEKKMKLGEDYSDSEAETSSEGEDTTKDDNEFANDMNKFEKLFYRKYEKPE 120

Query: 121 HSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIAKKRVEKNVVHMPLVNKRYFDIKS 180
           HSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIAKKRVEKNVVHMPLVNKRYFDIKS
Sbjct: 121 HSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIAKKRVEKNVVHMPLVNKRYFDIKS 180

Query: 181 EGYEVLEPLVDIDSYLLKHIEILTQILFSSVSQGNWDIAYRTFSLLIRIPEVDIRNIWGL 240
           EGYEVLEPLVDIDSYLLKHIEILTQILFSSVSQGNWDIAYRTFSLLIRIPEVDIRNIWGL
Sbjct: 181 EGYEVLEPLVDIDSYLLKHIEILTQILFSSVSQGNWDIAYRTFSLLIRIPEVDIRNIWGL 240

Query: 241 GTRILMERGQTTRSLEFLKWMSTVYSSKQNFVQSHCHRKAPVFRSGSRTHTPKYALTWLW 300
           GTRILMERGQTTRSLEFLKWMSTVYSSKQNFVQSHCHRKAPVFRSGSRTHTPKYALTWLW
Sbjct: 241 GTRILMERGQTTRSLEFLKWMSTVYSSKQNFVQSHCHRKAPVFRSGSRTHTPKYALTWLW 300

Query: 301 NCLIKVTELISIXXXXXXXXXXXXXDNGSKQSAMDKLTELIDKISEMVLVPPYLDDPEIW 360
           NCLIKVTELISI             DNGSKQSAMDKLTELIDKISEMVLVPPYLDDPEIW
Sbjct: 301 NCLIKVTELISIEEEKGVNTNEEENDNGSKQSAMDKLTELIDKISEMVLVPPYLDDPEIW 360

Query: 361 FIYSMCHMVHADYLSGKFNCQRLSGSRRDIARNQVTQHIHYVKTYLQNCSQKGNFEYPKQ 420
           FIYSMCHMVHADYLSGKFNCQRLSGSRRDIARNQVTQHIHYVKTYLQNCSQKGNFEYPKQ
Sbjct: 361 FIYSMCHMVHADYLSGKFNCQRLSGSRRDIARNQVTQHIHYVKTYLQNCSQKGNFEYPKQ 420

Query: 421 FIQSRLEEFEKRMYEDESKPENMKLQESYDNTSYSNEDDEENPFQIDESNSFLGNLVEEG 480
           FIQSRLEEFEKRMYEDESKPENMKLQESYDNTSYSNEDDEENPFQIDESNSFLGNLVEEG
Sbjct: 421 FIQSRLEEFEKRMYEDESKPENMKLQESYDNTSYSNEDDEENPFQIDESNSFLGNLVEEG 480

Query: 481 IDPVIKTHWEPTMNMDALKFNY 502
           IDPVIKTHWEPTMNMDALKFNY
Sbjct: 481 IDPVIKTHWEPTMNMDALKFNY 502

>YML043C (RRN11) [3925] chr13 complement(190244..191767) Component
           of RNA polymerase I core transcription factor (CF) along
           with Rrn6p and Rrn7p [1524 bp, 507 aa]
          Length = 507

 Score =  315 bits (806), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 190/485 (39%), Positives = 285/485 (58%), Gaps = 46/485 (9%)

Query: 1   MFEVPITYNCRRLNVERRVRYQYINILSRKYHAKRRSKRRRQANSLPTPENSAVEND--- 57
           MFEVPIT   R+    R+++YQYIN +SR++   R SK+    +SLPTPENSA EN+   
Sbjct: 1   MFEVPITLTNRKFAQRRKLKYQYINYISRRF--DRISKKSTTTDSLPTPENSAAENNDEE 58

Query: 58  ---QSESQLPSREQIKEKKMK--------LGEDYSDSEAETSSEGEDTTKD---DNEFAN 103
               SE+    R  +++KK +        +GE YS +E+ET S+ E+T +    D     
Sbjct: 59  EGQNSEAGTYRRSVLQQKKRRRERHWRSVVGEIYSTTESETDSQEEETEEGGEHDTGIDK 118

Query: 104 DMNKFEKLFYRKYEKPEHSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIAKKRVEK 163
           + +  E+ F++KYEKPE SFE+W    +V+++ K  + K  + Y    ++E+I  +++E 
Sbjct: 119 EDSDEERKFWKKYEKPEKSFEIW---RTVSSQNKQPINKQKMTYHNFKKIEKIPLRKMEI 175

Query: 164 NVVHMPLVNKRYFDIKSEGYEVLEPL----VDIDSYLLKHIEILTQILFSSVSQGNWDIA 219
            ++H    NK YF   S G   LEPL     ++ +Y  +HI  LT +L  +VS+ NW +A
Sbjct: 176 PLLHCTKENKLYFQSISRG---LEPLKTSTSEVRNYRTRHIVTLTDLLHLNVSRHNWSLA 232

Query: 220 YRTFSLLIRIPEVDIRNIWGLGTRILMERGQTTRSLEFLKWMSTVYSSKQNFVQSHCHRK 279
           Y+ F+ LIRIP V I+++WG+G  IL     ++  L+FL+WM  +YSSK  FVQ+  +R 
Sbjct: 233 YKIFATLIRIPGVQIKSLWGIGVEILDNLSNSSSGLDFLQWMCQIYSSKSRFVQNINYRS 292

Query: 280 -APVFRSGSRTHTPKYALTWLWNCLIKVTELISIXXXXXXXXXXXXXDNGSKQSAMDKLT 338
             P F++GSRTHT K+A+T+LW+ LI   +  S+             +N       D L 
Sbjct: 293 IVPPFQTGSRTHTAKFAITYLWSSLINCQK--SMEPSSNIIDKPFDTEN-------DLLQ 343

Query: 339 ELIDKISEMVLVPPYLDDPEIWFIYSMCHMVHADYLSGKF----NCQRLSGSRRDIARNQ 394
           ELIDKISE VL PP+++D E+WFIY+ CH++ AD LS +F        L G  RDI  NQ
Sbjct: 344 ELIDKISEWVLTPPFMEDAEVWFIYASCHLLKADTLSRQFVNDNKNNDLIGLDRDIKINQ 403

Query: 395 VTQHIHYVKTYLQNCSQKGNFEYPKQFIQSRLEEFEKRMY---EDESKPENMKLQESYDN 451
           V +HIHYV+T+L+ C  KG F  P + I+++L+ FE R+Y   +D  + +   + +S DN
Sbjct: 404 VIKHIHYVRTFLKICLDKGGFAVPSRLIENQLKSFESRLYGEAQDIQERDVANVYDSIDN 463

Query: 452 TSYSN 456
           +S  N
Sbjct: 464 SSVEN 468

>Kwal_56.22527
          Length = 481

 Score =  275 bits (704), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 161/447 (36%), Positives = 251/447 (56%), Gaps = 37/447 (8%)

Query: 1   MFEVPITYNCRRLNVERRVRYQYINILSRKYHAKRRSKRRRQANS-LPTPENSAVEN--- 56
           MFE+P+  N  R+   R++RYQYIN LS+++   RR +    A++ LPTPENSA E+   
Sbjct: 1   MFELPLARNSNRVRTVRKLRYQYINSLSQEH---RRIQDSAAAHATLPTPENSAAEDASD 57

Query: 57  -DQSESQLPSREQIKEKKMKLGEDYSDSEAETSSEGEDTTKDDNEFANDMNKFEKLFYRK 115
            DQ      SR + +++++     + DSE+E S    D         +++ + EK F+  
Sbjct: 58  GDQDSEDAGSRRRRRKRRILSVLGHIDSESELS----DVDMSTESHHSELQESEKEFFSH 113

Query: 116 YEKPEHSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIAKKRVEKNVVHMPLVNKRY 175
           +EKP+ ++E W    + + +K   +    + Y     +E  A++RV + + H   + + +
Sbjct: 114 HEKPQDTYETW----NTDRRKAVSMTTATLSYAENKLIEARAQRRVIERIGHFSRIARSH 169

Query: 176 FDIKSEGYEVLEPLVDIDSYLLKHIEILTQILFSSVSQGNWDIAYRTFSLLIRIPEVDIR 235
           F+    GYE+      +  +   HI  L ++L  +V +G W+ A+R FS+LIR+P VDIR
Sbjct: 170 FNSIKRGYEIYSRPSQV--HQTTHITHLNELLHINVMEGQWETAFRCFSILIRLPGVDIR 227

Query: 236 NIWGLGTRILMERGQTTRSL----EFLKWMSTVYSSKQNFVQSHCHRKAPVFRSGSRTHT 291
           ++WGLG RIL E   T +++    EFL W+S +Y+S+ NF  +      PVFR+GS+ HT
Sbjct: 228 SMWGLGVRILRELSSTDKNVASSDEFLGWLSGIYTSRSNFNHTMNFLMDPVFRTGSKKHT 287

Query: 292 PKYALTWLWNCLIKVTELISIXXXXXXXXXXXXXDNGSKQSAMDKLTELIDKISEMVLVP 351
            K+   WLW  L                      DNGS      KL +L++K+SEMVL+P
Sbjct: 288 AKFVSAWLWEMLFAACP---------DKLEERQADNGSGNR---KLIQLLEKLSEMVLIP 335

Query: 352 PYLDDPEIWFIYSMCHMVHADYLSGKFNCQRLSGS--RRDIARNQVTQHIHYVKTYLQNC 409
           PY++DPEIWFIY++CH+V AD LS +F       +   RDI+RNQVTQHI      ++ C
Sbjct: 336 PYMEDPEIWFIYALCHLVSADELSQRFTFTYSESTELERDISRNQVTQHITNAHNCIRTC 395

Query: 410 SQKG-NFEYPKQFIQSRLEEFEKRMYE 435
             KG +F +P++ I+ +L  FE+R+YE
Sbjct: 396 EAKGDDFFFPRRIIEEQLAFFERRLYE 422

>KLLA0C05852g 518508..519956 weakly similar to sp|Q04712
           Saccharomyces cerevisiae YML043c RRN11 RNA polymerase I
           specific transcription initiation factor singleton,
           start by similarity
          Length = 482

 Score =  271 bits (694), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 170/483 (35%), Positives = 254/483 (52%), Gaps = 53/483 (10%)

Query: 1   MFEVPITYNCRRLNVERRVRYQYINILSRKY--------HAKRRSKRRRQANSLPTPENS 52
           MF++P+     R    R++RYQYIN L RKY         A   S+     N + TPENS
Sbjct: 1   MFQLPVIDRSSRNRKRRKIRYQYINSLKRKYDQLNYNQSEASVSSEADNVTNGILTPENS 60

Query: 53  AVENDQSESQLPSREQIKEKKMKLGEDYSDSEAETSSEGEDTTKDDNEFANDMNKFEKLF 112
               + SE++    E+   +K +L      S    + +  D   D +E   D N  E  F
Sbjct: 61  ----ESSEAEAADLEKKHRRKRRL-----QSVLGNALDSSDEELDGDEDGTDENDPETQF 111

Query: 113 YRKYEKPEHSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIAKKRVEKNVVHMPLVN 172
           Y  + KP+H+FEVW    +VNT  +  +++  I Y  + ++E+ A K V K + +     
Sbjct: 112 YESHIKPQHTFEVW----NVNTALRTPIQRKKITYNAVKKLEKAATKSVTKKLNYQTKKL 167

Query: 173 KRYFDIKSEGYEVLEPLVDIDSYLLKHIEILTQILFSSVSQGNWDIAYRTFSLLIRIPEV 232
             YF     G++V  P   +      H+  L Q+L+++V   NW+IAYR FS+LIR+ +V
Sbjct: 168 NMYFQALKFGFDVY-PKPQLSKQKTMHLAHLNQLLYTNVLNQNWEIAYRCFSILIRLEDV 226

Query: 233 DIRNIWGLGTRILMERGQTTRSLEFLKWMSTVYSSKQNFVQSHCHRKAPVFRSGSRTHTP 292
           D+R++W +G+ IL   G T  +  +L+W++ V+ S+  F Q   +   PVFR GSRTHTP
Sbjct: 227 DVRSLWSIGSEILNSLGDTQSNEAYLEWLAHVFPSRVQFNQGTNYSLDPVFRCGSRTHTP 286

Query: 293 KYALTWLWNCLIKVTELISIXXXXXXXXXXXXXDNGSKQSAMDK---LTELIDKISEMVL 349
            + LTWLW  L   T                     S  SA+DK   L  LID++ EMVL
Sbjct: 287 TFVLTWLWTRLFIAT---------------------SGSSAVDKEKFLQSLIDRLDEMVL 325

Query: 350 VPPYLDDPEIWFIYSMCHMVHADYLSGKFNCQR--LSGSRRDIARNQVTQHIHYVKTYLQ 407
            PPY+DD EIW+I+ + H+V A  LS KF   +  L GSR DIARNQV QHI+  K  LQ
Sbjct: 326 SPPYMDDSEIWYIFGLTHLVMASELSSKFRQSKDILLGSRADIARNQVIQHINNAKNCLQ 385

Query: 408 NCSQKGNFEYPKQFIQSRLEEFEKRMYEDESKPENMKLQESYDNTSYSNEDDEENPFQID 467
            C    N+E+P+  I+ +L + E+ +Y DE     + +  + ++   S+ED  E+ +  +
Sbjct: 386 MCKANSNYEFPENVIEHQLVQLERSLYTDE-----LSVNCTDESAKSSDEDGIEHSYPNE 440

Query: 468 ESN 470
           +SN
Sbjct: 441 DSN 443

>ACL020W [1029] [Homologous to ScYML043C (RRN11) - NSH]
           complement(326268..327887) [1620 bp, 539 aa]
          Length = 539

 Score =  256 bits (653), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 158/489 (32%), Positives = 253/489 (51%), Gaps = 52/489 (10%)

Query: 1   MFEVPITYNCRRLNVERRVRYQYINILSRKY-HAKRRSKRRRQAN----SLPTPENSA-- 53
           MFE PI    +R   +R ++Y+Y++ + RKY      S   +QA+      PTP+NSA  
Sbjct: 46  MFESPIVSYSKRSKQQRALKYKYVSCVRRKYEQLNGLSDSDKQAHIDSACFPTPDNSAAE 105

Query: 54  ------VENDQSESQLPSREQIKEKKMKLGEDYSDSE-AETSSEGEDTTKDDNEFANDMN 106
                 +E D   +    + +    +  LG    D+E  +  SE ED    D    +   
Sbjct: 106 ASDGDALEGDVDTAARRLKRKRLRLQSILGHATLDAEEGDLGSEEED----DLNGGSTAK 161

Query: 107 KFEKLFYRKYEKPEHSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIAKKRVEKNVV 166
            +EK F+ +Y KPE+++E+W    + + K +  +++  + Y    ++E  + +R++  + 
Sbjct: 162 DYEKQFFARYYKPEYTYELW----ATSPKNRVPIRRKMLSYQAFKQIENYSNQRMKATLS 217

Query: 167 HMPLVNKRYFDIKSEGYEVLEPLVDIDSYLLKHIEILTQILFSSVSQGNWDIAYRTFSLL 226
                   Y ++   GYE   P  ++ +Y   H+  L  +L+S++   NW  AYR F+LL
Sbjct: 218 LSTKKAAAYHEVMRLGYETC-PKEEVTNYQKLHLNHLVGLLYSNIISENWGTAYRCFALL 276

Query: 227 IRIPEVDIRNIWGLGTRILMERGQTTRSLEFLKWMSTVYSSKQNFVQSHCHRKAPVFRSG 286
           IR+  VD+R+IW LG+ IL          +FL+WM TV++S   F Q+  +   PVFRSG
Sbjct: 277 IRMKSVDLRSIWNLGSHILSHLNFDMHE-KFLEWMGTVFTSHSVFSQNKVNLIDPVFRSG 335

Query: 287 SRTHTPKYALTWLWNCLIKVT--ELISIXXXXXXXXXXXXXDNGSKQSAMDKLTELIDKI 344
           SR HTP + L WLW  L   T  E++                      +   +  L++K+
Sbjct: 336 SRAHTPNFMLAWLWLVLRGATADEVL---------------------DSTRSMAWLLEKV 374

Query: 345 SEMVLVPPYLDDPEIWFIYSMCHMVHADYLSGKFNCQ---RLSGSRRDIARNQVTQHIHY 401
           SE+VL PPY+DD EIWF+Y+MC+ + AD LS +       +L GS+ DIA+ QVTQ+I  
Sbjct: 375 SELVLRPPYMDDAEIWFLYAMCYFIQADKLSAQLASHEGIKLHGSKLDIAKTQVTQYICS 434

Query: 402 VKTYLQNCSQKGNFEYPKQFIQSRLEEFEKRMYEDESKPENMKLQESYDNTSYSNEDDEE 461
           VK  L++C +KGNF YP++ IQ +L EFE+R+Y    K +      S+D       +  +
Sbjct: 435 VKNCLESCREKGNFTYPERIIQEQLLEFERRLYAGTHKEQTDG--NSFDTYESDTGEQND 492

Query: 462 NPFQIDESN 470
           NP  + E++
Sbjct: 493 NPTMVSETD 501

>Scas_611.0d
          Length = 153

 Score = 85.1 bits (209), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 61/91 (67%), Gaps = 1/91 (1%)

Query: 367 HMVHADYLSGKFNCQRLSGSRRDIARNQVTQHIHYVKTYLQNCSQKGNFEYPKQFIQSRL 426
           HMV AD LS  FN  + +GS RDIARN+V Q+I  VKT+LQ    KG+FEYP++FI  +L
Sbjct: 1   HMVKADQLSLNFNLNQSNGSARDIARNEVIQNIQLVKTFLQTAMSKGHFEYPERFITRQL 60

Query: 427 EEFEKRMY-EDESKPENMKLQESYDNTSYSN 456
             FE+R+Y +DE+  ++    ES + +S  N
Sbjct: 61  NTFEERLYSKDETNSKDKDNNESDNGSSMDN 91

>ABR149W [742] [Homologous to ScYBL047C (EDE1) - SH]
           complement(679579..683259) [3681 bp, 1226 aa]
          Length = 1226

 Score = 33.9 bits (76), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 70/164 (42%), Gaps = 13/164 (7%)

Query: 20  RYQYINILSRKYHAKRRSKRRRQANS-LPTPENSAVENDQSESQLPSRE-----QIKEKK 73
           R Q +N+ +R  ++   + R   A S   TP+N A+ +    S LP+       Q+ E+ 
Sbjct: 432 RSQPVNVANRGINSAENTSRSIPALSPQGTPQNQAMRHSSYISTLPTVPDFASLQVSEQL 491

Query: 74  MKLGEDYSDSEAETSSEGEDTTKDDNEFANDMNKFEKLFYRKYEKPEHSFEVWYDGNSVN 133
             + + Y DSE  TS +    T D    +N ++       +  E+ EH+ +     N + 
Sbjct: 492 APVKDIYMDSE--TSGQLSQATTDVANLSNQVSSLTTQVSKTTERKEHAQQELSRINELK 549

Query: 134 TKKKHELKKTHIHY----TRLNRVER-IAKKRVEKNVVHMPLVN 172
              + +L   H  Y     ++  VE+ + K R E  V+   L N
Sbjct: 550 ASLEAKLTTLHSSYQQETQQMEEVEQLLTKARAETEVLTQQLQN 593

>YJL039C (NUP192) [2872] chr10 complement(368664..373715) Nuclear
           pore protein (nucleoporin) located at the inner site of
           nuclear pores [5052 bp, 1683 aa]
          Length = 1683

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 1/51 (1%)

Query: 82  DSEAETSSEGEDTTKDDNEFANDMNKFEKLFYRKY-EKPEHSFEVWYDGNS 131
           D+E ++   GED T DD     D+ +F    Y  Y  +PE+S   W D  S
Sbjct: 455 DAEEDSLLSGEDLTLDDISLKADLERFFLSIYFFYASRPEYSCTFWSDKES 505

>YLR417W (VPS36) [3793] chr12 (955006..956706) Component of the
           endosomal sorting complex required for transport II
           (ESCRT-II), mutant displays a prominent novel
           pre-vacuolar organelle [1701 bp, 566 aa]
          Length = 566

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 10/55 (18%)

Query: 171 VNKRYFDIKSEGYEVL-EPLVDI-----DSYLLKHIEILTQILFSSVSQGNWDIA 219
           VNKR   + SE ++V+ E LVD+      S LL+    LTQIL S+ S+ NW + 
Sbjct: 480 VNKRILCVTSEKFDVVKEKLVDLIGDNPGSDLLR----LTQILSSNNSKSNWTLG 530

>Sklu_765.2 YGL079W, Contig c765 563-1195 reverse complement
          Length = 210

 Score = 29.3 bits (64), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 26/47 (55%)

Query: 107 KFEKLFYRKYEKPEHSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRV 153
           + +KL     +K +H  EV++DG   + + K+ L++     TR+NR 
Sbjct: 139 ELKKLIEEVQQKLQHFQEVFHDGAKTSKRIKYNLQQASSKITRINRA 185

>KLLA0B08657g 764962..767337 gi|4760392|gb|AAD29121.1|AF120714_1
           Kluyveromyces lactis COX2 mRNA-specific translational
           activator Pet111, start by similarity
          Length = 791

 Score = 29.3 bits (64), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 4/52 (7%)

Query: 184 EVLEPLVDIDSYLLKHIEILTQILFSSVSQGNWDIAYRTFSLLIRIPEVDIR 235
           E+L P ++       ++++L Q     V Q N+D+  +T +L+   PEVD+R
Sbjct: 352 EILIPQINRKERSFLYLQLLNQF----VEQNNYDMLQQTITLIKNDPEVDLR 399

>CAGL0G07623g complement(722781..724472) similar to sp|P37302
           Saccharomyces cerevisiae YBR286w APE3 vacuolar
           aminopeptidase Y, hypothetical start
          Length = 563

 Score = 29.3 bits (64), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 56/133 (42%), Gaps = 13/133 (9%)

Query: 25  NILSRKYHAKRRSKRRRQANSLPTPENSAVENDQSE--SQLPSREQIKEKKMKLGEDYSD 82
           NI++   H    +     A+S    E   + +D S   S L   +Q+   K+     ++ 
Sbjct: 324 NIIADTKHGDENNIVGLGAHSDSVEEGPGLNDDGSGTISLLTVAKQLTHFKINNKVRFAW 383

Query: 83  SEAETSSEGEDTTKDDNEFANDMNKFEKLFYRKY------EKPEHSFEVWYDGNSVNTKK 136
             AE     E+     N +AN ++K E L  R +        P + +EV+   N+VN   
Sbjct: 384 WAAE-----EEGLLGSNYYANSLSKEENLKLRVFMDYDMMASPNYEYEVYDANNTVNPPG 438

Query: 137 KHELKKTHIHYTR 149
             EL+  +I+Y +
Sbjct: 439 SQELRDLYINYYK 451

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.132    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,546,212
Number of extensions: 828863
Number of successful extensions: 6352
Number of sequences better than 10.0: 231
Number of HSP's gapped: 6473
Number of HSP's successfully gapped: 240
Length of query: 502
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 396
Effective length of database: 12,926,601
Effective search space: 5118933996
Effective search space used: 5118933996
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)