Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0J11770g65964931640.0
YMR008C (PLB1)66459722690.0
Scas_611.164657922650.0
YOL011W (PLB3)68659320640.0
Kwal_56.2251064160620540.0
Scas_644.870460519960.0
Sklu_1900.165859419820.0
KLLA0C05940g64058619700.0
Scas_685.367759519370.0
YMR006C (PLB2)70659119150.0
CAGL0E02321g70458918690.0
CAGL0J11748g69557617700.0
Scas_92.0d2362318111e-104
Sklu_2442.195844335761e-65
AAL027W5924245664e-64
Kwal_0.1735074165605e-64
KLLA0F12232g6804204881e-52
YNL012W (SPO1)6314104782e-51
CAGL0H03575g5144014661e-50
Scas_695.105533804372e-46
YGL064C (MRH4)56181667.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J11770g
         (649 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J11770g complement(1145135..1147114) highly similar to sp|P...  1223   0.0  
YMR008C (PLB1) [3972] chr13 complement(280590..282584) Phospholi...   878   0.0  
Scas_611.1                                                            877   0.0  
YOL011W (PLB3) [4805] chr15 (305349..307409) Phospholipase B (ly...   799   0.0  
Kwal_56.22510                                                         795   0.0  
Scas_644.8                                                            773   0.0  
Sklu_1900.1 YMR008C, Contig c1900 2946-4922 reverse complement        768   0.0  
KLLA0C05940g 524768..526690 gi|3169132|dbj|BAA28619.1 Kluyveromy...   763   0.0  
Scas_685.3                                                            750   0.0  
YMR006C (PLB2) [3971] chr13 complement(277561..279681) Phospholi...   742   0.0  
CAGL0E02321g 222466..224580 some similarities with sp|Q08108 Sac...   724   0.0  
CAGL0J11748g complement(1141497..1143584) similar to sp|Q03674 S...   686   0.0  
Scas_92.0d                                                            317   e-104
Sklu_2442.19 YNL012W, Contig c2442 32274-34028 reverse complement     226   1e-65
AAL027W [160] [Homologous to ScYNL012W (SPO1) - SH] complement(2...   222   4e-64
Kwal_0.173                                                            220   5e-64
KLLA0F12232g join(1129199..1129312,1129409..1131337) similar to ...   192   1e-52
YNL012W (SPO1) [4573] chr14 (609684..609788,609873..611663) Meio...   188   2e-51
CAGL0H03575g 331303..332847 similar to sp|P53541 Saccharomyces c...   184   1e-50
Scas_695.10                                                           172   2e-46
YGL064C (MRH4) [1915] chr7 complement(381524..383209) Member of ...    30   7.6  

>CAGL0J11770g complement(1145135..1147114) highly similar to
           sp|P39105 Saccharomyces cerevisiae YMR008c PLB1 or
           sp|Q08108 Saccharomyces cerevisiae YOL011w PLB3 or
           sp|Q03674 Saccharomyces cerevisiae YMR006c PLB2, start
           by similarity
          Length = 659

 Score = 1223 bits (3164), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 600/649 (92%), Positives = 600/649 (92%)

Query: 1   MQLQDLVVTVSLLAAFNGGVEAWSPTNSYVPANVTCPNDINLLRNATGLSQSEIDWLKKR 60
           MQLQDLVVTVSLLAAFNGGVEAWSPTNSYVPANVTCPNDINLLRNATGLSQSEIDWLKKR
Sbjct: 1   MQLQDLVVTVSLLAAFNGGVEAWSPTNSYVPANVTCPNDINLLRNATGLSQSEIDWLKKR 60

Query: 61  DVNTREALESFLKRVXXXXXXXXXXXXLIDQLFSTNSSNIPKIGIAASGGGYRAMLSGAG 120
           DVNTREALESFLKRV            LIDQLFSTNSSNIPKIGIAASGGGYRAMLSGAG
Sbjct: 61  DVNTREALESFLKRVTSNFTSNSSASNLIDQLFSTNSSNIPKIGIAASGGGYRAMLSGAG 120

Query: 121 MVSAMDNRTDGANEHGLGGLLQAATYLAGLSGGXXXXXXXXXXXXXXVQDIVDSQDNDSA 180
           MVSAMDNRTDGANEHGLGGLLQAATYLAGLSGG              VQDIVDSQDNDSA
Sbjct: 121 MVSAMDNRTDGANEHGLGGLLQAATYLAGLSGGNWLTTTLSWNNWTSVQDIVDSQDNDSA 180

Query: 181 IWDISHSIVSPGGINIFKTGSRWDHISDAVEDKQKAGFNVSLADVWGRALSYQFFPTLYR 240
           IWDISHSIVSPGGINIFKTGSRWDHISDAVEDKQKAGFNVSLADVWGRALSYQFFPTLYR
Sbjct: 181 IWDISHSIVSPGGINIFKTGSRWDHISDAVEDKQKAGFNVSLADVWGRALSYQFFPTLYR 240

Query: 241 GGVAYLWSDLRESDVFKNAEMPMPISVADGRYPGTAVIDLNSTVFEYSPFELGSWDPSLS 300
           GGVAYLWSDLRESDVFKNAEMPMPISVADGRYPGTAVIDLNSTVFEYSPFELGSWDPSLS
Sbjct: 241 GGVAYLWSDLRESDVFKNAEMPMPISVADGRYPGTAVIDLNSTVFEYSPFELGSWDPSLS 300

Query: 301 AFTDVQYLGTKVSDGKPAEEGKCIAGFDNVGFLMGTSSTLFNQFLLRINDTSIPKFIRNL 360
           AFTDVQYLGTKVSDGKPAEEGKCIAGFDNVGFLMGTSSTLFNQFLLRINDTSIPKFIRNL
Sbjct: 301 AFTDVQYLGTKVSDGKPAEEGKCIAGFDNVGFLMGTSSTLFNQFLLRINDTSIPKFIRNL 360

Query: 361 ATHFLKDLSEDYDDIAVYAPNPFRDADYVNNNRSKSLSESEYLFLVDGGEDGQNVPLVPL 420
           ATHFLKDLSEDYDDIAVYAPNPFRDADYVNNNRSKSLSESEYLFLVDGGEDGQNVPLVPL
Sbjct: 361 ATHFLKDLSEDYDDIAVYAPNPFRDADYVNNNRSKSLSESEYLFLVDGGEDGQNVPLVPL 420

Query: 421 IQQERDLDIVFALDNSADTEENWPDGASLMHTYRRQFGFQGQGVTFPSVPGTDTFVNLGL 480
           IQQERDLDIVFALDNSADTEENWPDGASLMHTYRRQFGFQGQGVTFPSVPGTDTFVNLGL
Sbjct: 421 IQQERDLDIVFALDNSADTEENWPDGASLMHTYRRQFGFQGQGVTFPSVPGTDTFVNLGL 480

Query: 481 NKKPTFFGCDARNMTDLEYIPPLIVYIPNSRHSYNGNTSTFKLSYSEKERLGVIRNGFEA 540
           NKKPTFFGCDARNMTDLEYIPPLIVYIPNSRHSYNGNTSTFKLSYSEKERLGVIRNGFEA
Sbjct: 481 NKKPTFFGCDARNMTDLEYIPPLIVYIPNSRHSYNGNTSTFKLSYSEKERLGVIRNGFEA 540

Query: 541 ATMNNLTADSNFAGCIGCAIMRRKQQALNLTLPKECETCFTNYCWNGTIDNTPAKGVTAS 600
           ATMNNLTADSNFAGCIGCAIMRRKQQALNLTLPKECETCFTNYCWNGTIDNTPAKGVTAS
Sbjct: 541 ATMNNLTADSNFAGCIGCAIMRRKQQALNLTLPKECETCFTNYCWNGTIDNTPAKGVTAS 600

Query: 601 NDFDNASGSAAADMXXXXXXXXXXXXXXXXXXXXXXXVDVNAKTLFAII 649
           NDFDNASGSAAADM                       VDVNAKTLFAII
Sbjct: 601 NDFDNASGSAAADMAEQDASGAASASSSSRKKNAAVSVDVNAKTLFAII 649

>YMR008C (PLB1) [3972] chr13 complement(280590..282584)
           Phospholipase B, preferentially deacylates
           phosphatidylcholine and phosphatidylethanolamine [1995
           bp, 664 aa]
          Length = 664

 Score =  878 bits (2269), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/597 (68%), Positives = 491/597 (82%), Gaps = 4/597 (0%)

Query: 1   MQLQDLVVTVSLLAAFNGGVEAWSPTNSYVPANVTCPNDINLLRNATGLSQSEIDWLKKR 60
           M+LQ L+V+ ++L +    V AWSP NSYVPANVTC +DINL+R A+GLS +E +WLKKR
Sbjct: 1   MKLQSLLVSAAVLTSLTENVNAWSPNNSYVPANVTCDDDINLVREASGLSDNETEWLKKR 60

Query: 61  DVNTREALESFLKRVXXXXXXXXXXXXLIDQLFSTNSSNIPKIGIAASGGGYRAMLSGAG 120
           D  T+EAL SFL R             L+  LF +NSSN+PKI +A SGGGYRAMLSGAG
Sbjct: 61  DAYTKEALHSFLNRATSNFSDTS----LLSTLFGSNSSNMPKIAVACSGGGYRAMLSGAG 116

Query: 121 MVSAMDNRTDGANEHGLGGLLQAATYLAGLSGGXXXXXXXXXXXXXXVQDIVDSQDNDSA 180
           M++AMDNRTDGANEHGLGGLLQ ATYLAGLSGG              VQ IVD+    ++
Sbjct: 117 MLAAMDNRTDGANEHGLGGLLQGATYLAGLSGGNWLTSTLAWNNWTSVQAIVDNTTESNS 176

Query: 181 IWDISHSIVSPGGINIFKTGSRWDHISDAVEDKQKAGFNVSLADVWGRALSYQFFPTLYR 240
           IWDISHSI++P GINIFKTGSRWD ISD V+DK+ AGFN+SLADVWGRAL+Y F+P+L+R
Sbjct: 177 IWDISHSILTPDGINIFKTGSRWDDISDDVQDKKDAGFNISLADVWGRALAYNFWPSLHR 236

Query: 241 GGVAYLWSDLRESDVFKNAEMPMPISVADGRYPGTAVIDLNSTVFEYSPFELGSWDPSLS 300
           GGV Y WS LRE+DVFKN EMP PI+VADGRYPGT VI+LN+T+FE++PFE+GSWDP+L+
Sbjct: 237 GGVGYTWSTLREADVFKNGEMPFPITVADGRYPGTTVINLNATLFEFNPFEMGSWDPTLN 296

Query: 301 AFTDVQYLGTKVSDGKPAEEGKCIAGFDNVGFLMGTSSTLFNQFLLRINDTSIPKFIRNL 360
           AFTDV+YLGT V++GKP  +G+CIAGFDN GF+  TSSTLFNQFLLR+N T +P FI NL
Sbjct: 297 AFTDVKYLGTNVTNGKPVNKGQCIAGFDNTGFITATSSTLFNQFLLRLNSTDLPSFIANL 356

Query: 361 ATHFLKDLSEDYDDIAVYAPNPFRDADYVNNNRSKSLSESEYLFLVDGGEDGQNVPLVPL 420
           AT FL+DLS++ DDIA+YAPNPF++A+++  N + S+ ESEYLFLVDGGED QN+PLVPL
Sbjct: 357 ATDFLEDLSDNSDDIAIYAPNPFKEANFLQKNATSSIIESEYLFLVDGGEDNQNIPLVPL 416

Query: 421 IQQERDLDIVFALDNSADTEENWPDGASLMHTYRRQFGFQGQGVTFPSVPGTDTFVNLGL 480
           +Q+ER+LD++FALDNSADT++ WPDGASL++TY+RQFG QG  ++FP VP  +TFVNLGL
Sbjct: 417 LQKERELDVIFALDNSADTDDYWPDGASLVNTYQRQFGSQGLNLSFPYVPDVNTFVNLGL 476

Query: 481 NKKPTFFGCDARNMTDLEYIPPLIVYIPNSRHSYNGNTSTFKLSYSEKERLGVIRNGFEA 540
           NKKPTFFGCDARN+TDLEYIPPLIVYIPNSRHS+NGN STFK+SYS+ ERLG+I+NGFEA
Sbjct: 477 NKKPTFFGCDARNLTDLEYIPPLIVYIPNSRHSFNGNQSTFKMSYSDSERLGMIKNGFEA 536

Query: 541 ATMNNLTADSNFAGCIGCAIMRRKQQALNLTLPKECETCFTNYCWNGTIDNTPAKGV 597
           ATM N T DS+F GC+GCAI+RRKQQ LN TLP EC  CFTNYCWNGTID+    GV
Sbjct: 537 ATMGNFTDDSDFLGCVGCAIIRRKQQNLNATLPSECSQCFTNYCWNGTIDSRSVSGV 593

>Scas_611.1
          Length = 646

 Score =  877 bits (2265), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/579 (70%), Positives = 476/579 (82%), Gaps = 4/579 (0%)

Query: 20  VEAWSPTNSYVPANVTCPNDINLLRNATGLSQSEIDWLKKRDVNTREALESFLKRVXXXX 79
           V AWSP+NSYVPANVTC ++INL+R A  LS  E  WL KRD  T EALESFLKR     
Sbjct: 18  VGAWSPSNSYVPANVTCDDNINLIREANSLSDDEKSWLTKRDAITSEALESFLKR----S 73

Query: 80  XXXXXXXXLIDQLFSTNSSNIPKIGIAASGGGYRAMLSGAGMVSAMDNRTDGANEHGLGG 139
                   LI QLFS NSS+ P+IG+A SGGGYRAMLSGAGMV+AMDNRTDGANEHGLGG
Sbjct: 74  TSNFSDTSLISQLFSGNSSSAPRIGVACSGGGYRAMLSGAGMVAAMDNRTDGANEHGLGG 133

Query: 140 LLQAATYLAGLSGGXXXXXXXXXXXXXXVQDIVDSQDNDSAIWDISHSIVSPGGINIFKT 199
           LLQ ATYLAGLSGG              VQ I+++  ND +IWDISHSI++PGG NI +T
Sbjct: 134 LLQGATYLAGLSGGNWLTSTLGWNNWTSVQAILNNMTNDDSIWDISHSIINPGGWNILET 193

Query: 200 GSRWDHISDAVEDKQKAGFNVSLADVWGRALSYQFFPTLYRGGVAYLWSDLRESDVFKNA 259
           G RWDHISDAV+ KQ AGFN+SLADVWGRALSY FFP+LYRGG  Y WS LR++DVFKNA
Sbjct: 194 GERWDHISDAVQAKQDAGFNISLADVWGRALSYNFFPSLYRGGQGYTWSTLRDADVFKNA 253

Query: 260 EMPMPISVADGRYPGTAVIDLNSTVFEYSPFELGSWDPSLSAFTDVQYLGTKVSDGKPAE 319
           EMP PISVADGRYPGT VI+LN+TVFE++PFE+GSWDP+L+ FTDV+YLGT VS+GKP  
Sbjct: 254 EMPFPISVADGRYPGTTVINLNATVFEFNPFEMGSWDPTLNTFTDVKYLGTNVSNGKPIT 313

Query: 320 EGKCIAGFDNVGFLMGTSSTLFNQFLLRINDTSIPKFIRNLATHFLKDLSEDYDDIAVYA 379
           EGKCIAGFDN GF+ GTSSTLFNQFLL IN TS+P FI  LA+HFL DLS DY+DIA+Y+
Sbjct: 314 EGKCIAGFDNTGFITGTSSTLFNQFLLHINSTSLPSFITKLASHFLNDLSADYNDIAIYS 373

Query: 380 PNPFRDADYVNNNRSKSLSESEYLFLVDGGEDGQNVPLVPLIQQERDLDIVFALDNSADT 439
           PNPFRDAD++ +N SKS+ +S+ LFLVDGGED QN+PLVPL+Q+ER+LD++FALDNSADT
Sbjct: 374 PNPFRDADFIASNYSKSIVQSKDLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSADT 433

Query: 440 EENWPDGASLMHTYRRQFGFQGQGVTFPSVPGTDTFVNLGLNKKPTFFGCDARNMTDLEY 499
            ++WPDGASL++TY RQFG QG G+ FP VP  +TFVNLGLNK+PTFFGCDARN+TDLEY
Sbjct: 434 NQSWPDGASLVNTYERQFGMQGNGMAFPYVPDKNTFVNLGLNKRPTFFGCDARNLTDLEY 493

Query: 500 IPPLIVYIPNSRHSYNGNTSTFKLSYSEKERLGVIRNGFEAATMNNLTADSNFAGCIGCA 559
           IPPL+VYIPN+RHS+NGN STFK+SYS  ER  +I+NGFE+AT  N T DS+F GCIGCA
Sbjct: 494 IPPLVVYIPNARHSFNGNQSTFKMSYSTSERFSMIQNGFESATRGNFTDDSDFLGCIGCA 553

Query: 560 IMRRKQQALNLTLPKECETCFTNYCWNGTIDNTPAKGVT 598
           IMRRKQQ++N TLP EC  CFTNYCWNGTIDNTPAK  T
Sbjct: 554 IMRRKQQSMNATLPTECNQCFTNYCWNGTIDNTPAKDST 592

>YOL011W (PLB3) [4805] chr15 (305349..307409) Phospholipase B
           (lysophospholipase) [2061 bp, 686 aa]
          Length = 686

 Score =  799 bits (2064), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/593 (62%), Positives = 465/593 (78%), Gaps = 4/593 (0%)

Query: 6   LVVTVSLLAAFNGGVEAWSPTNSYVPANVTCPNDINLLRNATGLSQSEIDWLKKRDVNTR 65
           ++  +  ++ F     AWSPT+SYVP  V+CP+DINL+R AT +SQ+E  WL+KR+  T 
Sbjct: 10  IISYIFAISQFLLAANAWSPTDSYVPGTVSCPDDINLVREATSISQNESAWLEKRNKVTS 69

Query: 66  EALESFLKRVXXXXXXXXXXXXLIDQLFST-NSSNIPKIGIAASGGGYRAMLSGAGMVSA 124
            AL+ FL R             ++ +LF+  NS N+PKI +A SGGGYR+ML+GAG+++A
Sbjct: 70  VALKDFLTRATANFSDSSE---VLSKLFNDGNSENLPKIAVAVSGGGYRSMLTGAGVLAA 126

Query: 125 MDNRTDGANEHGLGGLLQAATYLAGLSGGXXXXXXXXXXXXXXVQDIVDSQDNDSAIWDI 184
           MDNRT+GA EHGLGGLLQ+ TYL+G SGG              VQDI+++  ND +IWD+
Sbjct: 127 MDNRTEGAYEHGLGGLLQSTTYLSGASGGNWLVGTLALNNWTSVQDILNNMQNDDSIWDL 186

Query: 185 SHSIVSPGGINIFKTGSRWDHISDAVEDKQKAGFNVSLADVWGRALSYQFFPTLYRGGVA 244
           S SIV+PGGINIFKT  RWDHIS+AVE KQ A +N SLAD+WGRAL+Y FFP+L RGG+ 
Sbjct: 187 SDSIVTPGGINIFKTAKRWDHISNAVESKQNADYNTSLADIWGRALAYNFFPSLNRGGIG 246

Query: 245 YLWSDLRESDVFKNAEMPMPISVADGRYPGTAVIDLNSTVFEYSPFELGSWDPSLSAFTD 304
             WS +R+  VF+NAEMP PISVADGRYPGT VI+LN+TVFE++PFE+GSWDPSL++F +
Sbjct: 247 LTWSSIRDFPVFQNAEMPFPISVADGRYPGTKVINLNATVFEFNPFEMGSWDPSLNSFAN 306

Query: 305 VQYLGTKVSDGKPAEEGKCIAGFDNVGFLMGTSSTLFNQFLLRINDTSIPKFIRNLATHF 364
           V+YLGT VS+G P E GKC AGFDN GF+MGTSSTLFNQFLLRIN T +P FI  LA HF
Sbjct: 307 VKYLGTNVSNGVPLERGKCTAGFDNAGFIMGTSSTLFNQFLLRINSTHLPSFITRLARHF 366

Query: 365 LKDLSEDYDDIAVYAPNPFRDADYVNNNRSKSLSESEYLFLVDGGEDGQNVPLVPLIQQE 424
           LKDLS+D++DIAVY+PNPF+D  +++++ + S+ +S+ LFLVDGGED +NVP++PLIQ+E
Sbjct: 367 LKDLSQDFNDIAVYSPNPFKDTKFLDSDYTTSIVDSDSLFLVDGGEDDENVPVLPLIQKE 426

Query: 425 RDLDIVFALDNSADTEENWPDGASLMHTYRRQFGFQGQGVTFPSVPGTDTFVNLGLNKKP 484
           RD+DI+FA+DNSAD    WPDG+SL+HTY RQF  QGQG++FP VP T+TFVNLGLNKKP
Sbjct: 427 RDVDIIFAVDNSADMRLAWPDGSSLVHTYERQFVKQGQGMSFPYVPDTNTFVNLGLNKKP 486

Query: 485 TFFGCDARNMTDLEYIPPLIVYIPNSRHSYNGNTSTFKLSYSEKERLGVIRNGFEAATMN 544
           TFFGCDA N+TDL+YIPPL+VY+PN+ +S+N N S FKLSYSE +R  +I+NGFE AT N
Sbjct: 487 TFFGCDANNLTDLQYIPPLVVYLPNAEYSFNSNQSAFKLSYSESQRRSMIQNGFEIATRN 546

Query: 545 NLTADSNFAGCIGCAIMRRKQQALNLTLPKECETCFTNYCWNGTIDNTPAKGV 597
           N T D  F GC+GCAI+RRKQQALN+TLP ECETCF NYCWNGT+D TP   V
Sbjct: 547 NFTDDPEFMGCVGCAIIRRKQQALNITLPPECETCFKNYCWNGTLDTTPLPDV 599

>Kwal_56.22510
          Length = 641

 Score =  795 bits (2054), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/606 (61%), Positives = 460/606 (75%), Gaps = 10/606 (1%)

Query: 6   LVVTVSLLAAFNGGVEAWSPTNSYVPANVTCPNDINLLRNATGLSQSEIDWLKKRDVNTR 65
           ++  +SLL A    V+AWSPT+SYVP NV+C +DINL+R A+ LS +E +WLKKRD  T+
Sbjct: 1   MLWILSLLLAAISAVQAWSPTDSYVPGNVSCADDINLVRKASSLSPNETEWLKKRDAYTK 60

Query: 66  EALESFLKRVXXXXXXXXXXXXLIDQLFSTNSSNIPKIGIAASGGGYRAMLSGAGMVSAM 125
           EAL +FL R             L+D ++   S  IP+I +A SGGGYRAMLSGAGM+SAM
Sbjct: 61  EALRTFLDRATSNFSNSS----LVDNVWK--SGKIPRIAVACSGGGYRAMLSGAGMLSAM 114

Query: 126 DNRTDGANEHGLGGLLQAATYLAGLSGGXXXXXXXXXXXXXXVQDIVDSQDNDSAIWDIS 185
           DNRT+GA EHGLGGLLQ+ TYLAGLSGG              VQ I+D++  D  +WDIS
Sbjct: 115 DNRTNGATEHGLGGLLQSTTYLAGLSGGNWLVGSLAWNNWTSVQHIIDTRGTDDELWDIS 174

Query: 186 HSIVSPGGINIFKTGSRWDHISDAVEDKQKAGFNVSLADVWGRALSYQFFPTLYRGGVAY 245
           +SI++PGG+NI  + +RWD ISDAVE K  AGFN SLADVWGRALSY FFPTLY+GG+ Y
Sbjct: 175 NSILNPGGVNILTSANRWDQISDAVEAKGDAGFNTSLADVWGRALSYDFFPTLYKGGLGY 234

Query: 246 LWSDLRESDVFKNAEMPMPISVADGRYPGTAVIDLNSTVFEYSPFELGSWDPSLSAFTDV 305
            WS LR++DVFKN EMP PISVADGRYPGT +IDLNST+FE++PFE+GSWDPSL+AFTDV
Sbjct: 235 TWSTLRDADVFKNGEMPFPISVADGRYPGTQIIDLNSTLFEFNPFEMGSWDPSLNAFTDV 294

Query: 306 QYLGTKVSDGKPAEEGKCIAGFDNVGFLMGTSSTLFNQFLLRINDTSIPKFIRNLATHFL 365
           +YLGT+V +G P  +G+C+AGFDN GF+MGTSSTLFNQFLL++N TS+  F++     FL
Sbjct: 295 KYLGTEVKNGTPVTQGQCVAGFDNTGFVMGTSSTLFNQFLLQLNTTSVSSFLKGFIQDFL 354

Query: 366 KDLSEDYDDIAVYAPNPFRDADYVNNNRSKSLSESEYLFLVDGGEDGQNVPLVPLIQQER 425
           +DLSED +DIA+Y PNPFRD  YV+ N +  +  SE LFLVDGGEDG+N+PLVPLIQQ+R
Sbjct: 355 QDLSEDSNDIAIYNPNPFRDTAYVDKNYTHGIVNSENLFLVDGGEDGENIPLVPLIQQDR 414

Query: 426 DLDIVFALDNSADTEENWPDGASLMHTYRRQFGFQGQGVTFPSVPGTDTFVNLGLNKKPT 485
           D+D++FALDNSADT+E WP G SLMHTY RQFG QG+ + FP VP  DTFVN GLN KP 
Sbjct: 415 DVDVIFALDNSADTDEYWPAGLSLMHTYERQFGPQGKDIAFPYVPDVDTFVNEGLNTKPV 474

Query: 486 FFGCDARNMTDLEYIPPLIVYIPNSRHSYNGNTSTFKLSYSEKERLGVIRNGFEAATMNN 545
           FFGCDA N +DL Y PPLIVY+PN+R SYN NTSTFK+SYS  +R+ + +NGFEA T NN
Sbjct: 475 FFGCDATNTSDLAYTPPLIVYMPNNRQSYNSNTSTFKMSYSSSQRMKMYQNGFEAITRNN 534

Query: 546 LTADSNFAGCIGCAIMRRKQQALNLTLPKECETCFTNYCWNGTIDNTPAKGVTASNDFDN 605
           LT DSNF GC+ CA++RRKQ++ N+T P+EC  CF NYCW+G      +K  +     DN
Sbjct: 535 LTDDSNFMGCVACAVLRRKQESQNMTFPEECTKCFQNYCWDGKT----SKKTSNVTTLDN 590

Query: 606 ASGSAA 611
            SGS +
Sbjct: 591 YSGSMS 596

>Scas_644.8
          Length = 704

 Score =  773 bits (1996), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/605 (60%), Positives = 458/605 (75%), Gaps = 12/605 (1%)

Query: 1   MQLQDLVVTVSLLAAFNGGVEAWSPTNSYVPANVTCPN--------DINLLRNATGLSQS 52
           M L  L   V ++ + +    AW+P+NSY P+ + C          D +L+R A  +S +
Sbjct: 1   MILIPLYCFVYIIVSLSHTAYAWAPSNSYAPSYMDCKQALGSAFNEDFSLIREADSISHN 60

Query: 53  EIDWLKKRDVNTREALESFLKRVXXXXXXXXX--XXXLIDQLFSTNSSNIPKIGIAASGG 110
           E  WL+KR  NTRE L  FL R               L+  L  ++S++ PKIGIA SGG
Sbjct: 61  ESLWLQKRMQNTREPLLQFLNRSLTSLNTSSSFDTAALLSSLMGSDSASQPKIGIAVSGG 120

Query: 111 GYRAMLSGAGMVSAMDNRTDGANEHGLGGLLQAATYLAGLSGGXXXXXXXXXXXXXXVQD 170
           GYR+ML+GAG+++AMDNRT GA  HGLGGLLQ+ TYL+G SGG              VQ 
Sbjct: 121 GYRSMLTGAGILAAMDNRTRGAQHHGLGGLLQSTTYLSGASGGNWLVGTLAYNNWTSVQS 180

Query: 171 IVDSQDNDSAIWDISHSIVSPGGINIFKTGSRWDHISDAVEDKQKAGFNVSLADVWGRAL 230
           I+D+ +   +IWD+S SIVSPGG NIFK+  RWDHISDA++DKQKAGF+ SLADVWGRAL
Sbjct: 181 IIDNFNESDSIWDLSESIVSPGGKNIFKSARRWDHISDALQDKQKAGFDTSLADVWGRAL 240

Query: 231 SYQFFPTLYRGGVAYLWSDLRESDVFKNAEMPMPISVADGRYPGTAVIDLNSTVFEYSPF 290
           SY+FFP+LYRGGVAY WS LR+S VF   +MP PISVADGRYPG+ V++LN+TVFE++PF
Sbjct: 241 SYKFFPSLYRGGVAYTWSSLRDSPVFTEGQMPFPISVADGRYPGSKVLNLNATVFEFNPF 300

Query: 291 ELGSWDPSLSAFTDVQYLGTKVSDGKPAEEGKCIAGFDNVGFLMGTSSTLFNQFLLRIND 350
           E+GSWDPSL+ FTDV++LGT VS GKP +  +C+ GFDN  F+MGTSSTLFNQFLLRIN 
Sbjct: 301 EMGSWDPSLNTFTDVKFLGTNVSAGKPIDSQRCVQGFDNTAFIMGTSSTLFNQFLLRINS 360

Query: 351 TS--IPKFIRNLATHFLKDLSEDYDDIAVYAPNPFRDADYVNNNRSKSLSESEYLFLVDG 408
           T+  +P FI  LATHFLKD+S+D++D+A Y PNPF+DA++++ N +KS+  S+ L+LVDG
Sbjct: 361 TNLHLPGFITKLATHFLKDISQDFNDVATYHPNPFKDANFIDANYTKSIVNSKSLYLVDG 420

Query: 409 GEDGQNVPLVPLIQQERDLDIVFALDNSADTEENWPDGASLMHTYRRQFGFQGQGVTFPS 468
           GED +N+PL+PLIQ+ERDLDIVFA+DNS D +  WPDG+SL+HT+ RQF  QGQG+ FP 
Sbjct: 421 GEDDENIPLLPLIQRERDLDIVFAIDNSMDMKLAWPDGSSLVHTFERQFVRQGQGMAFPY 480

Query: 469 VPGTDTFVNLGLNKKPTFFGCDARNMTDLEYIPPLIVYIPNSRHSYNGNTSTFKLSYSEK 528
           VPGTDTFVNLGLN+KPTFFGCDA N+TDLEYIPPL++Y+PN ++S+  N S FKLSY+E+
Sbjct: 481 VPGTDTFVNLGLNQKPTFFGCDAHNLTDLEYIPPLVIYLPNKQYSFPSNQSAFKLSYTEE 540

Query: 529 ERLGVIRNGFEAATMNNLTADSNFAGCIGCAIMRRKQQALNLTLPKECETCFTNYCWNGT 588
           +R  +I NGFE AT NN T D +F GCIGCAI+RRKQQ+LNLTLP+ C TCFTNYCWNGT
Sbjct: 541 QRRAMISNGFEIATRNNFTDDPDFLGCIGCAIIRRKQQSLNLTLPEGCNTCFTNYCWNGT 600

Query: 589 IDNTP 593
           +D TP
Sbjct: 601 LDTTP 605

>Sklu_1900.1 YMR008C, Contig c1900 2946-4922 reverse complement
          Length = 658

 Score =  768 bits (1982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/594 (62%), Positives = 450/594 (75%), Gaps = 16/594 (2%)

Query: 20  VEAWSPTNSYVPANVTCPNDINLLRNATGLSQSEIDWLKKRDVNTREALESFLKRVXXXX 79
           V AWSPTNSY P NVTC +DINL+R A GLS  E +WLKKR+V T  ALE FL R     
Sbjct: 14  VGAWSPTNSYTPGNVTCDDDINLVREAVGLSTDESEWLKKREVYTNSALEDFLNRATENF 73

Query: 80  XXXXXXXXLIDQLFSTNSSNIPKIGIAASGGGYRAMLSGAGMVSAMDNRTDGANEHGLGG 139
                   ++  LF  NSS+ P+IG+A SGGGYRAMLSGAGM++AMDNRT G+ EHGLGG
Sbjct: 74  TDNS----IVKTLF--NSSSAPRIGVACSGGGYRAMLSGAGMLAAMDNRTRGSVEHGLGG 127

Query: 140 LLQAATYLAGLSGGXXXXXXXXXXXXXXVQDIVDSQDNDSAIWDISHSIVSPGGINIFKT 199
           LLQ+ TYLAGLSGG              VQ I+D+   D  IWDIS+SI+SPGG N+ +T
Sbjct: 128 LLQSTTYLAGLSGGNWLVGTLAWNNWTSVQHILDTMGQDDDIWDISNSIISPGGTNVLET 187

Query: 200 GSRWDHISDAVEDKQKAGFNVSLADVWGRALSYQFFPTLYRGGVAYLWSDLRESDVFKNA 259
            SRWD ISDAV+ KQ AGFN SL DVWGRALSY FFPTL  GG AY WS LRE+DVFKNA
Sbjct: 188 TSRWDDISDAVDAKQDAGFNASLTDVWGRALSYDFFPTLPNGGDAYTWSTLREADVFKNA 247

Query: 260 EMPMPISVADGRYPGTAVIDLNSTVFEYSPFELGSWDPSLSAFTDVQYLGTKVSDGKPAE 319
           EMP PISVADGRYPGT VI+LN+TVFE++PFE+GSWD SL AFT+V+YLGTKV++G P  
Sbjct: 248 EMPFPISVADGRYPGTQVINLNATVFEFNPFEMGSWDRSLRAFTNVKYLGTKVNNGTPET 307

Query: 320 EGKCIAGFDNVGFLMGTSSTLFNQFLLRINDT------SIPKFIRNLATHFLKDLSEDYD 373
           +G+CIAGFDN GF+MGTSS+LFNQF L+ N T      S+P ++   A  FL  LS+DYD
Sbjct: 308 KGQCIAGFDNTGFIMGTSSSLFNQFSLQSNSTLMLLNASLPSYLYKFANKFLTGLSKDYD 367

Query: 374 DIAVYAPNPFRDADYVNNNRSKSLSESEYLFLVDGGEDGQNVPLVPLIQQERDLDIVFAL 433
           DIA+YAPNPF+  +YV  N ++S+ ESE L+LVDGGEDGQN+PL+PL+Q+ER+LD++FAL
Sbjct: 368 DIALYAPNPFKGTNYVFENYTRSIVESEILYLVDGGEDGQNIPLIPLLQEERELDVIFAL 427

Query: 434 DNSADTEENWPDGASLMHTYRRQFGFQGQGVTFPSVPGTDTFVNLGLNKKPTFFGCDARN 493
           DNSADT + WP+G SL  TY RQF  QG  + FP VP   TFV LGLNK+PTFFGCDA N
Sbjct: 428 DNSADTNQYWPNGFSLTQTYERQFEKQGDDIAFPYVPDVSTFVELGLNKRPTFFGCDATN 487

Query: 494 MTDLEYIPPLIVYIPNSRHSYNGNTSTFKLSYSEKERLGVIRNGFEAATMNNLTADSNFA 553
           +TDL+YIPPL+VY+PN++ S+N N STFKLSYS + R  +I+NGFEA T NNLT DS+F 
Sbjct: 488 LTDLDYIPPLVVYMPNTKESFNSNQSTFKLSYSSENRRAMIKNGFEAVTRNNLTDDSDFV 547

Query: 554 GCIGCAIMRRKQQALNLTLPKECETCFTNYCWNGTIDNTPAKGVTASNDFDNAS 607
            C+ CA++RRKQQ++N TLP+ECE CFTNYCWN   DN  +KG  + + ++N +
Sbjct: 548 SCVACAVIRRKQQSMNATLPEECEKCFTNYCWN---DNA-SKGSASISSYNNQT 597

>KLLA0C05940g 524768..526690 gi|3169132|dbj|BAA28619.1 Kluyveromyces
           lactis phospholipase B, start by similarity
          Length = 640

 Score =  763 bits (1970), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/586 (61%), Positives = 446/586 (76%), Gaps = 4/586 (0%)

Query: 5   DLVVTVSLLAAFNGGVEAWSPTNSYVPANVTCPNDINLLRNATGLSQSEIDWLKKRDVNT 64
           +L+  V  +A     V AWSPTN Y P  V C  +INL+R A  +S  E DWLK R  +T
Sbjct: 8   NLLFLVCSVALHLDAVNAWSPTNGYAPGVVDCDENINLVRKADAVSDDEADWLKVRHEST 67

Query: 65  REALESFLKRVXXXXXXXXXXXXLIDQLFSTNSSNIPKIGIAASGGGYRAMLSGAGMVSA 124
             AL+ FL+R             +ID+L +T  +  PK+ IA SGGGYRAMLSGAGM+SA
Sbjct: 68  VPALKDFLQR---GFKGFTNDTSIIDKLLATQDT-APKVAIACSGGGYRAMLSGAGMISA 123

Query: 125 MDNRTDGANEHGLGGLLQAATYLAGLSGGXXXXXXXXXXXXXXVQDIVDSQDNDSAIWDI 184
           MDNRTDGAN+HGLGGLLQ++TYLAGLSGG              VQ I+++  +D++IWDI
Sbjct: 124 MDNRTDGANDHGLGGLLQSSTYLAGLSGGNWLVGTLAYNNWTSVQAIINNMTDDNSIWDI 183

Query: 185 SHSIVSPGGINIFKTGSRWDHISDAVEDKQKAGFNVSLADVWGRALSYQFFPTLYRGGVA 244
           S+SIV+PGGINIF + SRWD ISDAVE+K+KAGFN S+ DVWGRALSY FFP+L  GGV 
Sbjct: 184 SNSIVNPGGINIFSSISRWDDISDAVEEKKKAGFNTSITDVWGRALSYNFFPSLDEGGVG 243

Query: 245 YLWSDLRESDVFKNAEMPMPISVADGRYPGTAVIDLNSTVFEYSPFELGSWDPSLSAFTD 304
           Y W+ LR+ DVFKN EMP PISVA GRYPGT V++LN+TVFE++PFE+GSWD +L  FTD
Sbjct: 244 YTWNTLRDVDVFKNGEMPFPISVAVGRYPGTQVVNLNATVFEFNPFEMGSWDYTLHTFTD 303

Query: 305 VQYLGTKVSDGKPAEEGKCIAGFDNVGFLMGTSSTLFNQFLLRINDTSIPKFIRNLATHF 364
           V+Y GT V++G P   GKC+AGFDN GF+MGTSS+LFNQFLL++N T +P F+ NL   F
Sbjct: 304 VRYAGTNVTNGTPNVTGKCVAGFDNTGFVMGTSSSLFNQFLLQLNTTDLPSFLYNLLHGF 363

Query: 365 LKDLSEDYDDIAVYAPNPFRDADYVNNNRSKSLSESEYLFLVDGGEDGQNVPLVPLIQQE 424
           L D S+DYDDI+++APNPF +   + +N S+S+SE + L+LVDGGEDGQN+PL PL+Q E
Sbjct: 364 LTDASDDYDDISIWAPNPFYEITNIPSNYSQSISEDDTLYLVDGGEDGQNIPLTPLLQTE 423

Query: 425 RDLDIVFALDNSADTEENWPDGASLMHTYRRQFGFQGQGVTFPSVPGTDTFVNLGLNKKP 484
           R++D++FALDNSADT+++WPDG SL  TY RQFG QG+G+ FP VP  +TF NLGLN +P
Sbjct: 424 REIDVIFALDNSADTDQSWPDGFSLTQTYARQFGLQGKGIAFPYVPDVNTFTNLGLNTRP 483

Query: 485 TFFGCDARNMTDLEYIPPLIVYIPNSRHSYNGNTSTFKLSYSEKERLGVIRNGFEAATMN 544
           TFFGCDARN+TDLE IPPL+VY+PN+R S+N NTSTFK+SYS  ER  +I+NGFEA TM 
Sbjct: 484 TFFGCDARNLTDLESIPPLVVYMPNTRESFNSNTSTFKMSYSTSERFKMIQNGFEAVTMK 543

Query: 545 NLTADSNFAGCIGCAIMRRKQQALNLTLPKECETCFTNYCWNGTID 590
           NLT D NF GCI CAI+RRKQ++LN TLP EC+ CF  YCWNGT+D
Sbjct: 544 NLTKDENFMGCISCAILRRKQESLNYTLPSECDACFEKYCWNGTVD 589

>Scas_685.3
          Length = 677

 Score =  750 bits (1937), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/595 (60%), Positives = 459/595 (77%), Gaps = 9/595 (1%)

Query: 1   MQLQDLVVTVSLLAAFNGGVEAWSPTNSYVPANVTCPNDINLLRNATGLSQSEIDWLKKR 60
           MQLQDL++   + A  +  V+AWSP+N Y PANVTC +D+NLLR A+ LS+ E DWLKKR
Sbjct: 1   MQLQDLLL---IAAISSNAVQAWSPSNGYAPANVTCADDVNLLREASDLSKDEQDWLKKR 57

Query: 61  DVNTREALESFLKRVXXXXXXXXXXXXLIDQLFSTNSSNIPKIGIAASGGGYRAMLSGAG 120
           +  T E+L++FL R             L+++LF  +  N+PKIGIAASGGGYRAML+GAG
Sbjct: 58  NTITAESLKTFLDR--STKNFSDSSSSLLNKLFQ-DGDNVPKIGIAASGGGYRAMLAGAG 114

Query: 121 MVSAMDNRTDGANEHGLGGLLQAATYLAGLSGGXXXXXXXXXXXXXXVQDIVDSQDNDSA 180
           M++AMDNRT GAN+HGLGGLLQ++TYLAGLSGG              VQDI+D+   +++
Sbjct: 115 MLAAMDNRTSGANDHGLGGLLQSSTYLAGLSGGNWLTTTLAWNNWTSVQDIIDNITVENS 174

Query: 181 IWDISHSIVSPGGINIFKTGSRWDHISDAVEDKQKAGFNVSLADVWGRALSYQFFPTLYR 240
           IWDI +S+ S   I+     S W  I++ V+ KQ AGFNV+LAD+WGRAL+Y FFP LY 
Sbjct: 175 IWDIDNSLFS---ISEMANSSIWTDIANDVKAKQDAGFNVTLADLWGRALAYNFFPDLYH 231

Query: 241 GGVAYLWSDLRESDVFKNAEMPMPISVADGRYPGTAVIDLNSTVFEYSPFELGSWDPSLS 300
           GG  Y WS LR+S+VFKNAEMP PI+VADGRYPGT VI LN+TVFE++PFE+GSWDP+L+
Sbjct: 232 GGAGYTWSTLRDSEVFKNAEMPFPITVADGRYPGTTVISLNATVFEFNPFEMGSWDPTLN 291

Query: 301 AFTDVQYLGTKVSDGKPAEEGKCIAGFDNVGFLMGTSSTLFNQFLLRINDTSIPKFIRNL 360
           +FTDV+YLGT VS+GKP + G+C+AGFDN GF++GTS+TLFN   L    + +PK +  L
Sbjct: 292 SFTDVKYLGTNVSNGKPIDAGQCVAGFDNAGFVLGTSATLFNLMPLPFTSSMLPKSLSVL 351

Query: 361 ATHFLKDLSEDYDDIAVYAPNPFRDADYVNNNRSKSLSESEYLFLVDGGEDGQNVPLVPL 420
             +F   L++ Y+DIA+Y+PNPFRDAD V +N SK++ +S+ LFLVDGGEDG+ +PLVPL
Sbjct: 352 GDNFTASLADTYNDIAIYSPNPFRDADSVKSNFSKAIVDSDDLFLVDGGEDGEVIPLVPL 411

Query: 421 IQQERDLDIVFALDNSADTEENWPDGASLMHTYRRQFGFQGQGVTFPSVPGTDTFVNLGL 480
           +Q++R LD+VFALD ++DT  +WPDG+SL+ TY+RQF  QG+G++FP VP T+TF+  GL
Sbjct: 412 LQEKRGLDVVFALDFNSDTTTSWPDGSSLVATYQRQFEDQGEGMSFPYVPDTETFIKYGL 471

Query: 481 NKKPTFFGCDARNMTDLEYIPPLIVYIPNSRHSYNGNTSTFKLSYSEKERLGVIRNGFEA 540
           N KPTFFGCDA+N+TDLEYIPPLIVYIPNSR+S+N NTST +LSY+  +RLG+I+NGFE+
Sbjct: 472 NTKPTFFGCDAKNLTDLEYIPPLIVYIPNSRYSFNSNTSTLQLSYNSSQRLGMIQNGFES 531

Query: 541 ATMNNLTADSNFAGCIGCAIMRRKQQALNLTLPKECETCFTNYCWNGTIDNTPAK 595
           AT  N T D  F GCIGCAIMRRKQQ+LN TLP ECE CFTNYCWNGT+  + AK
Sbjct: 532 ATRGNFTDDPEFLGCIGCAIMRRKQQSLNETLPSECEQCFTNYCWNGTLAGSVAK 586

>YMR006C (PLB2) [3971] chr13 complement(277561..279681)
           Phospholipase B2 (lysophospholipase), releases fatty
           acids from lysophospholipids [2121 bp, 706 aa]
          Length = 706

 Score =  742 bits (1915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/591 (58%), Positives = 452/591 (76%), Gaps = 6/591 (1%)

Query: 1   MQLQDLVVTVSLLAAFNGGVEAWSPT-NSYVPANVTCP-NDINLLRNATGLSQSEIDWLK 58
           MQL++++   SL++  +   ++ S T + Y P+ + CP +D +L+RNA+GLS +E DWLK
Sbjct: 1   MQLRNILQASSLISGLSLAADSSSTTGDGYAPSIIPCPSDDTSLVRNASGLSTAETDWLK 60

Query: 59  KRDVNTREALESFLKRVXXXXXXXXXXXXLIDQLFSTNSSNIPKIGIAASGGGYRAMLSG 118
           KRD  T+EAL SFL R             L+  LFS+NSSN+PKIGIA SGGGYRAML G
Sbjct: 61  KRDAYTKEALHSFLSRATSNFSDTS----LLSTLFSSNSSNVPKIGIACSGGGYRAMLGG 116

Query: 119 AGMVSAMDNRTDGANEHGLGGLLQAATYLAGLSGGXXXXXXXXXXXXXXVQDIVDSQDND 178
           AGM++AMDNRTDGANEHGLGGLLQ++TYL+GLSGG              VQ+IVD     
Sbjct: 117 AGMIAAMDNRTDGANEHGLGGLLQSSTYLSGLSGGNWLTGTLAWNNWTSVQEIVDHMSES 176

Query: 179 SAIWDISHSIVSPGGINIFKTGSRWDHISDAVEDKQKAGFNVSLADVWGRALSYQFFPTL 238
            +IW+I+ SIV+PGG N+  T  RW+ I   V+ K  AGFN+SL+D+W RALSY FFP+L
Sbjct: 177 DSIWNITKSIVNPGGSNLTYTIERWESIVQEVQAKSDAGFNISLSDLWARALSYNFFPSL 236

Query: 239 YRGGVAYLWSDLRESDVFKNAEMPMPISVADGRYPGTAVIDLNSTVFEYSPFELGSWDPS 298
              G A  WS LR+ DVFKN EMP+PI+VADGRYPGT VI+LN+T+FE++PFE+GSWDPS
Sbjct: 237 PDAGSALTWSSLRDVDVFKNGEMPLPITVADGRYPGTTVINLNATLFEFTPFEMGSWDPS 296

Query: 299 LSAFTDVQYLGTKVSDGKPAEEGKCIAGFDNVGFLMGTSSTLFNQFLLRINDTSIPKFIR 358
           L+AFTDV+YLGT V++GKP  + +C++G+DN GF++ TS++LFN+F L  + ++  K I 
Sbjct: 297 LNAFTDVKYLGTNVTNGKPVNKDQCVSGYDNAGFVIATSASLFNEFSLEASTSTYYKMIN 356

Query: 359 NLATHFLKDLSEDYDDIAVYAPNPFRDADYVNNNRSKSLSESEYLFLVDGGEDGQNVPLV 418
           + A  ++ +LS+D DDIA+YA NPF+D ++V+ N + S+ +++ LFLVDGGEDGQN+PLV
Sbjct: 357 SFANKYVNNLSQDDDDIAIYAANPFKDTEFVDRNYTSSIVDADDLFLVDGGEDGQNLPLV 416

Query: 419 PLIQQERDLDIVFALDNSADTEENWPDGASLMHTYRRQFGFQGQGVTFPSVPGTDTFVNL 478
           PLI++ERDLD+VFALD S +T+E+WP G  + +TY RQ+  QG+G+ FP VP  +TF+NL
Sbjct: 417 PLIKKERDLDVVFALDISDNTDESWPSGVCMTNTYERQYSKQGKGMAFPYVPDVNTFLNL 476

Query: 479 GLNKKPTFFGCDARNMTDLEYIPPLIVYIPNSRHSYNGNTSTFKLSYSEKERLGVIRNGF 538
           GL  KPTFFGCDA+N+TDLEYIPPL+VYIPN++HS+NGN ST K++Y+  ERLG+IRNGF
Sbjct: 477 GLTNKPTFFGCDAKNLTDLEYIPPLVVYIPNTKHSFNGNQSTLKMNYNVTERLGMIRNGF 536

Query: 539 EAATMNNLTADSNFAGCIGCAIMRRKQQALNLTLPKECETCFTNYCWNGTI 589
           EAATM N T DSNF GCIGCAI+RRKQ++LN TLP EC  CF +YCWNGT+
Sbjct: 537 EAATMGNFTDDSNFLGCIGCAIIRRKQESLNATLPPECTKCFADYCWNGTL 587

>CAGL0E02321g 222466..224580 some similarities with sp|Q08108
           Saccharomyces cerevisiae YOL011w PLB3 phospholipase B,
           hypothetical start
          Length = 704

 Score =  724 bits (1869), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/589 (58%), Positives = 435/589 (73%), Gaps = 19/589 (3%)

Query: 19  GVEAWSPTNSYVPANVTCP-NDINLLRNATGLSQSEIDWLKKRDVNTREALESFLKRVXX 77
           G   +S  + Y P    CP +DINL+R A+GLSQ+E  WL++RDV T+EAL +FL+R   
Sbjct: 16  GSSGYSVADQYAPKLAYCPSDDINLVREASGLSQNETQWLQRRDVRTKEALHNFLQRATS 75

Query: 78  XXXXXXXXXXLIDQLFSTNSSNIPKIGIAASGGGYRAMLSGAGMVSAMDNRTDGANEHGL 137
                     L  ++F  ++  +P+IGIA SGGGYR+ML+GAG++SA DNRT GA +HGL
Sbjct: 76  SSQNFTQ---LFHRIF--DAGMVPRIGIAVSGGGYRSMLTGAGILSAFDNRTRGAMDHGL 130

Query: 138 GGLLQAATYLAGLSGGXXXXXXXXXXXXXXVQDIVD-SQDNDSA----------IWDISH 186
           GG+LQ+ TY+ G SGG              VQDI+D + D  +A          IWD+S 
Sbjct: 131 GGILQSTTYMTGCSGGNWLVASLSWNNWTSVQDILDMNYDRKTARKQGKITKDPIWDLSD 190

Query: 187 SIVSPGGINIFKTGSRWDHISDAVEDKQKAGFNVSLADVWGRALSYQFFPTLYRGGVAYL 246
           SIVSPGG+NI KT  RWDHI++AV+ KQ+AGFN SLADVWGRALSY+FFPTL RGG+ Y 
Sbjct: 191 SIVSPGGLNIIKTARRWDHITNAVKAKQEAGFNTSLADVWGRALSYKFFPTLERGGIDYT 250

Query: 247 WSDLRESDVFKNAEMPMPISVADGRYPGTAVIDLNSTVFEYSPFELGSWDPSLSAFTDVQ 306
           WS LR+S +F+  +MP+PI+VADGRYPG+  I LN+TVFE++PFE+GSWDPSL+AFTDV+
Sbjct: 251 WSSLRDSPIFQAGDMPLPITVADGRYPGSNAIALNATVFEFNPFEMGSWDPSLNAFTDVK 310

Query: 307 YLGTKVSDGKPAEE--GKCIAGFDNVGFLMGTSSTLFNQFLLRINDTSIPKFIRNLATHF 364
           YLGT V++GKP      KCI GFDN  F+MGTSS LFNQFLLRIN T +P F+   AT+ 
Sbjct: 311 YLGTNVTNGKPVAHTAKKCIEGFDNTAFIMGTSSNLFNQFLLRINSTHLPNFVTKWATNL 370

Query: 365 LKDLSEDYDDIAVYAPNPFRDADYVNNNRSKSLSESEYLFLVDGGEDGQNVPLVPLIQQE 424
           LK  + +++D+AVY PNPF+D  YV  N S S+ +SE+L+LVDGGED +NVPL+PL+Q++
Sbjct: 371 LKSWAHEFNDVAVYNPNPFKDTRYVMENFSTSIVDSEHLYLVDGGEDDENVPLIPLLQRD 430

Query: 425 RDLDIVFALDNSADTEENWPDGASLMHTYRRQFGFQGQGVTFPSVPGTDTFVNLGLNKKP 484
           RDLDI+FA+DNSAD +  WPDG+SL+HTY RQF  QGQ + FP +P T+TF+NLGLNK+P
Sbjct: 431 RDLDIIFAIDNSADNKLQWPDGSSLVHTYERQFVLQGQKIAFPHIPDTNTFINLGLNKRP 490

Query: 485 TFFGCDARNMTDLEYIPPLIVYIPNSRHSYNGNTSTFKLSYSEKERLGVIRNGFEAATMN 544
           TFFGC+A NMT L+YIPPL+VY PNS +S+N N S FKLSYS  +   +I NGFE AT N
Sbjct: 491 TFFGCNATNMTSLKYIPPLVVYYPNSEYSFNSNQSAFKLSYSRDQMANMISNGFEIATRN 550

Query: 545 NLTADSNFAGCIGCAIMRRKQQALNLTLPKECETCFTNYCWNGTIDNTP 593
           N T D  F GCI CAIM+RKQ+AL+L LP ECE C   YCW+GT+D+TP
Sbjct: 551 NFTDDPEFIGCIACAIMKRKQEALDLELPSECERCLARYCWDGTVDDTP 599

>CAGL0J11748g complement(1141497..1143584) similar to sp|Q03674
           Saccharomyces cerevisiae YMR006c PLB2 or sp|P39105
           Saccharomyces cerevisiae YMR008c PLB1 or sp|Q08108
           Saccharomyces cerevisiae YOL011w PLB3, start by
           similarity
          Length = 695

 Score =  686 bits (1770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/576 (56%), Positives = 429/576 (74%), Gaps = 10/576 (1%)

Query: 28  SYVPANVTCPNDINLLRNAT-GLSQSEIDWLKKRDVNTREALESFLKRVXXXXXXXXXXX 86
           SY P NV+CP++ N +RNA  GLS +E +WLKKRD  TR+AL++FL+R            
Sbjct: 21  SYTPQNVSCPDNANFIRNAADGLSPAEKEWLKKRDPITRDALQTFLRRAFANVSTE---- 76

Query: 87  XLIDQLFSTNSSNIPKIGIAASGGGYRAMLSGAGMVSAMDNRTDGANEHGLGGLLQAATY 146
            +   LF+ ++ N+PK+GIA +GGGYRAM  GAG  +AMDNRTDGANEHGLGGLLQAATY
Sbjct: 77  -ITSALFN-DTENVPKLGIAVAGGGYRAMFVGAGAFAAMDNRTDGANEHGLGGLLQAATY 134

Query: 147 LAGLSGGXXXXXXXXXXXXXXVQDIVDSQDNDSAIWDISHSIVSPGGINIFKTGSRWDHI 206
           +AGLSGG              VQ I++  D   AIW+I++S ++P   +  KT +RW  I
Sbjct: 135 MAGLSGGNWLTGTLAYNNFTSVQQILEEGDKADAIWNITNSFLNPYDKDFSKTLARWTAI 194

Query: 207 SDAVEDKQKAGFNVSLADVWGRALSYQFFPTLYRGGVAYLWSDLRESDVFKNAEMPMPIS 266
              V+ K+ AGFNV++ D+W RAL+Y +FPTL   G    WS LR++++F N EMPMPIS
Sbjct: 195 GSQVQGKRDAGFNVTITDLWSRALAYGWFPTLPNAGAGLTWSSLRDNEIFMNGEMPMPIS 254

Query: 267 VADGRYPGTAVIDLNSTVFEYSPFELGSWDPSLSAFTDVQYLGTKVSDGKPAEEGKCIAG 326
           VADGRYPGT VI+LN+TVFE +PFE+GSWDPSL+AF+D++YLGT+V+DGKP  E +CI G
Sbjct: 255 VADGRYPGTTVINLNATVFEMTPFEIGSWDPSLNAFSDIKYLGTQVTDGKPETE-RCING 313

Query: 327 FDNVGFLMGTSSTLFNQFLLRINDTSIP-KFIRNLATHFLKDLSEDYDDIAVYAPNPFRD 385
           FD+  F+MGTSS+LFN+F +  ND+++   ++  L++  +K + ++ +DIA+YAPNPF+ 
Sbjct: 314 FDDASFIMGTSSSLFNEFTMS-NDSAVAYTYLNTLSSTLVKGIDKENNDIAMYAPNPFKG 372

Query: 386 ADYVNNNRSKSLSESEYLFLVDGGEDGQNVPLVPLIQQERDLDIVFALDNSADTEENWPD 445
           + YV++N + S+ +S+ LFLVDGGED Q +P VPL++QERDLDI+FA+D   +T +N+P 
Sbjct: 373 SKYVDSNYTTSIVDSDSLFLVDGGEDLQGIPFVPLLKQERDLDIIFAIDVDTETSDNYPA 432

Query: 446 GASLMHTYRRQFGFQGQGVTFPSVPGTDTFVNLGLNKKPTFFGCDARNMTDLEYIPPLIV 505
           G  +M TY RQF  QG+G+ FP VP   TFVNLGL  KP+F+GCDA N+TDLEYIPPLIV
Sbjct: 433 GGPMMKTYERQFSKQGKGMAFPYVPDMTTFVNLGLGGKPSFYGCDANNLTDLEYIPPLIV 492

Query: 506 YIPNSRHSYNGNTSTFKLSYSEKERLGVIRNGFEAATMNNLTADSNFAGCIGCAIMRRKQ 565
           YIPNS HS+  N STFKL+Y+  ER+G+IRN FEA T NNLT D+++  C+GCAI+RRKQ
Sbjct: 493 YIPNSYHSFESNVSTFKLNYNYSERVGMIRNAFEATTRNNLTEDADYVTCVGCAIIRRKQ 552

Query: 566 QALNLTLPKECETCFTNYCWNGTIDNTPAKGVTASN 601
           Q+LNLTLP  C+ CFTNYCWNGTIDNTP K +T +N
Sbjct: 553 QSLNLTLPDICDKCFTNYCWNGTIDNTPTKLLTPNN 588

>Scas_92.0d
          Length = 236

 Score =  317 bits (811), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 149/231 (64%), Positives = 184/231 (79%), Gaps = 1/231 (0%)

Query: 225 VWGRALSYQFFPTL-YRGGVAYLWSDLRESDVFKNAEMPMPISVADGRYPGTAVIDLNST 283
           ++G  L    F  L   GG AY WS LRE+DVFKNAEMP PISVADGRYPGT VI+LN+T
Sbjct: 2   MFGAVLYRMIFSQLCLNGGDAYTWSTLREADVFKNAEMPFPISVADGRYPGTQVINLNAT 61

Query: 284 VFEYSPFELGSWDPSLSAFTDVQYLGTKVSDGKPAEEGKCIAGFDNVGFLMGTSSTLFNQ 343
           VFE++PFE+GSWD SL AFT+V+YLGTKV++G P  +G+CIAGFDN GF+MGTSS+LFNQ
Sbjct: 62  VFEFNPFEMGSWDRSLRAFTNVKYLGTKVNNGTPETKGQCIAGFDNTGFIMGTSSSLFNQ 121

Query: 344 FLLRINDTSIPKFIRNLATHFLKDLSEDYDDIAVYAPNPFRDADYVNNNRSKSLSESEYL 403
           FLL++N T +P FI  LA  FL  LS+DYDDIA+YAPNPF+   +V  N ++S+ ESE L
Sbjct: 122 FLLQLNTTGLPSFIYKLANKFLTGLSDDYDDIALYAPNPFKGTGHVVENYTRSIVESEIL 181

Query: 404 FLVDGGEDGQNVPLVPLIQQERDLDIVFALDNSADTEENWPDGASLMHTYR 454
           +LVDGGEDGQN+PLVPL+Q+ER+LD++FALDNSADT + WP+G    H  R
Sbjct: 182 YLVDGGEDGQNIPLVPLLQEERELDVIFALDNSADTNQYWPNGFEFHHRAR 232

>Sklu_2442.19 YNL012W, Contig c2442 32274-34028 reverse complement
          Length = 584

 Score =  226 bits (576), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 140/433 (32%), Positives = 222/433 (51%), Gaps = 57/433 (13%)

Query: 195 NIFKTGSRWDHISDAVEDKQKAGFNVSLADVWGRALSYQFFPTLYRGGVAYLWSDLRESD 254
           N  +T   + ++   V  K+  GF++S  D WGRAL  +    L       +   L    
Sbjct: 168 NFRQTLEFYINLHFEVRPKKIKGFHLSFTDYWGRALMKKMSSHLSNSQSMSMSMLLENCR 227

Query: 255 VFKNAEMPMPISVADGRYPGTAVIDLNSTVFEYSPFELGSWDPSLSAFTDVQYLGTKVSD 314
            FK  ++P PI V++ +   +  +     VFE++PFE GSWD  L+ F  ++YLG+K+  
Sbjct: 228 NFKEFKVPFPIIVSNCKNSPSKTV-----VFEFTPFEFGSWDEYLNEFIKLKYLGSKIVS 282

Query: 315 GKPAEEGKCIAGFDNVGFLMGTSSTLFNQFLLRI------NDTSIPKFIRNLATHFLKDL 368
           GK     +C  GFD++GF+  TSS++FN  L+ +      +     K IR + + F   L
Sbjct: 283 GKTF---RCFNGFDDIGFISATSSSIFNNVLVYVWQMAANSSKETLKAIRAIMSTFGLRL 339

Query: 369 SEDY------------DDIAVYAPNPFRDADYVNNNRSKSLSESEYLFLVDGGEDGQNVP 416
            +D              D A+Y PNPF     VNN     L++  +L+LVDGGE+G+N+P
Sbjct: 340 VKDMGAKDVPNNPLTRPDYALYRPNPFYKLLTVNN----ELTKENHLYLVDGGENGENIP 395

Query: 417 LVPLIQQERDLDIVFALDNSADTEENWPDGASLMHTY------RRQFGFQGQGVT----- 465
           + PL+  +R LD++FALD+S+D+  N+P+G  L + Y      +       +G+T     
Sbjct: 396 IRPLLLPQRKLDVIFALDSSSDS-NNYPNGTILRNLYNNFHNGQESLNITREGITSNIDL 454

Query: 466 FPSVPGTDTFVNLGLNKKPTFFGCD----------ARNMTDLEYIPPLIVYIPNSRHSYN 515
            P +P + +FV   L  +P  FGC               T+   +PP+++Y  N  HSY+
Sbjct: 455 LPYIPNSKSFVEQQLFSRPVAFGCHLSSYHVREQYVNKTTESTNLPPIVIYYANYHHSYS 514

Query: 516 GNTSTFKLSYSEKERLGVIRNGFEAATMNNLTADSNFAGCIGCAIMRRKQQALNLT--LP 573
            NTSTFK SY+  E  G++RNG     +    A++ +  C+GC I++R+      T  LP
Sbjct: 515 SNTSTFKQSYNSSEIEGMLRNG---QDIFGFDANNTYHKCLGCIIIKREYDRRQTTAELP 571

Query: 574 KECETCFTNYCWN 586
           + C  C+ +YC+N
Sbjct: 572 EFCHQCYQDYCFN 584

>AAL027W [160] [Homologous to ScYNL012W (SPO1) - SH]
           complement(295617..297395) [1779 bp, 592 aa]
          Length = 592

 Score =  222 bits (566), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 146/424 (34%), Positives = 222/424 (52%), Gaps = 53/424 (12%)

Query: 198 KTGSRWDHISDAVEDKQKAGFNVSLADVWGRALSYQFFPTLYRGGVAYLWSDLRESDVFK 257
           K  S +  +   V  K+  GF VS  D WGRAL  + +  +    ++ +      S++  
Sbjct: 187 KVLSFYIDLHSEVRPKKIMGFPVSFTDYWGRALWKKIY--VNESMISSMSELFARSEITN 244

Query: 258 NAEMPMPISVADGRYPGTAVIDLNSTVFEYSPFELGSWDPSLSAFTDVQYLGTKVSDGKP 317
           N E P+PI +A+ +       DL + VFE++PFE GSW+  L  F +++YLG+  ++G  
Sbjct: 245 NYEAPLPIIIANCKNE-----DLVNAVFEFTPFEFGSWNRLLGLFVNLKYLGSNFTEGVA 299

Query: 318 AEEGKCIAGFDNVGFLMGTSSTLFNQFLLRI----NDTSIP--KFIRNLATHF---LKDL 368
                C+ GFD++GF+  TSS+LFN  L+      +++S+   K IR L + F   LK+ 
Sbjct: 300 Q---SCVQGFDDIGFITATSSSLFNNVLIYAWKLASESSLKTMKAIRALFSTFGVNLKNK 356

Query: 369 SEDY----DDIAVYAPNPFRDADYVNNNRSKSLSESEYLFLVDGGEDGQNVPLVPLIQQE 424
              +     D A++ PNPF     V++     L+ S+ L+LVDGGEDG+N+PL P +Q E
Sbjct: 357 PNSFFGTRSDFALFQPNPFYRYPGVDS----PLTNSDKLYLVDGGEDGENIPLRPFLQPE 412

Query: 425 RDLDIVFALDNSADTEENWPDGASLMHTYRRQFGFQG----------QGVT--FPSVPGT 472
           R +D++FALD+S+    N+P G  L + Y       G          Q VT   P +P  
Sbjct: 413 RQVDLIFALDSSSG-RINYPTGGILRNLYDNLHATDGAAAVVQTGDVQSVTDLLPYIPSA 471

Query: 473 DTFVNLGLNKKPTFFGC-----DARNMTDLE---YIPPLIVYIPNSRHSYNGNTSTFKLS 524
           + F   GL K+P  FGC       RN +       +PP++ Y  N   +YN NTSTFKL 
Sbjct: 472 EEFEAKGLLKRPVAFGCYPESYHIRNASATAAPGKLPPIVFYHANRNSTYNSNTSTFKLR 531

Query: 525 YSEKERLGVIRNGFEAATMNNLTADSNFAGCIGCAIMRRKQQALNLT--LPKECETCFTN 582
           Y+  E  G++ NG    T +N TA   +  C+GC +++R    +N +  LP  C+ CF  
Sbjct: 532 YNHSEVQGMLENGASLFTHDNNTA---YFQCVGCLVVKRAYDNVNASAKLPPTCQQCFRR 588

Query: 583 YCWN 586
           YC+N
Sbjct: 589 YCYN 592

>Kwal_0.173
          Length = 507

 Score =  220 bits (560), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 139/416 (33%), Positives = 219/416 (52%), Gaps = 60/416 (14%)

Query: 210 VEDKQKAGFNVSLADVWGRALSYQFFPTLYRGGVAYLWSDLRESDVFKNAEMPMPISVAD 269
           V+ K+ +GF +S  D WG AL     PT   G ++  ++D  +S  F+  E+P+PI VA+
Sbjct: 113 VKSKKLSGFPISFTDYWGEALVTSIAPTHTTGSIS-AFAD--KSQRFQRYEVPLPIFVAN 169

Query: 270 GRYPGTAVIDLNSTVFEYSPFELGSWDPSLSAFTDVQYLGTKVSDGKPAEEGKCIAGFDN 329
            +       +L + VFE++PFE GSW  ++  F  ++YLG++++ G P    KCI GFD 
Sbjct: 170 CKND-----NLRNAVFEFTPFEFGSWT-NMRLFIPLRYLGSQITAGTPQ---KCIIGFDE 220

Query: 330 VGFLMGTSSTLFNQFLLRINDTSIP-----KFIR------NLATHFLKDLSE------DY 372
           VGF+  TSS+LFN  L+ +     P     K +R       L  H    +S+       +
Sbjct: 221 VGFVTATSSSLFNSVLMYVWHLVAPSLDTRKAVRAIFSTFGLGIHKTTTVSKGEANIMSH 280

Query: 373 DDIAVYAPNPFRDADYVNNNRSKSLSESEYLFLVDGGEDGQNVPLVPLIQQERDLDIVFA 432
            + A+Y PNPF    Y +   S  L++   L+LVDGGEDG+N+P+ PL+  ER LD++FA
Sbjct: 281 PEYAIYQPNPF----YKHPATSDVLAKHNQLYLVDGGEDGENIPIGPLLIPERKLDVIFA 336

Query: 433 LDNSADTEENWPDGASLMHTYRRQFGFQGQGVT-----FPSVPGTDTFVNLGLNKKPTFF 487
           LD+S+D   ++P+G  L + Y+  +G             P +P ++ FV   L  +P  F
Sbjct: 337 LDSSSDV-CSFPNGTMLWNFYQNNYGHSSSKSNTPYQLLPLIPSSEEFVARRLLSRPVAF 395

Query: 488 GCD------------ARNMTDLEYIPPLIVYIPNSRHSYNGNTSTFKLSYSEKERLGVIR 535
           GC              RN + LE +PP+++Y  N+ HS+  N STFKL YS+ E   ++R
Sbjct: 396 GCHMESYPTLNSTNWVRNSSHLE-LPPILIYHANANHSFASNLSTFKLKYSKIEVEQMLR 454

Query: 536 NGFEAATMNNLTADSNFAGCIGCAIMRRKQQ-----ALNLTLPKECETCFTNYCWN 586
           NG    + ++      +  C+ C +++R           + LP  C+ CF+ YC+N
Sbjct: 455 NGKHIFSFDD---RPKYKRCLACLLVKRNYDRSIILGEEVRLPFFCDVCFSEYCYN 507

>KLLA0F12232g join(1129199..1129312,1129409..1131337) similar to
           sp|P53541 Saccharomyces cerevisiae YNL012w SPO1
           transcriptional regulator involved in sporulation, start
           by similarity
          Length = 680

 Score =  192 bits (488), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 134/420 (31%), Positives = 211/420 (50%), Gaps = 55/420 (13%)

Query: 203 WDHISDAVEDKQKAGFNVSLADVWGRALSYQFFPTLYRGGVAYLWSDLRESDVFKNAEMP 262
           + ++   V  K++AGF +SL D  G+AL  +  P   +  +  L S+  +S+ FK  + P
Sbjct: 280 YINLHRQVRQKKEAGFPISLTDYLGQALLDRL-PAQKQDHLKQL-SNFVQSESFKKFDAP 337

Query: 263 MPISVADGRYPGTAVIDLNSTVFEYSPFELGSWDPSLSAFTDVQYLGTKVSDGKPAEEGK 322
           +P+ VA+ +       +L++ VFE++PFE GSW  ++S F   +YLG+    GK     K
Sbjct: 338 IPVFVANAKTSKGP--ELHNVVFEFTPFEFGSWHLNVSKFISTKYLGSTALKGKLT---K 392

Query: 323 CIAGFDNVGFLMGTSSTLFNQFLLRINDTSIP--------KFIRNLATHFLKDLSEDYDD 374
           C+ GFDN+GF+  TSS+LFN  L  I  T           K I+ +   F    +    D
Sbjct: 393 CVNGFDNLGFITATSSSLFNNALFYIWKTVTTNIESNEKLKAIKTIFGVFGVGFNAIRSD 452

Query: 375 IAVYAPNPF-RDADYVNNNRSKSLSESEYLFLVDGGEDGQNVPLVPLIQQERDLDIVFAL 433
            A+Y PNPF +D + +N      +S++  LFLVDGGEDG+N+PL  L    R  D++F +
Sbjct: 453 YAIYQPNPFYKDPEVLN-----LISDTSQLFLVDGGEDGENIPLRSLFISGRQNDVIFIV 507

Query: 434 DNSADTEENWPDGASLMHTYRRQFGFQGQGVT------------FPSVPGTDTFV--NLG 479
           D+S+D +EN PD   L  TY      + Q                P +P ++  +  N  
Sbjct: 508 DSSSD-KENLPDMTKLRDTYDDIIHVEEQKRIVALKNEIWEMDLMPYIPTSEELLAANFS 566

Query: 480 LNKKPTFFGC-----DARNMTDL--------EYIPPLIVYIPNSRHSYNGNTSTFKLSYS 526
           L+  P  FGC     + + +TD           +PP+++Y  N   ++  NTSTFKL+Y+
Sbjct: 567 LS-TPIAFGCHLQSYNTKRLTDTLITKETSSASLPPILIYHGNIPITFQSNTSTFKLNYT 625

Query: 527 EKERLGVIRNGFEAATMNNLTADSNFAGCIGCAIMRRKQQALNLTLPKECETCFTNYCWN 586
           + E  G++ NG      NN      +  C+GC ++ R+ Q L   +   C+ C    C+N
Sbjct: 626 KDEYNGMLNNGHHL--FNNDDTQGEYLQCLGCVMLLRQNQEL---VSSFCDACIRKVCYN 680

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 58/127 (45%), Gaps = 26/127 (20%)

Query: 29  YVPANVTCPNDINLLRNATG--LSQSEIDWLKKRDVNTREALESFLKRVXXXXXXXXXXX 86
           Y P NV CP D++L R A    LS  E D+L KR    +   E F + +           
Sbjct: 21  YAPVNVDCPKDLSL-RAAKNEKLSALEFDYLSKRTEVIKGKFEKFYEDLAIPG------- 72

Query: 87  XLIDQLFSTNSSNIPKIGIAASGGGYRAMLSGAGMVSAMDNRTDGANEHGLGGLLQAATY 146
                  + +S   P+I +A SGGG+R+ML  +G V  M             GL +  +Y
Sbjct: 73  ------INVDSLQFPRIAVAISGGGFRSMLISSGFVLGMQQH----------GLWECTSY 116

Query: 147 LAGLSGG 153
           +AG+SGG
Sbjct: 117 VAGISGG 123

>YNL012W (SPO1) [4573] chr14 (609684..609788,609873..611663)
           Meiosis-specific protein with similarity to
           phospholipase B enzymes [1896 bp, 631 aa]
          Length = 631

 Score =  188 bits (478), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 130/410 (31%), Positives = 203/410 (49%), Gaps = 71/410 (17%)

Query: 210 VEDKQKAGFNVSLADVWGRALSYQFFPTLYRG-GVAYLWSDL-RESDVFKNAEMPMPISV 267
           ++ K+  GF +S  D WG+A+  +           ++ +S L   S  FK   +P+PI V
Sbjct: 260 IKPKKMEGFQISFTDYWGKAIVQRLKKNFDDDPNHSFSFSKLVNSSKKFKECSVPIPIFV 319

Query: 268 ADGRYPGTAVIDLNSTVFEYSPFELGSWDPSLSAFTDVQYLGTKVSDGKPAEEGKCIAGF 327
           A+ +  G     L++ +FE++PFE GSW+  L  F  + YLG+K+  GK AE  KCI  F
Sbjct: 320 ANCK-NGL----LSNVIFEFTPFEFGSWENILRLFVKLPYLGSKIVSGK-AE--KCINNF 371

Query: 328 DNVGFLMGTSSTLFNQFLLRINDTSIPKFIRNLATH------------------------ 363
           D++GF+  TSS++FN  L+         FI NLA+                         
Sbjct: 372 DDLGFITATSSSIFNNVLI---------FIWNLASQSSREAMKALNMVMGIFGLGKEEIF 422

Query: 364 -FLKDLSEDYDDIAVYAPNPFRDADYVNNNRSKSLSESEYLFLVDGGEDGQNVPLVPLIQ 422
              KD S    D AVY PNPF    Y+   +   L+   +L+LVDGGEDG+N+PL  L+ 
Sbjct: 423 SISKDSSRLETDYAVYQPNPF----YLYPEKDNVLTNKNHLYLVDGGEDGENIPLRTLVI 478

Query: 423 QERDLDIVFALDNSADTEENWPDGASLMHTYRRQFGFQGQGVTFPSVPGTDTFVNLGLNK 482
            ER+LD++F LD+S+D  +N+P+G+ L   + +      + V +       TF +     
Sbjct: 479 PERELDVIFVLDSSSDI-DNYPNGSKLKRIFEK---LDEENVHYQFPNNVKTFTH----- 529

Query: 483 KPTFFGCDARNMTDLEYIPPLIVYIPNSRHSYNGNTSTFKLSYSEKERLGVIRNGFEAAT 542
            P   GC+A   T  +   P+I+Y  N+ H    NTSTFK++Y++ E   ++  G     
Sbjct: 530 -PIVIGCNATKRTGHDSFLPIIIYHANANHGNASNTSTFKITYNQSEVSSMLPTG--RGV 586

Query: 543 MNNLTADSNFAGCIGCAIMRRKQQALNLTLPKE------CETCFTNYCWN 586
            +N   D  +  C+GC + +R        LP++      C  CF +YC++
Sbjct: 587 FSN-DYDLYYKNCLGCILTKRTMDR----LPRKKKFSPFCLQCFKDYCYS 631

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 61/124 (49%), Gaps = 20/124 (16%)

Query: 31  PANVTCPNDINLLRNATG-LSQSEIDWLKKRDVNTREALESFLKRVXXXXXXXXXXXXLI 89
           P  V CP+   L+R A   L   E  +LKK+ + T+  L  FLK +              
Sbjct: 20  PFQVQCPSS-PLIREAKHELCPEETLYLKKKKIKTKNKLIQFLKSLTEAKFS-------- 70

Query: 90  DQLFSTNSSNIPKIGIAASGGGYRAMLSGAGMVSAMDNRTDGANEHGLGGLLQAATYLAG 149
            + +     + PKIGIA SGGGYR+ML G G +S M++           GL + + Y+AG
Sbjct: 71  SKFYKRVLKDPPKIGIAISGGGYRSMLVGTGFISQMNDY----------GLFEYSDYIAG 120

Query: 150 LSGG 153
           LSGG
Sbjct: 121 LSGG 124

>CAGL0H03575g 331303..332847 similar to sp|P53541 Saccharomyces
           cerevisiae YNL012w SPO1, start by similarity
          Length = 514

 Score =  184 bits (466), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 122/401 (30%), Positives = 207/401 (51%), Gaps = 57/401 (14%)

Query: 210 VEDKQKAGFNVSLADVWGRAL----SYQFFPTLYRGGVAYLWSDLRESDVFKNAEMPMPI 265
           +  K+  GF +S  D W +AL     Y+  PT     + Y  S +R S+ FKN  +P+PI
Sbjct: 143 IRSKRINGFPISFTDYWAQALVQNIKYRQLPT----HLTYSKS-VRTSNYFKNYLVPIPI 197

Query: 266 SVADGRYPGTAVIDLNSTVFEYSPFELGSWDPSLSAFTDVQYLGTKVSDGKPAEEGKCIA 325
            VA+ R        L + +FE++P+E GSW+  L  F +++YLG+++ +G      +C  
Sbjct: 198 IVANCRNGF-----LKNVIFEFTPWEFGSWEQVLGLFVNIEYLGSRIING---VSHQCYK 249

Query: 326 GFDNVGFLMGTSSTLFNQFLLRI-------NDTSIPKFIRNLA------THFLKDLSEDY 372
           G D++GF+  TSS++FN  L+ +       +  +I      LA      T F   L    
Sbjct: 250 GLDDLGFIAATSSSIFNNALIYVWKLASKSSKDAIAAVKTVLAVFGLGTTKFESALQTSS 309

Query: 373 D-------DIAVYAPNPFRDADYVNNNRSKSLSESEYLFLVDGGEDGQNVPLVPLIQQER 425
                   D AVY  NPF    Y  +N    L++++YL+LVDGGEDG+N+P+  L+   R
Sbjct: 310 QITAALDTDYAVYRHNPF----YKYSNIKNELAQNDYLYLVDGGEDGENIPIRTLV--PR 363

Query: 426 DLDIVFALDNSADTEENWPDGASLMHTYRRQFGFQGQGVTFPSVPGTDTFVNLGLNKKPT 485
           ++D++  +D+S+D ++N+ +G  L     +    +G    +P+   T         K+PT
Sbjct: 364 NVDMIMIMDSSSD-KKNYANGDKLKIVLNQMKEKEGIYYRYPTKIVTS-------QKRPT 415

Query: 486 FFGCDARNMTDLEYIPPLIVYIPNSRHSYNG--NTSTFKLSYSEKERLGVIRNGFEAATM 543
             GC     +D + + P++VY PNS  S     NTSTFK+ Y+ +E+  +I +G+   T 
Sbjct: 416 IIGCKPPRTSDTK-LAPILVYYPNSERSSTQVTNTSTFKMIYTSEEQQLLIDHGYTLVTG 474

Query: 544 NNLTADSNFAGCIGCAIMRRKQQALNLTLPKECETCFTNYC 584
           +    + ++  C+ C +++R     ++  PK+C  C++ YC
Sbjct: 475 H---GEHDYQKCMACILVKRSYDQASIIPPKQCSICYSKYC 512

>Scas_695.10
          Length = 553

 Score =  172 bits (437), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 123/380 (32%), Positives = 190/380 (50%), Gaps = 59/380 (15%)

Query: 210 VEDKQKAGFNVSLADVWGRALSYQFFP-----TLYRGGVAYLWSDLRESDV-FKNAEMPM 263
           V  K+  GF VS  D WG AL  +        + +   V++  S L ES++ F   E P+
Sbjct: 184 VRTKKIQGFFVSFTDYWGEALLKRLNNKDKKFSAFANTVSF--SKLIESNLKFSKFEAPI 241

Query: 264 PISVADGRYPGTAVIDLNSTVFEYSPFELGSWDPSLSAFTDVQYLGTKVSDGKPAEEGKC 323
           PI VA+ R        L + +FE+SPFE GSW+  L  F  + YLG+K+ +G       C
Sbjct: 242 PIFVANNRNG-----RLKNVIFEFSPFEFGSWEKMLRLFVKLPYLGSKIVNGTAK---IC 293

Query: 324 IAGFDNVGFLMGTSSTLFNQFLL----RINDTSIPKFIRNLATHFLKDLSEDYD------ 373
              FD++GF+  TSS++FN  L+    +++ +S+       A   L  L    D      
Sbjct: 294 YKEFDDIGFITATSSSIFNNVLIFIWQKMSRSSLEAMKSVKAVMGLFGLIGTKDSTKPLT 353

Query: 374 ----------DIAVYAPNPFRDADYVNNNRSKSLSESEYLFLVDGGEDGQNVPLVPLIQQ 423
                     D AVY  NPF     ++N    +L++ ++L+LVDGGEDG+N+PL  LI  
Sbjct: 354 LSNTAIAPETDYAVYYHNPFFRYPNIDN----ALTKDDHLYLVDGGEDGENIPLRSLIIP 409

Query: 424 ERDLDIVFALDNSADTEENWPDGASLMHTYRRQFGFQGQGVTFPSVPGTDTFVNLGLNKK 483
           ER +D++FA+D+S+D   N+ +G  L+ T  R     G     P +              
Sbjct: 410 ERKVDVIFAIDSSSDV-NNYANGTKLI-TILRHLEKLGYHYKIPKISKKRI-------NH 460

Query: 484 PTFFGCDARNMTDLEYIPPLIVYIPNSRHSYNGNTSTFKLSYSEKERLGVIRNGFEAATM 543
           P  FGC+A ++       P+I+Y  N+ HSY  NTSTFK++Y+E E   +++NG +    
Sbjct: 461 PLIFGCNAPSL-------PIIIYHANTEHSYPSNTSTFKVTYNETEVGAMLQNGMDIFND 513

Query: 544 NNLTADSNFAGCIGCAIMRR 563
           N    +  +  C+GC + +R
Sbjct: 514 N---ENIYYQNCLGCILSKR 530

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 33/56 (58%), Gaps = 10/56 (17%)

Query: 98  SNIPKIGIAASGGGYRAMLSGAGMVSAMDNRTDGANEHGLGGLLQAATYLAGLSGG 153
           SN P IG+A SGGGYR+ML+G G +  M  +          GL    +YL+GLSGG
Sbjct: 6   SNPPNIGVALSGGGYRSMLTGTGFILGMQEK----------GLWDCVSYLSGLSGG 51

>YGL064C (MRH4) [1915] chr7 complement(381524..383209) Member of the
           DEAD-box RNA helicase family [1686 bp, 561 aa]
          Length = 561

 Score = 30.0 bits (66), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 35/81 (43%), Gaps = 10/81 (12%)

Query: 54  IDWLKKRDVNTREALESFLKRVXXXXXXXXXXXXLIDQLFSTNSSNIPKIGIAA----SG 109
           ID+LK++++ T E  E+  K V            L+DQ++ T S     +G+ +      
Sbjct: 179 IDYLKRQELETPELWETLRKNVLIRSIILVPTHELVDQVYETVSKTKTLLGLNSFKWDKA 238

Query: 110 GGYRAMLSGAGMVSAMDNRTD 130
             YR +L        + NR D
Sbjct: 239 TSYRDLLEN------IKNRID 253

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.134    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,671,218
Number of extensions: 930661
Number of successful extensions: 2151
Number of sequences better than 10.0: 24
Number of HSP's gapped: 2115
Number of HSP's successfully gapped: 28
Length of query: 649
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 541
Effective length of database: 12,857,365
Effective search space: 6955834465
Effective search space used: 6955834465
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)