Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0J11748g69558930360.0
YMR006C (PLB2)70659419440.0
Scas_611.164656418130.0
CAGL0J11770g65959018060.0
YMR008C (PLB1)66455917800.0
YOL011W (PLB3)68656417680.0
Sklu_1900.165857617520.0
Scas_685.367756517250.0
Kwal_56.2251064158316910.0
Scas_644.870457716540.0
KLLA0C05940g64055915920.0
CAGL0E02321g70457615810.0
Scas_92.0d2362076418e-79
Sklu_2442.195844755746e-65
AAL027W5924285739e-65
Kwal_0.1735074305161e-57
YNL012W (SPO1)6314834835e-52
KLLA0F12232g6804504714e-50
CAGL0H03575g5144154187e-44
Scas_695.105534054056e-42
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J11748g
         (684 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J11748g complement(1141497..1143584) similar to sp|Q03674 S...  1174   0.0  
YMR006C (PLB2) [3971] chr13 complement(277561..279681) Phospholi...   753   0.0  
Scas_611.1                                                            702   0.0  
CAGL0J11770g complement(1145135..1147114) highly similar to sp|P...   700   0.0  
YMR008C (PLB1) [3972] chr13 complement(280590..282584) Phospholi...   690   0.0  
YOL011W (PLB3) [4805] chr15 (305349..307409) Phospholipase B (ly...   685   0.0  
Sklu_1900.1 YMR008C, Contig c1900 2946-4922 reverse complement        679   0.0  
Scas_685.3                                                            669   0.0  
Kwal_56.22510                                                         655   0.0  
Scas_644.8                                                            641   0.0  
KLLA0C05940g 524768..526690 gi|3169132|dbj|BAA28619.1 Kluyveromy...   617   0.0  
CAGL0E02321g 222466..224580 some similarities with sp|Q08108 Sac...   613   0.0  
Scas_92.0d                                                            251   8e-79
Sklu_2442.19 YNL012W, Contig c2442 32274-34028 reverse complement     225   6e-65
AAL027W [160] [Homologous to ScYNL012W (SPO1) - SH] complement(2...   225   9e-65
Kwal_0.173                                                            203   1e-57
YNL012W (SPO1) [4573] chr14 (609684..609788,609873..611663) Meio...   190   5e-52
KLLA0F12232g join(1129199..1129312,1129409..1131337) similar to ...   186   4e-50
CAGL0H03575g 331303..332847 similar to sp|P53541 Saccharomyces c...   165   7e-44
Scas_695.10                                                           160   6e-42

>CAGL0J11748g complement(1141497..1143584) similar to sp|Q03674
           Saccharomyces cerevisiae YMR006c PLB2 or sp|P39105
           Saccharomyces cerevisiae YMR008c PLB1 or sp|Q08108
           Saccharomyces cerevisiae YOL011w PLB3, start by
           similarity
          Length = 695

 Score = 1174 bits (3036), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 577/589 (97%), Positives = 577/589 (97%)

Query: 22  YTPQNVSCPDNANFIRNAADGLSPAEKEWLKKRDPITRDALQTFLRRAFANVSTEITSAL 81
           YTPQNVSCPDNANFIRNAADGLSPAEKEWLKKRDPITRDALQTFLRRAFANVSTEITSAL
Sbjct: 22  YTPQNVSCPDNANFIRNAADGLSPAEKEWLKKRDPITRDALQTFLRRAFANVSTEITSAL 81

Query: 82  FNDTENVPKLGIAVAGGGYRXXXXXXXXXXXXDNRTDGANEHGLGGLLQAATYMAGLSGG 141
           FNDTENVPKLGIAVAGGGYR            DNRTDGANEHGLGGLLQAATYMAGLSGG
Sbjct: 82  FNDTENVPKLGIAVAGGGYRAMFVGAGAFAAMDNRTDGANEHGLGGLLQAATYMAGLSGG 141

Query: 142 NWLTGTLAYNNFTSVQQILEEGDKADAIWNITNSFLNPYDKDFSKTLARWTAIGSQVQGK 201
           NWLTGTLAYNNFTSVQQILEEGDKADAIWNITNSFLNPYDKDFSKTLARWTAIGSQVQGK
Sbjct: 142 NWLTGTLAYNNFTSVQQILEEGDKADAIWNITNSFLNPYDKDFSKTLARWTAIGSQVQGK 201

Query: 202 RDAGFNVTITDLWSRALAYGWFPTLPNAGAGLTWSSLRDNEIFMNGEMPMPISVADGRYP 261
           RDAGFNVTITDLWSRALAYGWFPTLPNAGAGLTWSSLRDNEIFMNGEMPMPISVADGRYP
Sbjct: 202 RDAGFNVTITDLWSRALAYGWFPTLPNAGAGLTWSSLRDNEIFMNGEMPMPISVADGRYP 261

Query: 262 GTTVINLNATVFEMTPFEIGSWDPSLNAFSDIKYLGTQVTDGKPETERCINGFDDASFIM 321
           GTTVINLNATVFEMTPFEIGSWDPSLNAFSDIKYLGTQVTDGKPETERCINGFDDASFIM
Sbjct: 262 GTTVINLNATVFEMTPFEIGSWDPSLNAFSDIKYLGTQVTDGKPETERCINGFDDASFIM 321

Query: 322 GTSSSLFNEFTMSNDSAVAYTYLNTLSSTLVKGIDKENNDIAMYAPNPFKGSKYVDSNYT 381
           GTSSSLFNEFTMSNDSAVAYTYLNTLSSTLVKGIDKENNDIAMYAPNPFKGSKYVDSNYT
Sbjct: 322 GTSSSLFNEFTMSNDSAVAYTYLNTLSSTLVKGIDKENNDIAMYAPNPFKGSKYVDSNYT 381

Query: 382 TSIVDSDSLFLVDGGEDLQGIPFVPLLKQERDLDIIFAIDVDTETSDNYPAGGPMMKTYE 441
           TSIVDSDSLFLVDGGEDLQGIPFVPLLKQERDLDIIFAIDVDTETSDNYPAGGPMMKTYE
Sbjct: 382 TSIVDSDSLFLVDGGEDLQGIPFVPLLKQERDLDIIFAIDVDTETSDNYPAGGPMMKTYE 441

Query: 442 RQFSKQGKGMAFPYVPDMTTFVNLGLGGKPSFYGCDANNLTDLEYIPPLIVYIPNSYHSF 501
           RQFSKQGKGMAFPYVPDMTTFVNLGLGGKPSFYGCDANNLTDLEYIPPLIVYIPNSYHSF
Sbjct: 442 RQFSKQGKGMAFPYVPDMTTFVNLGLGGKPSFYGCDANNLTDLEYIPPLIVYIPNSYHSF 501

Query: 502 ESNVSTFKLNYNYSERVGMIRNAFEATTRNNLTEDADYVTCVGCAIIRRKQQSLNLTLPD 561
           ESNVSTFKLNYNYSERVGMIRNAFEATTRNNLTEDADYVTCVGCAIIRRKQQSLNLTLPD
Sbjct: 502 ESNVSTFKLNYNYSERVGMIRNAFEATTRNNLTEDADYVTCVGCAIIRRKQQSLNLTLPD 561

Query: 562 ICDKCFTNYCWNGTIDNTPTKLLTPNNQDPAAISSAIAAVTDDSPIGAL 610
           ICDKCFTNYCWNGTIDNTPTKLLTPNNQDPAAISSAIAAVTDDSPIGAL
Sbjct: 562 ICDKCFTNYCWNGTIDNTPTKLLTPNNQDPAAISSAIAAVTDDSPIGAL 610

>YMR006C (PLB2) [3971] chr13 complement(277561..279681)
           Phospholipase B2 (lysophospholipase), releases fatty
           acids from lysophospholipids [2121 bp, 706 aa]
          Length = 706

 Score =  753 bits (1944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/594 (58%), Positives = 466/594 (78%), Gaps = 6/594 (1%)

Query: 22  YTPQNVSCP-DNANFIRNAADGLSPAEKEWLKKRDPITRDALQTFLRRAFANVS-TEITS 79
           Y P  + CP D+ + +RNA+ GLS AE +WLKKRD  T++AL +FL RA +N S T + S
Sbjct: 30  YAPSIIPCPSDDTSLVRNAS-GLSTAETDWLKKRDAYTKEALHSFLSRATSNFSDTSLLS 88

Query: 80  ALFN-DTENVPKLGIAVAGGGYRXXXXXXXXXXXXDNRTDGANEHGLGGLLQAATYMAGL 138
            LF+ ++ NVPK+GIA +GGGYR            DNRTDGANEHGLGGLLQ++TY++GL
Sbjct: 89  TLFSSNSSNVPKIGIACSGGGYRAMLGGAGMIAAMDNRTDGANEHGLGGLLQSSTYLSGL 148

Query: 139 SGGNWLTGTLAYNNFTSVQQILEEGDKADAIWNITNSFLNPYDKDFSKTLARWTAIGSQV 198
           SGGNWLTGTLA+NN+TSVQ+I++   ++D+IWNIT S +NP   + + T+ RW +I  +V
Sbjct: 149 SGGNWLTGTLAWNNWTSVQEIVDHMSESDSIWNITKSIVNPGGSNLTYTIERWESIVQEV 208

Query: 199 QGKRDAGFNVTITDLWSRALAYGWFPTLPNAGAGLTWSSLRDNEIFMNGEMPMPISVADG 258
           Q K DAGFN++++DLW+RAL+Y +FP+LP+AG+ LTWSSLRD ++F NGEMP+PI+VADG
Sbjct: 209 QAKSDAGFNISLSDLWARALSYNFFPSLPDAGSALTWSSLRDVDVFKNGEMPLPITVADG 268

Query: 259 RYPGTTVINLNATVFEMTPFEIGSWDPSLNAFSDIKYLGTQVTDGKP-ETERCINGFDDA 317
           RYPGTTVINLNAT+FE TPFE+GSWDPSLNAF+D+KYLGT VT+GKP   ++C++G+D+A
Sbjct: 269 RYPGTTVINLNATLFEFTPFEMGSWDPSLNAFTDVKYLGTNVTNGKPVNKDQCVSGYDNA 328

Query: 318 SFIMGTSSSLFNEFTMSNDSAVAYTYLNTLSSTLVKGIDKENNDIAMYAPNPFKGSKYVD 377
            F++ TS+SLFNEF++   ++  Y  +N+ ++  V  + ++++DIA+YA NPFK +++VD
Sbjct: 329 GFVIATSASLFNEFSLEASTSTYYKMINSFANKYVNNLSQDDDDIAIYAANPFKDTEFVD 388

Query: 378 SNYTTSIVDSDSLFLVDGGEDLQGIPFVPLLKQERDLDIIFAIDVDTETSDNYPAGGPMM 437
            NYT+SIVD+D LFLVDGGED Q +P VPL+K+ERDLD++FA+D+   T +++P+G  M 
Sbjct: 389 RNYTSSIVDADDLFLVDGGEDGQNLPLVPLIKKERDLDVVFALDISDNTDESWPSGVCMT 448

Query: 438 KTYERQFSKQGKGMAFPYVPDMTTFVNLGLGGKPSFYGCDANNLTDLEYIPPLIVYIPNS 497
            TYERQ+SKQGKGMAFPYVPD+ TF+NLGL  KP+F+GCDA NLTDLEYIPPL+VYIPN+
Sbjct: 449 NTYERQYSKQGKGMAFPYVPDVNTFLNLGLTNKPTFFGCDAKNLTDLEYIPPLVVYIPNT 508

Query: 498 YHSFESNVSTFKLNYNYSERVGMIRNAFEATTRNNLTEDADYVTCVGCAIIRRKQQSLNL 557
            HSF  N ST K+NYN +ER+GMIRN FEA T  N T+D++++ C+GCAIIRRKQ+SLN 
Sbjct: 509 KHSFNGNQSTLKMNYNVTERLGMIRNGFEAATMGNFTDDSNFLGCIGCAIIRRKQESLNA 568

Query: 558 TLPDICDKCFTNYCWNGTIDNTPTKLLTPNNQ-DPAAISSAIAAVTDDSPIGAL 610
           TLP  C KCF +YCWNGT+  +    L+ N+     AI+SAI+  TD  PI AL
Sbjct: 569 TLPPECTKCFADYCWNGTLSTSANPELSGNSTYQSGAIASAISEATDGIPITAL 622

>Scas_611.1
          Length = 646

 Score =  702 bits (1813), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/564 (58%), Positives = 424/564 (75%), Gaps = 4/564 (0%)

Query: 22  YTPQNVSCPDNANFIRNAADGLSPAEKEWLKKRDPITRDALQTFLRRAFANVS-TEITSA 80
           Y P NV+C DN N IR  A+ LS  EK WL KRD IT +AL++FL+R+ +N S T + S 
Sbjct: 27  YVPANVTCDDNINLIR-EANSLSDDEKSWLTKRDAITSEALESFLKRSTSNFSDTSLISQ 85

Query: 81  LFN-DTENVPKLGIAVAGGGYRXXXXXXXXXXXXDNRTDGANEHGLGGLLQAATYMAGLS 139
           LF+ ++ + P++G+A +GGGYR            DNRTDGANEHGLGGLLQ ATY+AGLS
Sbjct: 86  LFSGNSSSAPRIGVACSGGGYRAMLSGAGMVAAMDNRTDGANEHGLGGLLQGATYLAGLS 145

Query: 140 GGNWLTGTLAYNNFTSVQQILEEGDKADAIWNITNSFLNPYDKDFSKTLARWTAIGSQVQ 199
           GGNWLT TL +NN+TSVQ IL      D+IW+I++S +NP   +  +T  RW  I   VQ
Sbjct: 146 GGNWLTSTLGWNNWTSVQAILNNMTNDDSIWDISHSIINPGGWNILETGERWDHISDAVQ 205

Query: 200 GKRDAGFNVTITDLWSRALAYGWFPTLPNAGAGLTWSSLRDNEIFMNGEMPMPISVADGR 259
            K+DAGFN+++ D+W RAL+Y +FP+L   G G TWS+LRD ++F N EMP PISVADGR
Sbjct: 206 AKQDAGFNISLADVWGRALSYNFFPSLYRGGQGYTWSTLRDADVFKNAEMPFPISVADGR 265

Query: 260 YPGTTVINLNATVFEMTPFEIGSWDPSLNAFSDIKYLGTQVTDGKPETE-RCINGFDDAS 318
           YPGTTVINLNATVFE  PFE+GSWDP+LN F+D+KYLGT V++GKP TE +CI GFD+  
Sbjct: 266 YPGTTVINLNATVFEFNPFEMGSWDPTLNTFTDVKYLGTNVSNGKPITEGKCIAGFDNTG 325

Query: 319 FIMGTSSSLFNEFTMSNDSAVAYTYLNTLSSTLVKGIDKENNDIAMYAPNPFKGSKYVDS 378
           FI GTSS+LFN+F +  +S    +++  L+S  +  +  + NDIA+Y+PNPF+ + ++ S
Sbjct: 326 FITGTSSTLFNQFLLHINSTSLPSFITKLASHFLNDLSADYNDIAIYSPNPFRDADFIAS 385

Query: 379 NYTTSIVDSDSLFLVDGGEDLQGIPFVPLLKQERDLDIIFAIDVDTETSDNYPAGGPMMK 438
           NY+ SIV S  LFLVDGGED Q IP VPLL++ER+LD+IFA+D   +T+ ++P G  ++ 
Sbjct: 386 NYSKSIVQSKDLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSADTNQSWPDGASLVN 445

Query: 439 TYERQFSKQGKGMAFPYVPDMTTFVNLGLGGKPSFYGCDANNLTDLEYIPPLIVYIPNSY 498
           TYERQF  QG GMAFPYVPD  TFVNLGL  +P+F+GCDA NLTDLEYIPPL+VYIPN+ 
Sbjct: 446 TYERQFGMQGNGMAFPYVPDKNTFVNLGLNKRPTFFGCDARNLTDLEYIPPLVVYIPNAR 505

Query: 499 HSFESNVSTFKLNYNYSERVGMIRNAFEATTRNNLTEDADYVTCVGCAIIRRKQQSLNLT 558
           HSF  N STFK++Y+ SER  MI+N FE+ TR N T+D+D++ C+GCAI+RRKQQS+N T
Sbjct: 506 HSFNGNQSTFKMSYSTSERFSMIQNGFESATRGNFTDDSDFLGCIGCAIMRRKQQSMNAT 565

Query: 559 LPDICDKCFTNYCWNGTIDNTPTK 582
           LP  C++CFTNYCWNGTIDNTP K
Sbjct: 566 LPTECNQCFTNYCWNGTIDNTPAK 589

>CAGL0J11770g complement(1145135..1147114) highly similar to
           sp|P39105 Saccharomyces cerevisiae YMR008c PLB1 or
           sp|Q08108 Saccharomyces cerevisiae YOL011w PLB3 or
           sp|Q03674 Saccharomyces cerevisiae YMR006c PLB2, start
           by similarity
          Length = 659

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/590 (56%), Positives = 445/590 (75%), Gaps = 10/590 (1%)

Query: 22  YTPQNVSCPDNANFIRNAADGLSPAEKEWLKKRDPITRDALQTFLRRAFANVSTEITSA- 80
           Y P NV+CP++ N +RNA  GLS +E +WLKKRD  TR+AL++FL+R  +N ++  +++ 
Sbjct: 29  YVPANVTCPNDINLLRNAT-GLSQSEIDWLKKRDVNTREALESFLKRVTSNFTSNSSASN 87

Query: 81  ----LFN-DTENVPKLGIAVAGGGYRXXXXXXXXXXXXDNRTDGANEHGLGGLLQAATYM 135
               LF+ ++ N+PK+GIA +GGGYR            DNRTDGANEHGLGGLLQAATY+
Sbjct: 88  LIDQLFSTNSSNIPKIGIAASGGGYRAMLSGAGMVSAMDNRTDGANEHGLGGLLQAATYL 147

Query: 136 AGLSGGNWLTGTLAYNNFTSVQQILEEGDKADAIWNITNSFLNPYDKDFSKTLARWTAIG 195
           AGLSGGNWLT TL++NN+TSVQ I++  D   AIW+I++S ++P   +  KT +RW  I 
Sbjct: 148 AGLSGGNWLTTTLSWNNWTSVQDIVDSQDNDSAIWDISHSIVSPGGINIFKTGSRWDHIS 207

Query: 196 SQVQGKRDAGFNVTITDLWSRALAYGWFPTLPNAGAGLTWSSLRDNEIFMNGEMPMPISV 255
             V+ K+ AGFNV++ D+W RAL+Y +FPTL   G    WS LR++++F N EMPMPISV
Sbjct: 208 DAVEDKQKAGFNVSLADVWGRALSYQFFPTLYRGGVAYLWSDLRESDVFKNAEMPMPISV 267

Query: 256 ADGRYPGTTVINLNATVFEMTPFEIGSWDPSLNAFSDIKYLGTQVTDGKPETE-RCINGF 314
           ADGRYPGT VI+LN+TVFE +PFE+GSWDPSL+AF+D++YLGT+V+DGKP  E +CI GF
Sbjct: 268 ADGRYPGTAVIDLNSTVFEYSPFELGSWDPSLSAFTDVQYLGTKVSDGKPAEEGKCIAGF 327

Query: 315 DDASFIMGTSSSLFNEFTMS-NDSAVAYTYLNTLSSTLVKGIDKENNDIAMYAPNPFKGS 373
           D+  F+MGTSS+LFN+F +  ND+++   ++  L++  +K + ++ +DIA+YAPNPF+ +
Sbjct: 328 DNVGFLMGTSSTLFNQFLLRINDTSIP-KFIRNLATHFLKDLSEDYDDIAVYAPNPFRDA 386

Query: 374 KYVDSNYTTSIVDSDSLFLVDGGEDLQGIPFVPLLKQERDLDIIFAIDVDTETSDNYPAG 433
            YV++N + S+ +S+ LFLVDGGED Q +P VPL++QERDLDI+FA+D   +T +N+P G
Sbjct: 387 DYVNNNRSKSLSESEYLFLVDGGEDGQNVPLVPLIQQERDLDIVFALDNSADTEENWPDG 446

Query: 434 GPMMKTYERQFSKQGKGMAFPYVPDMTTFVNLGLGGKPSFYGCDANNLTDLEYIPPLIVY 493
             +M TY RQF  QG+G+ FP VP   TFVNLGL  KP+F+GCDA N+TDLEYIPPLIVY
Sbjct: 447 ASLMHTYRRQFGFQGQGVTFPSVPGTDTFVNLGLNKKPTFFGCDARNMTDLEYIPPLIVY 506

Query: 494 IPNSYHSFESNVSTFKLNYNYSERVGMIRNAFEATTRNNLTEDADYVTCVGCAIIRRKQQ 553
           IPNS HS+  N STFKL+Y+  ER+G+IRN FEA T NNLT D+++  C+GCAI+RRKQQ
Sbjct: 507 IPNSRHSYNGNTSTFKLSYSEKERLGVIRNGFEAATMNNLTADSNFAGCIGCAIMRRKQQ 566

Query: 554 SLNLTLPDICDKCFTNYCWNGTIDNTPTKLLTPNNQDPAAISSAIAAVTD 603
           +LNLTLP  C+ CFTNYCWNGTIDNTP K +T +N    A  SA A + +
Sbjct: 567 ALNLTLPKECETCFTNYCWNGTIDNTPAKGVTASNDFDNASGSAAADMAE 616

>YMR008C (PLB1) [3972] chr13 complement(280590..282584)
           Phospholipase B, preferentially deacylates
           phosphatidylcholine and phosphatidylethanolamine [1995
           bp, 664 aa]
          Length = 664

 Score =  690 bits (1780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/559 (58%), Positives = 425/559 (76%), Gaps = 4/559 (0%)

Query: 22  YTPQNVSCPDNANFIRNAADGLSPAEKEWLKKRDPITRDALQTFLRRAFANVS-TEITSA 80
           Y P NV+C D+ N +R A+ GLS  E EWLKKRD  T++AL +FL RA +N S T + S 
Sbjct: 29  YVPANVTCDDDINLVREAS-GLSDNETEWLKKRDAYTKEALHSFLNRATSNFSDTSLLST 87

Query: 81  LF-NDTENVPKLGIAVAGGGYRXXXXXXXXXXXXDNRTDGANEHGLGGLLQAATYMAGLS 139
           LF +++ N+PK+ +A +GGGYR            DNRTDGANEHGLGGLLQ ATY+AGLS
Sbjct: 88  LFGSNSSNMPKIAVACSGGGYRAMLSGAGMLAAMDNRTDGANEHGLGGLLQGATYLAGLS 147

Query: 140 GGNWLTGTLAYNNFTSVQQILEEGDKADAIWNITNSFLNPYDKDFSKTLARWTAIGSQVQ 199
           GGNWLT TLA+NN+TSVQ I++   ++++IW+I++S L P   +  KT +RW  I   VQ
Sbjct: 148 GGNWLTSTLAWNNWTSVQAIVDNTTESNSIWDISHSILTPDGINIFKTGSRWDDISDDVQ 207

Query: 200 GKRDAGFNVTITDLWSRALAYGWFPTLPNAGAGLTWSSLRDNEIFMNGEMPMPISVADGR 259
            K+DAGFN+++ D+W RALAY ++P+L   G G TWS+LR+ ++F NGEMP PI+VADGR
Sbjct: 208 DKKDAGFNISLADVWGRALAYNFWPSLHRGGVGYTWSTLREADVFKNGEMPFPITVADGR 267

Query: 260 YPGTTVINLNATVFEMTPFEIGSWDPSLNAFSDIKYLGTQVTDGKPETE-RCINGFDDAS 318
           YPGTTVINLNAT+FE  PFE+GSWDP+LNAF+D+KYLGT VT+GKP  + +CI GFD+  
Sbjct: 268 YPGTTVINLNATLFEFNPFEMGSWDPTLNAFTDVKYLGTNVTNGKPVNKGQCIAGFDNTG 327

Query: 319 FIMGTSSSLFNEFTMSNDSAVAYTYLNTLSSTLVKGIDKENNDIAMYAPNPFKGSKYVDS 378
           FI  TSS+LFN+F +  +S    +++  L++  ++ +   ++DIA+YAPNPFK + ++  
Sbjct: 328 FITATSSTLFNQFLLRLNSTDLPSFIANLATDFLEDLSDNSDDIAIYAPNPFKEANFLQK 387

Query: 379 NYTTSIVDSDSLFLVDGGEDLQGIPFVPLLKQERDLDIIFAIDVDTETSDNYPAGGPMMK 438
           N T+SI++S+ LFLVDGGED Q IP VPLL++ER+LD+IFA+D   +T D +P G  ++ 
Sbjct: 388 NATSSIIESEYLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSADTDDYWPDGASLVN 447

Query: 439 TYERQFSKQGKGMAFPYVPDMTTFVNLGLGGKPSFYGCDANNLTDLEYIPPLIVYIPNSY 498
           TY+RQF  QG  ++FPYVPD+ TFVNLGL  KP+F+GCDA NLTDLEYIPPLIVYIPNS 
Sbjct: 448 TYQRQFGSQGLNLSFPYVPDVNTFVNLGLNKKPTFFGCDARNLTDLEYIPPLIVYIPNSR 507

Query: 499 HSFESNVSTFKLNYNYSERVGMIRNAFEATTRNNLTEDADYVTCVGCAIIRRKQQSLNLT 558
           HSF  N STFK++Y+ SER+GMI+N FEA T  N T+D+D++ CVGCAIIRRKQQ+LN T
Sbjct: 508 HSFNGNQSTFKMSYSDSERLGMIKNGFEAATMGNFTDDSDFLGCVGCAIIRRKQQNLNAT 567

Query: 559 LPDICDKCFTNYCWNGTID 577
           LP  C +CFTNYCWNGTID
Sbjct: 568 LPSECSQCFTNYCWNGTID 586

>YOL011W (PLB3) [4805] chr15 (305349..307409) Phospholipase B
           (lysophospholipase) [2061 bp, 686 aa]
          Length = 686

 Score =  685 bits (1768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/564 (57%), Positives = 421/564 (74%), Gaps = 6/564 (1%)

Query: 22  YTPQNVSCPDNANFIRNAADGLSPAEKEWLKKRDPITRDALQTFLRRAFANVS--TEITS 79
           Y P  VSCPD+ N +R A   +S  E  WL+KR+ +T  AL+ FL RA AN S  +E+ S
Sbjct: 33  YVPGTVSCPDDINLVREAT-SISQNESAWLEKRNKVTSVALKDFLTRATANFSDSSEVLS 91

Query: 80  ALFND--TENVPKLGIAVAGGGYRXXXXXXXXXXXXDNRTDGANEHGLGGLLQAATYMAG 137
            LFND  +EN+PK+ +AV+GGGYR            DNRT+GA EHGLGGLLQ+ TY++G
Sbjct: 92  KLFNDGNSENLPKIAVAVSGGGYRSMLTGAGVLAAMDNRTEGAYEHGLGGLLQSTTYLSG 151

Query: 138 LSGGNWLTGTLAYNNFTSVQQILEEGDKADAIWNITNSFLNPYDKDFSKTLARWTAIGSQ 197
            SGGNWL GTLA NN+TSVQ IL      D+IW++++S + P   +  KT  RW  I + 
Sbjct: 152 ASGGNWLVGTLALNNWTSVQDILNNMQNDDSIWDLSDSIVTPGGINIFKTAKRWDHISNA 211

Query: 198 VQGKRDAGFNVTITDLWSRALAYGWFPTLPNAGAGLTWSSLRDNEIFMNGEMPMPISVAD 257
           V+ K++A +N ++ D+W RALAY +FP+L   G GLTWSS+RD  +F N EMP PISVAD
Sbjct: 212 VESKQNADYNTSLADIWGRALAYNFFPSLNRGGIGLTWSSIRDFPVFQNAEMPFPISVAD 271

Query: 258 GRYPGTTVINLNATVFEMTPFEIGSWDPSLNAFSDIKYLGTQVTDGKP-ETERCINGFDD 316
           GRYPGT VINLNATVFE  PFE+GSWDPSLN+F+++KYLGT V++G P E  +C  GFD+
Sbjct: 272 GRYPGTKVINLNATVFEFNPFEMGSWDPSLNSFANVKYLGTNVSNGVPLERGKCTAGFDN 331

Query: 317 ASFIMGTSSSLFNEFTMSNDSAVAYTYLNTLSSTLVKGIDKENNDIAMYAPNPFKGSKYV 376
           A FIMGTSS+LFN+F +  +S    +++  L+   +K + ++ NDIA+Y+PNPFK +K++
Sbjct: 332 AGFIMGTSSTLFNQFLLRINSTHLPSFITRLARHFLKDLSQDFNDIAVYSPNPFKDTKFL 391

Query: 377 DSNYTTSIVDSDSLFLVDGGEDLQGIPFVPLLKQERDLDIIFAIDVDTETSDNYPAGGPM 436
           DS+YTTSIVDSDSLFLVDGGED + +P +PL+++ERD+DIIFA+D   +    +P G  +
Sbjct: 392 DSDYTTSIVDSDSLFLVDGGEDDENVPVLPLIQKERDVDIIFAVDNSADMRLAWPDGSSL 451

Query: 437 MKTYERQFSKQGKGMAFPYVPDMTTFVNLGLGGKPSFYGCDANNLTDLEYIPPLIVYIPN 496
           + TYERQF KQG+GM+FPYVPD  TFVNLGL  KP+F+GCDANNLTDL+YIPPL+VY+PN
Sbjct: 452 VHTYERQFVKQGQGMSFPYVPDTNTFVNLGLNKKPTFFGCDANNLTDLQYIPPLVVYLPN 511

Query: 497 SYHSFESNVSTFKLNYNYSERVGMIRNAFEATTRNNLTEDADYVTCVGCAIIRRKQQSLN 556
           + +SF SN S FKL+Y+ S+R  MI+N FE  TRNN T+D +++ CVGCAIIRRKQQ+LN
Sbjct: 512 AEYSFNSNQSAFKLSYSESQRRSMIQNGFEIATRNNFTDDPEFMGCVGCAIIRRKQQALN 571

Query: 557 LTLPDICDKCFTNYCWNGTIDNTP 580
           +TLP  C+ CF NYCWNGT+D TP
Sbjct: 572 ITLPPECETCFKNYCWNGTLDTTP 595

>Sklu_1900.1 YMR008C, Contig c1900 2946-4922 reverse complement
          Length = 658

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/576 (56%), Positives = 422/576 (73%), Gaps = 10/576 (1%)

Query: 22  YTPQNVSCPDNANFIRNAADGLSPAEKEWLKKRDPITRDALQTFLRRAFANVS-TEITSA 80
           YTP NV+C D+ N +R A  GLS  E EWLKKR+  T  AL+ FL RA  N +   I   
Sbjct: 23  YTPGNVTCDDDINLVREAV-GLSTDESEWLKKREVYTNSALEDFLNRATENFTDNSIVKT 81

Query: 81  LFNDTENVPKLGIAVAGGGYRXXXXXXXXXXXXDNRTDGANEHGLGGLLQAATYMAGLSG 140
           LFN + + P++G+A +GGGYR            DNRT G+ EHGLGGLLQ+ TY+AGLSG
Sbjct: 82  LFN-SSSAPRIGVACSGGGYRAMLSGAGMLAAMDNRTRGSVEHGLGGLLQSTTYLAGLSG 140

Query: 141 GNWLTGTLAYNNFTSVQQILEEGDKADAIWNITNSFLNPYDKDFSKTLARWTAIGSQVQG 200
           GNWL GTLA+NN+TSVQ IL+   + D IW+I+NS ++P   +  +T +RW  I   V  
Sbjct: 141 GNWLVGTLAWNNWTSVQHILDTMGQDDDIWDISNSIISPGGTNVLETTSRWDDISDAVDA 200

Query: 201 KRDAGFNVTITDLWSRALAYGWFPTLPNAGAGLTWSSLRDNEIFMNGEMPMPISVADGRY 260
           K+DAGFN ++TD+W RAL+Y +FPTLPN G   TWS+LR+ ++F N EMP PISVADGRY
Sbjct: 201 KQDAGFNASLTDVWGRALSYDFFPTLPNGGDAYTWSTLREADVFKNAEMPFPISVADGRY 260

Query: 261 PGTTVINLNATVFEMTPFEIGSWDPSLNAFSDIKYLGTQVTDGKPETE-RCINGFDDASF 319
           PGT VINLNATVFE  PFE+GSWD SL AF+++KYLGT+V +G PET+ +CI GFD+  F
Sbjct: 261 PGTQVINLNATVFEFNPFEMGSWDRSLRAFTNVKYLGTKVNNGTPETKGQCIAGFDNTGF 320

Query: 320 IMGTSSSLFNEFTMSNDSAVAY------TYLNTLSSTLVKGIDKENNDIAMYAPNPFKGS 373
           IMGTSSSLFN+F++ ++S +        +YL   ++  + G+ K+ +DIA+YAPNPFKG+
Sbjct: 321 IMGTSSSLFNQFSLQSNSTLMLLNASLPSYLYKFANKFLTGLSKDYDDIALYAPNPFKGT 380

Query: 374 KYVDSNYTTSIVDSDSLFLVDGGEDLQGIPFVPLLKQERDLDIIFAIDVDTETSDNYPAG 433
            YV  NYT SIV+S+ L+LVDGGED Q IP +PLL++ER+LD+IFA+D   +T+  +P G
Sbjct: 381 NYVFENYTRSIVESEILYLVDGGEDGQNIPLIPLLQEERELDVIFALDNSADTNQYWPNG 440

Query: 434 GPMMKTYERQFSKQGKGMAFPYVPDMTTFVNLGLGGKPSFYGCDANNLTDLEYIPPLIVY 493
             + +TYERQF KQG  +AFPYVPD++TFV LGL  +P+F+GCDA NLTDL+YIPPL+VY
Sbjct: 441 FSLTQTYERQFEKQGDDIAFPYVPDVSTFVELGLNKRPTFFGCDATNLTDLDYIPPLVVY 500

Query: 494 IPNSYHSFESNVSTFKLNYNYSERVGMIRNAFEATTRNNLTEDADYVTCVGCAIIRRKQQ 553
           +PN+  SF SN STFKL+Y+   R  MI+N FEA TRNNLT+D+D+V+CV CA+IRRKQQ
Sbjct: 501 MPNTKESFNSNQSTFKLSYSSENRRAMIKNGFEAVTRNNLTDDSDFVSCVACAVIRRKQQ 560

Query: 554 SLNLTLPDICDKCFTNYCWNGTIDNTPTKLLTPNNQ 589
           S+N TLP+ C+KCFTNYCWN         + + NNQ
Sbjct: 561 SMNATLPEECEKCFTNYCWNDNASKGSASISSYNNQ 596

>Scas_685.3
          Length = 677

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/565 (55%), Positives = 423/565 (74%), Gaps = 8/565 (1%)

Query: 22  YTPQNVSCPDNANFIRNAADGLSPAEKEWLKKRDPITRDALQTFLRRA---FANVSTEIT 78
           Y P NV+C D+ N +R A+D LS  E++WLKKR+ IT ++L+TFL R+   F++ S+ + 
Sbjct: 26  YAPANVTCADDVNLLREASD-LSKDEQDWLKKRNTITAESLKTFLDRSTKNFSDSSSSLL 84

Query: 79  SALFNDTENVPKLGIAVAGGGYRXXXXXXXXXXXXDNRTDGANEHGLGGLLQAATYMAGL 138
           + LF D +NVPK+GIA +GGGYR            DNRT GAN+HGLGGLLQ++TY+AGL
Sbjct: 85  NKLFQDGDNVPKIGIAASGGGYRAMLAGAGMLAAMDNRTSGANDHGLGGLLQSSTYLAGL 144

Query: 139 SGGNWLTGTLAYNNFTSVQQILEEGDKADAIWNITNSFLNPYDKDFSKTLARWTAIGSQV 198
           SGGNWLT TLA+NN+TSVQ I++     ++IW+I NS  +  +   S     WT I + V
Sbjct: 145 SGGNWLTTTLAWNNWTSVQDIIDNITVENSIWDIDNSLFSISEMANSSI---WTDIANDV 201

Query: 199 QGKRDAGFNVTITDLWSRALAYGWFPTLPNAGAGLTWSSLRDNEIFMNGEMPMPISVADG 258
           + K+DAGFNVT+ DLW RALAY +FP L + GAG TWS+LRD+E+F N EMP PI+VADG
Sbjct: 202 KAKQDAGFNVTLADLWGRALAYNFFPDLYHGGAGYTWSTLRDSEVFKNAEMPFPITVADG 261

Query: 259 RYPGTTVINLNATVFEMTPFEIGSWDPSLNAFSDIKYLGTQVTDGKP-ETERCINGFDDA 317
           RYPGTTVI+LNATVFE  PFE+GSWDP+LN+F+D+KYLGT V++GKP +  +C+ GFD+A
Sbjct: 262 RYPGTTVISLNATVFEFNPFEMGSWDPTLNSFTDVKYLGTNVSNGKPIDAGQCVAGFDNA 321

Query: 318 SFIMGTSSSLFNEFTMSNDSAVAYTYLNTLSSTLVKGIDKENNDIAMYAPNPFKGSKYVD 377
            F++GTS++LFN   +   S++    L+ L       +    NDIA+Y+PNPF+ +  V 
Sbjct: 322 GFVLGTSATLFNLMPLPFTSSMLPKSLSVLGDNFTASLADTYNDIAIYSPNPFRDADSVK 381

Query: 378 SNYTTSIVDSDSLFLVDGGEDLQGIPFVPLLKQERDLDIIFAIDVDTETSDNYPAGGPMM 437
           SN++ +IVDSD LFLVDGGED + IP VPLL+++R LD++FA+D +++T+ ++P G  ++
Sbjct: 382 SNFSKAIVDSDDLFLVDGGEDGEVIPLVPLLQEKRGLDVVFALDFNSDTTTSWPDGSSLV 441

Query: 438 KTYERQFSKQGKGMAFPYVPDMTTFVNLGLGGKPSFYGCDANNLTDLEYIPPLIVYIPNS 497
            TY+RQF  QG+GM+FPYVPD  TF+  GL  KP+F+GCDA NLTDLEYIPPLIVYIPNS
Sbjct: 442 ATYQRQFEDQGEGMSFPYVPDTETFIKYGLNTKPTFFGCDAKNLTDLEYIPPLIVYIPNS 501

Query: 498 YHSFESNVSTFKLNYNYSERVGMIRNAFEATTRNNLTEDADYVTCVGCAIIRRKQQSLNL 557
            +SF SN ST +L+YN S+R+GMI+N FE+ TR N T+D +++ C+GCAI+RRKQQSLN 
Sbjct: 502 RYSFNSNTSTLQLSYNSSQRLGMIQNGFESATRGNFTDDPEFLGCIGCAIMRRKQQSLNE 561

Query: 558 TLPDICDKCFTNYCWNGTIDNTPTK 582
           TLP  C++CFTNYCWNGT+  +  K
Sbjct: 562 TLPSECEQCFTNYCWNGTLAGSVAK 586

>Kwal_56.22510
          Length = 641

 Score =  655 bits (1691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/583 (52%), Positives = 416/583 (71%), Gaps = 7/583 (1%)

Query: 22  YTPQNVSCPDNANFIRNAADGLSPAEKEWLKKRDPITRDALQTFLRRAFANVSTEITSAL 81
           Y P NVSC D+ N +R A+  LSP E EWLKKRD  T++AL+TFL RA +N S       
Sbjct: 24  YVPGNVSCADDINLVRKAS-SLSPNETEWLKKRDAYTKEALRTFLDRATSNFSNSSLVDN 82

Query: 82  FNDTENVPKLGIAVAGGGYRXXXXXXXXXXXXDNRTDGANEHGLGGLLQAATYMAGLSGG 141
              +  +P++ +A +GGGYR            DNRT+GA EHGLGGLLQ+ TY+AGLSGG
Sbjct: 83  VWKSGKIPRIAVACSGGGYRAMLSGAGMLSAMDNRTNGATEHGLGGLLQSTTYLAGLSGG 142

Query: 142 NWLTGTLAYNNFTSVQQILEEGDKADAIWNITNSFLNPYDKDFSKTLARWTAIGSQVQGK 201
           NWL G+LA+NN+TSVQ I++     D +W+I+NS LNP   +   +  RW  I   V+ K
Sbjct: 143 NWLVGSLAWNNWTSVQHIIDTRGTDDELWDISNSILNPGGVNILTSANRWDQISDAVEAK 202

Query: 202 RDAGFNVTITDLWSRALAYGWFPTLPNAGAGLTWSSLRDNEIFMNGEMPMPISVADGRYP 261
            DAGFN ++ D+W RAL+Y +FPTL   G G TWS+LRD ++F NGEMP PISVADGRYP
Sbjct: 203 GDAGFNTSLADVWGRALSYDFFPTLYKGGLGYTWSTLRDADVFKNGEMPFPISVADGRYP 262

Query: 262 GTTVINLNATVFEMTPFEIGSWDPSLNAFSDIKYLGTQVTDGKPETE-RCINGFDDASFI 320
           GT +I+LN+T+FE  PFE+GSWDPSLNAF+D+KYLGT+V +G P T+ +C+ GFD+  F+
Sbjct: 263 GTQIIDLNSTLFEFNPFEMGSWDPSLNAFTDVKYLGTEVKNGTPVTQGQCVAGFDNTGFV 322

Query: 321 MGTSSSLFNEFTMSNDSAVAYTYLNTLSSTLVKGIDKENNDIAMYAPNPFKGSKYVDSNY 380
           MGTSS+LFN+F +  ++    ++L       ++ + +++NDIA+Y PNPF+ + YVD NY
Sbjct: 323 MGTSSTLFNQFLLQLNTTSVSSFLKGFIQDFLQDLSEDSNDIAIYNPNPFRDTAYVDKNY 382

Query: 381 TTSIVDSDSLFLVDGGEDLQGIPFVPLLKQERDLDIIFAIDVDTETSDNYPAGGPMMKTY 440
           T  IV+S++LFLVDGGED + IP VPL++Q+RD+D+IFA+D   +T + +PAG  +M TY
Sbjct: 383 THGIVNSENLFLVDGGEDGENIPLVPLIQQDRDVDVIFALDNSADTDEYWPAGLSLMHTY 442

Query: 441 ERQFSKQGKGMAFPYVPDMTTFVNLGLGGKPSFYGCDANNLTDLEYIPPLIVYIPNSYHS 500
           ERQF  QGK +AFPYVPD+ TFVN GL  KP F+GCDA N +DL Y PPLIVY+PN+  S
Sbjct: 443 ERQFGPQGKDIAFPYVPDVDTFVNEGLNTKPVFFGCDATNTSDLAYTPPLIVYMPNNRQS 502

Query: 501 FESNVSTFKLNYNYSERVGMIRNAFEATTRNNLTEDADYVTCVGCAIIRRKQQSLNLTLP 560
           + SN STFK++Y+ S+R+ M +N FEA TRNNLT+D++++ CV CA++RRKQ+S N+T P
Sbjct: 503 YNSNTSTFKMSYSSSQRMKMYQNGFEAITRNNLTDDSNFMGCVACAVLRRKQESQNMTFP 562

Query: 561 DICDKCFTNYCWNGTIDNTPTKLLTPNNQDPAAISSAIAAVTD 603
           + C KCF NYCW+G      + + T +N      S +++ VTD
Sbjct: 563 EECTKCFQNYCWDGKTSKKTSNVTTLDN-----YSGSMSFVTD 600

>Scas_644.8
          Length = 704

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/577 (52%), Positives = 410/577 (71%), Gaps = 18/577 (3%)

Query: 22  YTPQNVSCPD------NANF-IRNAADGLSPAEKEWLKKRDPITRDALQTFLRRAFA--- 71
           Y P  + C        N +F +   AD +S  E  WL+KR   TR+ L  FL R+     
Sbjct: 29  YAPSYMDCKQALGSAFNEDFSLIREADSISHNESLWLQKRMQNTREPLLQFLNRSLTSLN 88

Query: 72  -----NVSTEITSALFNDTENVPKLGIAVAGGGYRXXXXXXXXXXXXDNRTDGANEHGLG 126
                + +  ++S + +D+ + PK+GIAV+GGGYR            DNRT GA  HGLG
Sbjct: 89  TSSSFDTAALLSSLMGSDSASQPKIGIAVSGGGYRSMLTGAGILAAMDNRTRGAQHHGLG 148

Query: 127 GLLQAATYMAGLSGGNWLTGTLAYNNFTSVQQILEEGDKADAIWNITNSFLNPYDKDFSK 186
           GLLQ+ TY++G SGGNWL GTLAYNN+TSVQ I++  +++D+IW+++ S ++P  K+  K
Sbjct: 149 GLLQSTTYLSGASGGNWLVGTLAYNNWTSVQSIIDNFNESDSIWDLSESIVSPGGKNIFK 208

Query: 187 TLARWTAIGSQVQGKRDAGFNVTITDLWSRALAYGWFPTLPNAGAGLTWSSLRDNEIFMN 246
           +  RW  I   +Q K+ AGF+ ++ D+W RAL+Y +FP+L   G   TWSSLRD+ +F  
Sbjct: 209 SARRWDHISDALQDKQKAGFDTSLADVWGRALSYKFFPSLYRGGVAYTWSSLRDSPVFTE 268

Query: 247 GEMPMPISVADGRYPGTTVINLNATVFEMTPFEIGSWDPSLNAFSDIKYLGTQVTDGKP- 305
           G+MP PISVADGRYPG+ V+NLNATVFE  PFE+GSWDPSLN F+D+K+LGT V+ GKP 
Sbjct: 269 GQMPFPISVADGRYPGSKVLNLNATVFEFNPFEMGSWDPSLNTFTDVKFLGTNVSAGKPI 328

Query: 306 ETERCINGFDDASFIMGTSSSLFNEFTMSNDSAVAYT--YLNTLSSTLVKGIDKENNDIA 363
           +++RC+ GFD+ +FIMGTSS+LFN+F +  +S   +   ++  L++  +K I ++ ND+A
Sbjct: 329 DSQRCVQGFDNTAFIMGTSSTLFNQFLLRINSTNLHLPGFITKLATHFLKDISQDFNDVA 388

Query: 364 MYAPNPFKGSKYVDSNYTTSIVDSDSLFLVDGGEDLQGIPFVPLLKQERDLDIIFAIDVD 423
            Y PNPFK + ++D+NYT SIV+S SL+LVDGGED + IP +PL+++ERDLDI+FAID  
Sbjct: 389 TYHPNPFKDANFIDANYTKSIVNSKSLYLVDGGEDDENIPLLPLIQRERDLDIVFAIDNS 448

Query: 424 TETSDNYPAGGPMMKTYERQFSKQGKGMAFPYVPDMTTFVNLGLGGKPSFYGCDANNLTD 483
            +    +P G  ++ T+ERQF +QG+GMAFPYVP   TFVNLGL  KP+F+GCDA+NLTD
Sbjct: 449 MDMKLAWPDGSSLVHTFERQFVRQGQGMAFPYVPGTDTFVNLGLNQKPTFFGCDAHNLTD 508

Query: 484 LEYIPPLIVYIPNSYHSFESNVSTFKLNYNYSERVGMIRNAFEATTRNNLTEDADYVTCV 543
           LEYIPPL++Y+PN  +SF SN S FKL+Y   +R  MI N FE  TRNN T+D D++ C+
Sbjct: 509 LEYIPPLVIYLPNKQYSFPSNQSAFKLSYTEEQRRAMISNGFEIATRNNFTDDPDFLGCI 568

Query: 544 GCAIIRRKQQSLNLTLPDICDKCFTNYCWNGTIDNTP 580
           GCAIIRRKQQSLNLTLP+ C+ CFTNYCWNGT+D TP
Sbjct: 569 GCAIIRRKQQSLNLTLPEGCNTCFTNYCWNGTLDTTP 605

>KLLA0C05940g 524768..526690 gi|3169132|dbj|BAA28619.1 Kluyveromyces
           lactis phospholipase B, start by similarity
          Length = 640

 Score =  617 bits (1592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/559 (52%), Positives = 390/559 (69%), Gaps = 4/559 (0%)

Query: 22  YTPQNVSCPDNANFIRNAADGLSPAEKEWLKKRDPITRDALQTFLRRAFANVS--TEITS 79
           Y P  V C +N N +R A D +S  E +WLK R   T  AL+ FL+R F   +  T I  
Sbjct: 32  YAPGVVDCDENINLVRKA-DAVSDDEADWLKVRHESTVPALKDFLQRGFKGFTNDTSIID 90

Query: 80  ALFNDTENVPKLGIAVAGGGYRXXXXXXXXXXXXDNRTDGANEHGLGGLLQAATYMAGLS 139
            L    +  PK+ IA +GGGYR            DNRTDGAN+HGLGGLLQ++TY+AGLS
Sbjct: 91  KLLATQDTAPKVAIACSGGGYRAMLSGAGMISAMDNRTDGANDHGLGGLLQSSTYLAGLS 150

Query: 140 GGNWLTGTLAYNNFTSVQQILEEGDKADAIWNITNSFLNPYDKDFSKTLARWTAIGSQVQ 199
           GGNWL GTLAYNN+TSVQ I+      ++IW+I+NS +NP   +   +++RW  I   V+
Sbjct: 151 GGNWLVGTLAYNNWTSVQAIINNMTDDNSIWDISNSIVNPGGINIFSSISRWDDISDAVE 210

Query: 200 GKRDAGFNVTITDLWSRALAYGWFPTLPNAGAGLTWSSLRDNEIFMNGEMPMPISVADGR 259
            K+ AGFN +ITD+W RAL+Y +FP+L   G G TW++LRD ++F NGEMP PISVA GR
Sbjct: 211 EKKKAGFNTSITDVWGRALSYNFFPSLDEGGVGYTWNTLRDVDVFKNGEMPFPISVAVGR 270

Query: 260 YPGTTVINLNATVFEMTPFEIGSWDPSLNAFSDIKYLGTQVTDGKPE-TERCINGFDDAS 318
           YPGT V+NLNATVFE  PFE+GSWD +L+ F+D++Y GT VT+G P  T +C+ GFD+  
Sbjct: 271 YPGTQVVNLNATVFEFNPFEMGSWDYTLHTFTDVRYAGTNVTNGTPNVTGKCVAGFDNTG 330

Query: 319 FIMGTSSSLFNEFTMSNDSAVAYTYLNTLSSTLVKGIDKENNDIAMYAPNPFKGSKYVDS 378
           F+MGTSSSLFN+F +  ++    ++L  L    +     + +DI+++APNPF     + S
Sbjct: 331 FVMGTSSSLFNQFLLQLNTTDLPSFLYNLLHGFLTDASDDYDDISIWAPNPFYEITNIPS 390

Query: 379 NYTTSIVDSDSLFLVDGGEDLQGIPFVPLLKQERDLDIIFAIDVDTETSDNYPAGGPMMK 438
           NY+ SI + D+L+LVDGGED Q IP  PLL+ ER++D+IFA+D   +T  ++P G  + +
Sbjct: 391 NYSQSISEDDTLYLVDGGEDGQNIPLTPLLQTEREIDVIFALDNSADTDQSWPDGFSLTQ 450

Query: 439 TYERQFSKQGKGMAFPYVPDMTTFVNLGLGGKPSFYGCDANNLTDLEYIPPLIVYIPNSY 498
           TY RQF  QGKG+AFPYVPD+ TF NLGL  +P+F+GCDA NLTDLE IPPL+VY+PN+ 
Sbjct: 451 TYARQFGLQGKGIAFPYVPDVNTFTNLGLNTRPTFFGCDARNLTDLESIPPLVVYMPNTR 510

Query: 499 HSFESNVSTFKLNYNYSERVGMIRNAFEATTRNNLTEDADYVTCVGCAIIRRKQQSLNLT 558
            SF SN STFK++Y+ SER  MI+N FEA T  NLT+D +++ C+ CAI+RRKQ+SLN T
Sbjct: 511 ESFNSNTSTFKMSYSTSERFKMIQNGFEAVTMKNLTKDENFMGCISCAILRRKQESLNYT 570

Query: 559 LPDICDKCFTNYCWNGTID 577
           LP  CD CF  YCWNGT+D
Sbjct: 571 LPSECDACFEKYCWNGTVD 589

>CAGL0E02321g 222466..224580 some similarities with sp|Q08108
           Saccharomyces cerevisiae YOL011w PLB3 phospholipase B,
           hypothetical start
          Length = 704

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/576 (50%), Positives = 405/576 (70%), Gaps = 19/576 (3%)

Query: 22  YTPQNVSCP-DNANFIRNAADGLSPAEKEWLKKRDPITRDALQTFLRRAFANVS--TEIT 78
           Y P+   CP D+ N +R A+ GLS  E +WL++RD  T++AL  FL+RA ++    T++ 
Sbjct: 26  YAPKLAYCPSDDINLVREAS-GLSQNETQWLQRRDVRTKEALHNFLQRATSSSQNFTQLF 84

Query: 79  SALFNDTENVPKLGIAVAGGGYRXXXXXXXXXXXXDNRTDGANEHGLGGLLQAATYMAGL 138
             +F D   VP++GIAV+GGGYR            DNRT GA +HGLGG+LQ+ TYM G 
Sbjct: 85  HRIF-DAGMVPRIGIAVSGGGYRSMLTGAGILSAFDNRTRGAMDHGLGGILQSTTYMTGC 143

Query: 139 SGGNWLTGTLAYNNFTSVQQILE----------EGD-KADAIWNITNSFLNPYDKDFSKT 187
           SGGNWL  +L++NN+TSVQ IL+          +G    D IW++++S ++P   +  KT
Sbjct: 144 SGGNWLVASLSWNNWTSVQDILDMNYDRKTARKQGKITKDPIWDLSDSIVSPGGLNIIKT 203

Query: 188 LARWTAIGSQVQGKRDAGFNVTITDLWSRALAYGWFPTLPNAGAGLTWSSLRDNEIFMNG 247
             RW  I + V+ K++AGFN ++ D+W RAL+Y +FPTL   G   TWSSLRD+ IF  G
Sbjct: 204 ARRWDHITNAVKAKQEAGFNTSLADVWGRALSYKFFPTLERGGIDYTWSSLRDSPIFQAG 263

Query: 248 EMPMPISVADGRYPGTTVINLNATVFEMTPFEIGSWDPSLNAFSDIKYLGTQVTDGKP-- 305
           +MP+PI+VADGRYPG+  I LNATVFE  PFE+GSWDPSLNAF+D+KYLGT VT+GKP  
Sbjct: 264 DMPLPITVADGRYPGSNAIALNATVFEFNPFEMGSWDPSLNAFTDVKYLGTNVTNGKPVA 323

Query: 306 -ETERCINGFDDASFIMGTSSSLFNEFTMSNDSAVAYTYLNTLSSTLVKGIDKENNDIAM 364
              ++CI GFD+ +FIMGTSS+LFN+F +  +S     ++   ++ L+K    E ND+A+
Sbjct: 324 HTAKKCIEGFDNTAFIMGTSSNLFNQFLLRINSTHLPNFVTKWATNLLKSWAHEFNDVAV 383

Query: 365 YAPNPFKGSKYVDSNYTTSIVDSDSLFLVDGGEDLQGIPFVPLLKQERDLDIIFAIDVDT 424
           Y PNPFK ++YV  N++TSIVDS+ L+LVDGGED + +P +PLL+++RDLDIIFAID   
Sbjct: 384 YNPNPFKDTRYVMENFSTSIVDSEHLYLVDGGEDDENVPLIPLLQRDRDLDIIFAIDNSA 443

Query: 425 ETSDNYPAGGPMMKTYERQFSKQGKGMAFPYVPDMTTFVNLGLGGKPSFYGCDANNLTDL 484
           +    +P G  ++ TYERQF  QG+ +AFP++PD  TF+NLGL  +P+F+GC+A N+T L
Sbjct: 444 DNKLQWPDGSSLVHTYERQFVLQGQKIAFPHIPDTNTFINLGLNKRPTFFGCNATNMTSL 503

Query: 485 EYIPPLIVYIPNSYHSFESNVSTFKLNYNYSERVGMIRNAFEATTRNNLTEDADYVTCVG 544
           +YIPPL+VY PNS +SF SN S FKL+Y+  +   MI N FE  TRNN T+D +++ C+ 
Sbjct: 504 KYIPPLVVYYPNSEYSFNSNQSAFKLSYSRDQMANMISNGFEIATRNNFTDDPEFIGCIA 563

Query: 545 CAIIRRKQQSLNLTLPDICDKCFTNYCWNGTIDNTP 580
           CAI++RKQ++L+L LP  C++C   YCW+GT+D+TP
Sbjct: 564 CAIMKRKQEALDLELPSECERCLARYCWDGTVDDTP 599

>Scas_92.0d
          Length = 236

 Score =  251 bits (641), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 159/207 (76%), Gaps = 1/207 (0%)

Query: 228 NAGAGLTWSSLRDNEIFMNGEMPMPISVADGRYPGTTVINLNATVFEMTPFEIGSWDPSL 287
           N G   TWS+LR+ ++F N EMP PISVADGRYPGT VINLNATVFE  PFE+GSWD SL
Sbjct: 18  NGGDAYTWSTLREADVFKNAEMPFPISVADGRYPGTQVINLNATVFEFNPFEMGSWDRSL 77

Query: 288 NAFSDIKYLGTQVTDGKPETE-RCINGFDDASFIMGTSSSLFNEFTMSNDSAVAYTYLNT 346
            AF+++KYLGT+V +G PET+ +CI GFD+  FIMGTSSSLFN+F +  ++    +++  
Sbjct: 78  RAFTNVKYLGTKVNNGTPETKGQCIAGFDNTGFIMGTSSSLFNQFLLQLNTTGLPSFIYK 137

Query: 347 LSSTLVKGIDKENNDIAMYAPNPFKGSKYVDSNYTTSIVDSDSLFLVDGGEDLQGIPFVP 406
           L++  + G+  + +DIA+YAPNPFKG+ +V  NYT SIV+S+ L+LVDGGED Q IP VP
Sbjct: 138 LANKFLTGLSDDYDDIALYAPNPFKGTGHVVENYTRSIVESEILYLVDGGEDGQNIPLVP 197

Query: 407 LLKQERDLDIIFAIDVDTETSDNYPAG 433
           LL++ER+LD+IFA+D   +T+  +P G
Sbjct: 198 LLQEERELDVIFALDNSADTNQYWPNG 224

>Sklu_2442.19 YNL012W, Contig c2442 32274-34028 reverse complement
          Length = 584

 Score =  225 bits (574), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 161/475 (33%), Positives = 241/475 (50%), Gaps = 73/475 (15%)

Query: 149 AYNNFTSVQQIL------EEGDKADAIWNITNSFLNPYDKDFSKTLARWTAIGSQVQGKR 202
           A ++FT  + I+      ++G   + + N+  S      K+F +TL  +  +  +V+ K+
Sbjct: 133 AIDSFTRFKSIVADFFKHKQGTSEERVENLLGSL-----KNFRQTLEFYINLHFEVRPKK 187

Query: 203 DAGFNVTITDLWSRALAYGWFPTLPNAGAGLTWSSLRDNEIFMNGEMPMPISVADGR-YP 261
             GF+++ TD W RAL       L N+ +      L +   F   ++P PI V++ +  P
Sbjct: 188 IKGFHLSFTDYWGRALMKKMSSHLSNSQSMSMSMLLENCRNFKEFKVPFPIIVSNCKNSP 247

Query: 262 GTTVINLNATVFEMTPFEIGSWDPSLNAFSDIKYLGTQVTDGKPETERCINGFDDASFIM 321
             TV      VFE TPFE GSWD  LN F  +KYLG+++  GK  T RC NGFDD  FI 
Sbjct: 248 SKTV------VFEFTPFEFGSWDEYLNEFIKLKYLGSKIVSGK--TFRCFNGFDDIGFIS 299

Query: 322 GTSSSLFNEFTM------SNDSAVAYTYLNTLSST----LVKGI---DKENN-----DIA 363
            TSSS+FN   +      +N S      +  + ST    LVK +   D  NN     D A
Sbjct: 300 ATSSSIFNNVLVYVWQMAANSSKETLKAIRAIMSTFGLRLVKDMGAKDVPNNPLTRPDYA 359

Query: 364 MYAPNPFKGSKYVDSNYTTSIVDSDSLFLVDGGEDLQGIPFVPLLKQERDLDIIFAIDVD 423
           +Y PNPF     V++  T      + L+LVDGGE+ + IP  PLL  +R LD+IFA+D  
Sbjct: 360 LYRPNPFYKLLTVNNELTKE----NHLYLVDGGENGENIPIRPLLLPQRKLDVIFALDSS 415

Query: 424 TETSDNYPAGGPMMKTY------ERQFSKQGKGMA-----FPYVPDMTTFVNLGLGGKPS 472
           ++ S+NYP G  +   Y      +   +   +G+       PY+P+  +FV   L  +P 
Sbjct: 416 SD-SNNYPNGTILRNLYNNFHNGQESLNITREGITSNIDLLPYIPNSKSFVEQQLFSRPV 474

Query: 473 FYGCD----------ANNLTDLEYIPPLIVYIPNSYHSFESNVSTFKLNYNYSERVGMIR 522
            +GC            N  T+   +PP+++Y  N +HS+ SN STFK +YN SE  GM+R
Sbjct: 475 AFGCHLSSYHVREQYVNKTTESTNLPPIVIYYANYHHSYSSNTSTFKQSYNSSEIEGMLR 534

Query: 523 NAFEATTRNNLTEDAD--YVTCVGCAIIRRKQQSLNLT--LPDICDKCFTNYCWN 573
           N      ++    DA+  Y  C+GC II+R+      T  LP+ C +C+ +YC+N
Sbjct: 535 NG-----QDIFGFDANNTYHKCLGCIIIKREYDRRQTTAELPEFCHQCYQDYCFN 584

 Score = 33.5 bits (75), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 23/34 (67%), Gaps = 2/34 (5%)

Query: 127 GLLQAATYMAGLSGGNWLTGTLAYN--NFTSVQQ 158
           GLL    Y++GLSGG+W+  +L  +  NF S+Q+
Sbjct: 15  GLLDCLAYISGLSGGSWILTSLILHDFNFKSLQK 48

>AAL027W [160] [Homologous to ScYNL012W (SPO1) - SH]
           complement(295617..297395) [1779 bp, 592 aa]
          Length = 592

 Score =  225 bits (573), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 151/428 (35%), Positives = 214/428 (50%), Gaps = 58/428 (13%)

Query: 184 FSKTLARWTAIGSQVQGKRDAGFNVTITDLWSRALAYGWFPTLPNAGAGLTWSSL-RDNE 242
           F K L+ +  + S+V+ K+  GF V+ TD W RAL   W     N     + S L   +E
Sbjct: 185 FRKVLSFYIDLHSEVRPKKIMGFPVSFTDYWGRAL---WKKIYVNESMISSMSELFARSE 241

Query: 243 IFMNGEMPMPISVADGRYPGTTVINLNATVFEMTPFEIGSWDPSLNAFSDIKYLGTQVTD 302
           I  N E P+PI +A+ +     ++N    VFE TPFE GSW+  L  F ++KYLG+  T+
Sbjct: 242 ITNNYEAPLPIIIANCK--NEDLVN---AVFEFTPFEFGSWNRLLGLFVNLKYLGSNFTE 296

Query: 303 GKPETERCINGFDDASFIMGTSSSLFNEFTM------SNDSAVAYTYLNTLSSTLVKGID 356
           G  ++  C+ GFDD  FI  TSSSLFN   +      S  S      +  L ST   G++
Sbjct: 297 GVAQS--CVQGFDDIGFITATSSSLFNNVLIYAWKLASESSLKTMKAIRALFSTF--GVN 352

Query: 357 KEN---------NDIAMYAPNPFKGSKYVDSNYTTSIVDSDSLFLVDGGEDLQGIPFVPL 407
            +N         +D A++ PNPF     VDS  T    +SD L+LVDGGED + IP  P 
Sbjct: 353 LKNKPNSFFGTRSDFALFQPNPFYRYPGVDSPLT----NSDKLYLVDGGEDGENIPLRPF 408

Query: 408 LKQERDLDIIFAIDVDTETSDNYPAGGPMMKTYERQFSKQGKGMA------------FPY 455
           L+ ER +D+IFA+D  +    NYP GG +   Y+   +  G                 PY
Sbjct: 409 LQPERQVDLIFALD-SSSGRINYPTGGILRNLYDNLHATDGAAAVVQTGDVQSVTDLLPY 467

Query: 456 VPDMTTFVNLGLGGKPSFYGC--------DANNLTDLEYIPPLIVYIPNSYHSFESNVST 507
           +P    F   GL  +P  +GC        +A+       +PP++ Y  N   ++ SN ST
Sbjct: 468 IPSAEEFEAKGLLKRPVAFGCYPESYHIRNASATAAPGKLPPIVFYHANRNSTYNSNTST 527

Query: 508 FKLNYNYSERVGMIRNAFEATTRNNLTEDADYVTCVGCAIIRRKQQSLNLT--LPDICDK 565
           FKL YN+SE  GM+ N     T +N T    Y  CVGC +++R   ++N +  LP  C +
Sbjct: 528 FKLRYNHSEVQGMLENGASLFTHDNNTA---YFQCVGCLVVKRAYDNVNASAKLPPTCQQ 584

Query: 566 CFTNYCWN 573
           CF  YC+N
Sbjct: 585 CFRRYCYN 592

 Score = 33.1 bits (74), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 9/51 (17%)

Query: 127 GLLQAATYMAGLSGGNWLTGTLAYNNFTSVQQILEEGDKADAIWNITNSFL 177
           GL   A+Y+A +SGG+W    L   NF +++++ E        WNI +S L
Sbjct: 15  GLFNCASYIASISGGSWTLMRLLLTNF-NIEELKE--------WNINSSLL 56

>Kwal_0.173
          Length = 507

 Score =  203 bits (516), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 139/430 (32%), Positives = 209/430 (48%), Gaps = 59/430 (13%)

Query: 183 DFSKTLARWTAIGSQVQGKRDAGFNVTITDLWSRALAYGWFPTLPNAGAGLTWSSLRDNE 242
           +F + +  + A+  +V+ K+ +GF ++ TD W  AL     PT      G   +    ++
Sbjct: 98  NFRQIVQTYVALHLKVKSKKLSGFPISFTDYWGEALVTSIAPT---HTTGSISAFADKSQ 154

Query: 243 IFMNGEMPMPISVADGRYPGTTVINLNATVFEMTPFEIGSWDPSLNAFSDIKYLGTQVTD 302
            F   E+P+PI VA+ +       NL   VFE TPFE GSW  ++  F  ++YLG+Q+T 
Sbjct: 155 RFQRYEVPLPIFVANCKND-----NLRNAVFEFTPFEFGSWT-NMRLFIPLRYLGSQITA 208

Query: 303 GKPETERCINGFDDASFIMGTSSSLFNEFTMSNDSAVAYTY-----LNTLSSTLVKGIDK 357
           G P+  +CI GFD+  F+  TSSSLFN   M     VA +      +  + ST   GI K
Sbjct: 209 GTPQ--KCIIGFDEVGFVTATSSSLFNSVLMYVWHLVAPSLDTRKAVRAIFSTFGLGIHK 266

Query: 358 ------------ENNDIAMYAPNPFKGSKYVDSNYTTSIVDSDSLFLVDGGEDLQGIPFV 405
                        + + A+Y PNPF    Y     +  +   + L+LVDGGED + IP  
Sbjct: 267 TTTVSKGEANIMSHPEYAIYQPNPF----YKHPATSDVLAKHNQLYLVDGGEDGENIPIG 322

Query: 406 PLLKQERDLDIIFAIDVDTETSDNYPAGGPMMKTYERQFSKQGKGMAFPY-----VPDMT 460
           PLL  ER LD+IFA+D  ++   ++P G  +   Y+  +         PY     +P   
Sbjct: 323 PLLIPERKLDVIFALDSSSDVC-SFPNGTMLWNFYQNNYGHSSSKSNTPYQLLPLIPSSE 381

Query: 461 TFVNLGLGGKPSFYGCD------------ANNLTDLEYIPPLIVYIPNSYHSFESNVSTF 508
            FV   L  +P  +GC               N + LE +PP+++Y  N+ HSF SN+STF
Sbjct: 382 EFVARRLLSRPVAFGCHMESYPTLNSTNWVRNSSHLE-LPPILIYHANANHSFASNLSTF 440

Query: 509 KLNYNYSERVGMIRNAFEATTRNNLTEDADYVTCVGCAIIRRK-QQSLNL----TLPDIC 563
           KL Y+  E   M+RN     +     +   Y  C+ C +++R   +S+ L     LP  C
Sbjct: 441 KLKYSKIEVEQMLRNGKHIFS---FDDRPKYKRCLACLLVKRNYDRSIILGEEVRLPFFC 497

Query: 564 DKCFTNYCWN 573
           D CF+ YC+N
Sbjct: 498 DVCFSEYCYN 507

>YNL012W (SPO1) [4573] chr14 (609684..609788,609873..611663)
           Meiosis-specific protein with similarity to
           phospholipase B enzymes [1896 bp, 631 aa]
          Length = 631

 Score =  190 bits (483), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 143/483 (29%), Positives = 223/483 (46%), Gaps = 75/483 (15%)

Query: 135 MAGLSGGNWLTGTLAYNNFTSVQQILEEGDKADAIWNITNSFLNPYDK------------ 182
           M    GG+ +T   + N +  +++I+   ++    + IT   LNP  +            
Sbjct: 180 MKKRQGGSLITS--SSNFYEQIEEIMNSIEEIPEDYMITKRNLNPLARLKKIFFPNNTFT 237

Query: 183 -------DFSKTLARWTAIGSQVQGKRDAGFNVTITDLWSRALAYGW---FPTLPNAGAG 232
                   F K L  + ++  +++ K+  GF ++ TD W +A+       F   PN    
Sbjct: 238 GTDAKIETFKKVLDFYKSLHLKIKPKKMEGFQISFTDYWGKAIVQRLKKNFDDDPNHSFS 297

Query: 233 LTWSSLRDNEIFMNGEMPMPISVADGRYPGTTVINLNATVFEMTPFEIGSWDPSLNAFSD 292
            +   +  ++ F    +P+PI VA+ +  G     L+  +FE TPFE GSW+  L  F  
Sbjct: 298 FS-KLVNSSKKFKECSVPIPIFVANCK-NGL----LSNVIFEFTPFEFGSWENILRLFVK 351

Query: 293 IKYLGTQVTDGKPETERCINGFDDASFIMGTSSSLFNEFTM------SNDSAVAYTYLNT 346
           + YLG+++  GK   E+CIN FDD  FI  TSSS+FN   +      S  S  A   LN 
Sbjct: 352 LPYLGSKIVSGK--AEKCINNFDDLGFITATSSSIFNNVLIFIWNLASQSSREAMKALNM 409

Query: 347 LSSTLVKGIDKE------------NNDIAMYAPNPFKGSKYVDSNYTTSIVDSDSLFLVD 394
           +      G+ KE              D A+Y PNPF    Y+       + + + L+LVD
Sbjct: 410 VMGIF--GLGKEEIFSISKDSSRLETDYAVYQPNPF----YLYPEKDNVLTNKNHLYLVD 463

Query: 395 GGEDLQGIPFVPLLKQERDLDIIFAIDVDTETSDNYPAGGPMMKTYERQFSKQGKGMAFP 454
           GGED + IP   L+  ER+LD+IF +D  ++  DNYP G  + + +E+   ++     FP
Sbjct: 464 GGEDGENIPLRTLVIPERELDVIFVLDSSSDI-DNYPNGSKLKRIFEK-LDEENVHYQFP 521

Query: 455 YVPDMTTFVNLGLGGKPSFYGCDANNLTDLEYIPPLIVYIPNSYHSFESNVSTFKLNYNY 514
              ++ TF +      P   GC+A   T  +   P+I+Y  N+ H   SN STFK+ YN 
Sbjct: 522 --NNVKTFTH------PIVIGCNATKRTGHDSFLPIIIYHANANHGNASNTSTFKITYNQ 573

Query: 515 SERVGMIRNAFEATTRNNLTEDAD--YVTCVGCAIIRRKQQSL--NLTLPDICDKCFTNY 570
           SE   M+      T R   + D D  Y  C+GC + +R    L         C +CF +Y
Sbjct: 574 SEVSSML-----PTGRGVFSNDYDLYYKNCLGCILTKRTMDRLPRKKKFSPFCLQCFKDY 628

Query: 571 CWN 573
           C++
Sbjct: 629 CYS 631

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 69/142 (48%), Gaps = 16/142 (11%)

Query: 24  PQNVSCPDNANFIRNAADGLSPAEKEWLKKRDPITRDALQTFLRR-AFANVSTEITSALF 82
           P  V CP +   IR A   L P E  +LKK+   T++ L  FL+    A  S++    + 
Sbjct: 20  PFQVQCPSSP-LIREAKHELCPEETLYLKKKKIKTKNKLIQFLKSLTEAKFSSKFYKRVL 78

Query: 83  NDTENVPKLGIAVAGGGYRXXXXXXXXXXXXDNRTDGANEHGLGGLLQAATYMAGLSGGN 142
            D    PK+GIA++GGGYR            ++           GL + + Y+AGLSGG+
Sbjct: 79  KDP---PKIGIAISGGGYRSMLVGTGFISQMNDY----------GLFEYSDYIAGLSGGS 125

Query: 143 WLTGTLAYNNFTSVQQILEEGD 164
           W+   L   NF  V+ +L+E D
Sbjct: 126 WILMDLVVQNF-EVKSLLQEWD 146

>KLLA0F12232g join(1129199..1129312,1129409..1131337) similar to
           sp|P53541 Saccharomyces cerevisiae YNL012w SPO1
           transcriptional regulator involved in sporulation, start
           by similarity
          Length = 680

 Score =  186 bits (471), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 140/450 (31%), Positives = 208/450 (46%), Gaps = 58/450 (12%)

Query: 161 EEGDKADAIWNITNSFLNPYDKDFSKTLARWTAIGSQVQGKRDAGFNVTITDLWSRALAY 220
           EE D+ D    + N  ++ + K F K +  +  +  QV+ K++AGF +++TD   +AL  
Sbjct: 252 EENDQ-DKELEVINELMDSFGK-FRKIIGFYINLHRQVRQKKEAGFPISLTDYLGQAL-- 307

Query: 221 GWFPTLPNAGAGL--TWSSLRDNEIFMNGEMPMPISVADGRYPGTTVINLNATVFEMTPF 278
                LP          S+   +E F   + P+P+ VA+ +        L+  VFE TPF
Sbjct: 308 --LDRLPAQKQDHLKQLSNFVQSESFKKFDAPIPVFVANAKTSKGP--ELHNVVFEFTPF 363

Query: 279 EIGSWDPSLNAFSDIKYLGTQVTDGKPETERCINGFDDASFIMGTSSSLFNE-------- 330
           E GSW  +++ F   KYLG+    GK    +C+NGFD+  FI  TSSSLFN         
Sbjct: 364 EFGSWHLNVSKFISTKYLGSTALKGK--LTKCVNGFDNLGFITATSSSLFNNALFYIWKT 421

Query: 331 FTMSNDSAVAYTYLNTLSSTLVKGIDKENNDIAMYAPNPFKGSKYVDSNYTTSIVDSDSL 390
            T + +S      + T+      G +   +D A+Y PNPF    Y D      I D+  L
Sbjct: 422 VTTNIESNEKLKAIKTIFGVFGVGFNAIRSDYAIYQPNPF----YKDPEVLNLISDTSQL 477

Query: 391 FLVDGGEDLQGIPFVPLLKQERDLDIIFAIDVDTETSDNYPAGGPMMKTYER--QFSKQG 448
           FLVDGGED + IP   L    R  D+IF +D  ++  +N P    +  TY+      +Q 
Sbjct: 478 FLVDGGEDGENIPLRSLFISGRQNDVIFIVDSSSD-KENLPDMTKLRDTYDDIIHVEEQK 536

Query: 449 KGMAF----------PYVPDMTTFV--NLGLGGKPSFYGC-----DANNLTDL------- 484
           + +A           PY+P     +  N  L   P  +GC     +   LTD        
Sbjct: 537 RIVALKNEIWEMDLMPYIPTSEELLAANFSL-STPIAFGCHLQSYNTKRLTDTLITKETS 595

Query: 485 -EYIPPLIVYIPNSYHSFESNVSTFKLNYNYSERVGMIRNAFEATTRNNLTEDADYVTCV 543
              +PP+++Y  N   +F+SN STFKLNY   E  GM+ N       NN     +Y+ C+
Sbjct: 596 SASLPPILIYHGNIPITFQSNTSTFKLNYTKDEYNGMLNNGHHLF--NNDDTQGEYLQCL 653

Query: 544 GCAIIRRKQQSLNLTLPDICDKCFTNYCWN 573
           GC ++ R+ Q L   +   CD C    C+N
Sbjct: 654 GCVMLLRQNQEL---VSSFCDACIRKVCYN 680

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 57/133 (42%), Gaps = 19/133 (14%)

Query: 22  YTPQNVSCPDNANFIRNAADGLSPAEKEWLKKRDPITRDALQTFLR-RAFANVSTEITSA 80
           Y P NV CP + +      + LS  E ++L KR  + +   + F    A   ++      
Sbjct: 21  YAPVNVDCPKDLSLRAAKNEKLSALEFDYLSKRTEVIKGKFEKFYEDLAIPGINV----- 75

Query: 81  LFNDTENVPKLGIAVAGGGYRXXXXXXXXXXXXDNRTDGANEHGLGGLLQAATYMAGLSG 140
              D+   P++ +A++GGG+R                 G  +H   GL +  +Y+AG+SG
Sbjct: 76  ---DSLQFPRIAVAISGGGFRSMLISSGFVL-------GMQQH---GLWECTSYVAGISG 122

Query: 141 GNWLTGTLAYNNF 153
           G+W    L    F
Sbjct: 123 GSWTLLKLVLAEF 135

>CAGL0H03575g 331303..332847 similar to sp|P53541 Saccharomyces
           cerevisiae YNL012w SPO1, start by similarity
          Length = 514

 Score =  165 bits (418), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 126/415 (30%), Positives = 198/415 (47%), Gaps = 58/415 (13%)

Query: 184 FSKTLARWTAIGSQVQGKRDAGFNVTITDLWSRALA----YGWFPTLPNAGAGLTWS-SL 238
           F   L  +  +   ++ KR  GF ++ TD W++AL     Y   PT       LT+S S+
Sbjct: 129 FKNALQFYIDLHLHIRSKRINGFPISFTDYWAQALVQNIKYRQLPT------HLTYSKSV 182

Query: 239 RDNEIFMNGEMPMPISVADGRYPGTTVINLNATVFEMTPFEIGSWDPSLNAFSDIKYLGT 298
           R +  F N  +P+PI VA+ R        L   +FE TP+E GSW+  L  F +I+YLG+
Sbjct: 183 RTSNYFKNYLVPIPIIVANCRNGF-----LKNVIFEFTPWEFGSWEQVLGLFVNIEYLGS 237

Query: 299 QVTDGKPETERCINGFDDASFIMGTSSSLFNEFTM------SNDSAVAYTYLNTLSSTLV 352
           ++ +G   + +C  G DD  FI  TSSS+FN   +      S  S  A   + T+ +   
Sbjct: 238 RIING--VSHQCYKGLDDLGFIAATSSSIFNNALIYVWKLASKSSKDAIAAVKTVLAVFG 295

Query: 353 KGIDK--------------ENNDIAMYAPNPFKGSKYVDSNYTTSIVDSDSLFLVDGGED 398
            G  K               + D A+Y  NPF    Y  SN    +  +D L+LVDGGED
Sbjct: 296 LGTTKFESALQTSSQITAALDTDYAVYRHNPF----YKYSNIKNELAQNDYLYLVDGGED 351

Query: 399 LQGIPFVPLLKQERDLDIIFAIDVDTETSDNYPAGGPMMKTYERQFSKQGKGMAFPYVPD 458
            + IP   L+   R++D+I  +D  ++   NY A G  +K    Q  K+ +G+ + Y   
Sbjct: 352 GENIPIRTLV--PRNVDMIMIMDSSSD-KKNY-ANGDKLKIVLNQM-KEKEGIYYRYPTK 406

Query: 459 MTTFVNLGLGGKPSFYGCDANNLTDLEYIPPLIVYIPNSYHSFE--SNVSTFKLNYNYSE 516
           + T        +P+  GC     +D + + P++VY PNS  S    +N STFK+ Y   E
Sbjct: 407 IVTS-----QKRPTIIGCKPPRTSDTK-LAPILVYYPNSERSSTQVTNTSTFKMIYTSEE 460

Query: 517 RVGMIRNAFEATTRNNLTEDADYVTCVGCAIIRRKQQSLNLTLPDICDKCFTNYC 571
           +  +I + +   T +    + DY  C+ C +++R     ++  P  C  C++ YC
Sbjct: 461 QQLLIDHGYTLVTGHG---EHDYQKCMACILVKRSYDQASIIPPKQCSICYSKYC 512

>Scas_695.10
          Length = 553

 Score =  160 bits (405), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 122/405 (30%), Positives = 186/405 (45%), Gaps = 61/405 (15%)

Query: 173 TNSFLNPYDKDFSKTLARWTAIGSQVQGKRDAGFNVTITDLWSRALAYGW------FPTL 226
           +NS +  + + F + L  +  +  +V+ K+  GF V+ TD W  AL          F   
Sbjct: 160 SNSLIESF-QTFREVLNFYIDLHLRVRTKKIQGFFVSFTDYWGEALLKRLNNKDKKFSAF 218

Query: 227 PNAGAGLTWSSLRDNEI-FMNGEMPMPISVADGRYPGTTVINLNATVFEMTPFEIGSWDP 285
            N    +++S L ++ + F   E P+PI VA+ R        L   +FE +PFE GSW+ 
Sbjct: 219 ANT---VSFSKLIESNLKFSKFEAPIPIFVANNRNG-----RLKNVIFEFSPFEFGSWEK 270

Query: 286 SLNAFSDIKYLGTQVTDGKPETERCINGFDDASFIMGTSSSLFNEFTMSNDSAVAYTYLN 345
            L  F  + YLG+++ +G  +   C   FDD  FI  TSSS+FN   +     ++ + L 
Sbjct: 271 MLRLFVKLPYLGSKIVNGTAKI--CYKEFDDIGFITATSSSIFNNVLIFIWQKMSRSSLE 328

Query: 346 TLSS--------------------TLVKGIDKENNDIAMYAPNPFKGSKYVDSNYTTSIV 385
            + S                    TL         D A+Y  NPF    +   N   ++ 
Sbjct: 329 AMKSVKAVMGLFGLIGTKDSTKPLTLSNTAIAPETDYAVYYHNPF----FRYPNIDNALT 384

Query: 386 DSDSLFLVDGGEDLQGIPFVPLLKQERDLDIIFAIDVDTETSDNYPAGGPMMKTYERQFS 445
             D L+LVDGGED + IP   L+  ER +D+IFAID  ++  +NY A G  + T  R   
Sbjct: 385 KDDHLYLVDGGEDGENIPLRSLIIPERKVDVIFAIDSSSDV-NNY-ANGTKLITILRHLE 442

Query: 446 KQGKGMAFPYVPDMTTFVNLGLGGKPSFYGCDANNLTDLEYIPPLIVYIPNSYHSFESNV 505
           K G     P +              P  +GC+A +L       P+I+Y  N+ HS+ SN 
Sbjct: 443 KLGYHYKIPKISKKRI-------NHPLIFGCNAPSL-------PIIIYHANTEHSYPSNT 488

Query: 506 STFKLNYNYSERVGMIRNAFEATTRNNLTEDADYVTCVGCAIIRR 550
           STFK+ YN +E   M++N  +    N   E+  Y  C+GC + +R
Sbjct: 489 STFKVTYNETEVGAMLQNGMDIFNDN---ENIYYQNCLGCILSKR 530

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 34/73 (46%), Gaps = 10/73 (13%)

Query: 87  NVPKLGIAVAGGGYRXXXXXXXXXXXXDNRTDGANEHGLGGLLQAATYMAGLSGGNWLTG 146
           N P +G+A++GGGYR              +          GL    +Y++GLSGG+W+  
Sbjct: 7   NPPNIGVALSGGGYRSMLTGTGFILGMQEK----------GLWDCVSYLSGLSGGSWVLM 56

Query: 147 TLAYNNFTSVQQI 159
            L  NNF   + I
Sbjct: 57  DLIVNNFNITKMI 69

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,901,262
Number of extensions: 947330
Number of successful extensions: 2223
Number of sequences better than 10.0: 25
Number of HSP's gapped: 2186
Number of HSP's successfully gapped: 30
Length of query: 684
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 576
Effective length of database: 12,857,365
Effective search space: 7405842240
Effective search space used: 7405842240
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)