Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0J11726g33633115970.0
YMR005W (TAF4)3882619931e-134
Scas_611.23363369231e-124
ACL016C3612547612e-99
KLLA0C05962g3662537448e-97
Kwal_56.225054032507226e-93
YPL254W (HFI1)48855800.051
YJR107W32853720.43
AFL171W43255700.87
Scas_699.1343355700.96
KLLA0B10351g43258681.8
KLLA0D10065g46642662.7
Kwal_56.2454044245653.7
Kwal_23.605943255636.0
AAR100C40457637.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J11726g
         (331 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J11726g 1140123..1141133 similar to sp|P50105 Saccharomyces...   619   0.0  
YMR005W (TAF4) [3970] chr13 (276045..277211) Component of RNA po...   387   e-134
Scas_611.2                                                            360   e-124
ACL016C [1033] [Homologous to ScYMR005W (MPT1) - SH] (331298..33...   297   2e-99
KLLA0C05962g complement(527216..528316) similar to sp|P50105 Sac...   291   8e-97
Kwal_56.22505                                                         282   6e-93
YPL254W (HFI1) [5196] chr16 (69485..70951) Component of the ADA ...    35   0.051
YJR107W (YJR107W) [2999] chr10 (627254..628240) Protein of unkno...    32   0.43 
AFL171W [3024] [Homologous to ScYPL254W (HFI1) - SH] complement(...    32   0.87 
Scas_699.13                                                            32   0.96 
KLLA0B10351g complement(904656..905954) similar to sp|Q12060 Sac...    31   1.8  
KLLA0D10065g complement(851283..852683) similar to sp|Q03212 Sac...    30   2.7  
Kwal_56.24540                                                          30   3.7  
Kwal_23.6059                                                           29   6.0  
AAR100C [286] [Homologous to ScYPR120C (CLB5) - SH; ScYGR109C (C...    29   7.3  

>CAGL0J11726g 1140123..1141133 similar to sp|P50105 Saccharomyces
           cerevisiae YMR005w MPT1 required for protein synthesis,
           hypothetical start
          Length = 336

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/331 (92%), Positives = 306/331 (92%)

Query: 1   MSSQKRPSEESTGSGTKKVKLEETKTPSLKSEASNLALPKMNDSSNNINAVXXXXXXXXX 60
           MSSQKRPSEESTGSGTKKVKLEETKTPSLKSEASNLALPKMNDSSNNINAV         
Sbjct: 1   MSSQKRPSEESTGSGTKKVKLEETKTPSLKSEASNLALPKMNDSSNNINAVPLALPKGGD 60

Query: 61  XXXXXNSKTAQSGKNGGKEDGTGQKQKATDPNKMQDVLISAGVDLKEEEALLSSTVNVSK 120
                NSKTAQSGKNGGKEDGTGQKQKATDPNKMQDVLISAGVDLKEEEALLSSTVNVSK
Sbjct: 61  KKKKANSKTAQSGKNGGKEDGTGQKQKATDPNKMQDVLISAGVDLKEEEALLSSTVNVSK 120

Query: 121 TQQNAVVIPPHPPFLHPDQVSNFMKKVAKTQNFNLSFTKNTEILDMMSSACESYLRDIIT 180
           TQQNAVVIPPHPPFLHPDQVSNFMKKVAKTQNFNLSFTKNTEILDMMSSACESYLRDIIT
Sbjct: 121 TQQNAVVIPPHPPFLHPDQVSNFMKKVAKTQNFNLSFTKNTEILDMMSSACESYLRDIIT 180

Query: 181 NTIVVSRHRRKGVKVNYGRRSQVAAALRSIAINQXXXXXXXXXXXIALGLEKEDYENKMD 240
           NTIVVSRHRRKGVKVNYGRRSQVAAALRSIAINQ           IALGLEKEDYENKMD
Sbjct: 181 NTIVVSRHRRKGVKVNYGRRSQVAAALRSIAINQKKEEERRMKKRIALGLEKEDYENKMD 240

Query: 241 SEETLHRASNVTATLRAGSKKQYGWLTSSINKPASIGVKSAGKVATEIAARGESGLKFRE 300
           SEETLHRASNVTATLRAGSKKQYGWLTSSINKPASIGVKSAGKVATEIAARGESGLKFRE
Sbjct: 241 SEETLHRASNVTATLRAGSKKQYGWLTSSINKPASIGVKSAGKVATEIAARGESGLKFRE 300

Query: 301 AREEPGIVMRDLLFALEHRRIGVHNIISKGY 331
           AREEPGIVMRDLLFALEHRRIGVHNIISKGY
Sbjct: 301 AREEPGIVMRDLLFALEHRRIGVHNIISKGY 331

>YMR005W (TAF4) [3970] chr13 (276045..277211) Component of RNA
           polymerase II general transcription factor TFIID [1167
           bp, 388 aa]
          Length = 388

 Score =  387 bits (993), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 186/261 (71%), Positives = 218/261 (83%), Gaps = 3/261 (1%)

Query: 74  KNGGKEDGTGQK-QKATDPNKMQDVLISAGVDLKEEEALLSSTVNVSKTQ--QNAVVIPP 130
           K+G   + +GQ  Q+ +DPNKMQDVL SAG+D++EEEALL+S++N SK+Q   N V IP 
Sbjct: 123 KDGKASNSSGQNAQQQSDPNKMQDVLFSAGIDVREEEALLNSSINASKSQVQTNNVKIPN 182

Query: 131 HPPFLHPDQVSNFMKKVAKTQNFNLSFTKNTEILDMMSSACESYLRDIITNTIVVSRHRR 190
           H PFLHP+QVSN+M+KV K QNFNL+ TKN EILDMMSSACE+Y+RDI+TN IV+SRHRR
Sbjct: 183 HLPFLHPEQVSNYMRKVGKEQNFNLTPTKNPEILDMMSSACENYMRDILTNAIVISRHRR 242

Query: 191 KGVKVNYGRRSQVAAALRSIAINQXXXXXXXXXXXIALGLEKEDYENKMDSEETLHRASN 250
           K VK+N GRRS+V+AALR+IA+ Q           IALGLEKEDYENK+DSEETLHRASN
Sbjct: 243 KAVKINSGRRSEVSAALRAIALIQKKEEERRVKKRIALGLEKEDYENKIDSEETLHRASN 302

Query: 251 VTATLRAGSKKQYGWLTSSINKPASIGVKSAGKVATEIAARGESGLKFREAREEPGIVMR 310
           VTA LRAGSKKQYGWLTSS+NKP S+G KS+GKVA++I ARGESGLKFREAREEPGIVMR
Sbjct: 303 VTAGLRAGSKKQYGWLTSSVNKPTSLGAKSSGKVASDITARGESGLKFREAREEPGIVMR 362

Query: 311 DLLFALEHRRIGVHNIISKGY 331
           DLLFALE+RR  V  IISKGY
Sbjct: 363 DLLFALENRRNSVQTIISKGY 383

>Scas_611.2
          Length = 336

 Score =  360 bits (923), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 190/336 (56%), Positives = 239/336 (71%), Gaps = 13/336 (3%)

Query: 2   SSQKRPSE-ESTGSGTKKVKLEETKTPS-LKSEASNLALPKMNDSSNNINAVXXXXXXXX 59
           SS KR  E + + + +KKVK     T S +    S+LALP+   SS ++++         
Sbjct: 3   SSPKRKQENDQSETNSKKVKTSNEGTNSNVPGGFSDLALPR---SSTDLSSKSTVPLALP 59

Query: 60  XXXXXXNSKTAQSGKNGGKEDGTGQKQKATDPNKMQDVLISAGVDLKEEEALLSSTVNVS 119
                  SKTA             Q+QK +DPNKMQDVL SAGVD++EEEALL+S++  S
Sbjct: 60  ISKMSKQSKTA----GNASTTNVSQQQKQSDPNKMQDVLFSAGVDIREEEALLNSSIIAS 115

Query: 120 KTQQNA--VVIPPHPPFLHPDQVSNFMKKVAKTQNFNL--SFTKNTEILDMMSSACESYL 175
           K + N   V IP HPPFLHPDQV+ FM++VAK Q       F+K  E+L MMS+ACE+Y+
Sbjct: 116 KNKINTMDVRIPSHPPFLHPDQVARFMQRVAKEQQRRTRQDFSKYPELLSMMSTACETYM 175

Query: 176 RDIITNTIVVSRHRRKGVKVNYGRRSQVAAALRSIAINQXXXXXXXXXXXIALGLEKEDY 235
           RDI+TN +V+SRHRR+ +K+N GRRS+++  LR+IA+ +           IALGLEKED 
Sbjct: 176 RDILTNALVISRHRRRAIKLNAGRRSEISMILRNIALKEKKDEEKRVKKRIALGLEKEDL 235

Query: 236 ENKMDSEETLHRASNVTATLRAGSKKQYGWLTSSINKPASIGVKSAGKVATEIAARGESG 295
           ENK+DSEETLHRASNVTA LRAGSKKQYGWLTSS++KP +  VKSAGKVA++IAARGE+G
Sbjct: 236 ENKIDSEETLHRASNVTAGLRAGSKKQYGWLTSSVSKPTNTSVKSAGKVASDIAARGETG 295

Query: 296 LKFREAREEPGIVMRDLLFALEHRRIGVHNIISKGY 331
           LKFREAREEPGIVMRDLL+ALE+RR GVHN+ISKGY
Sbjct: 296 LKFREAREEPGIVMRDLLYALENRRNGVHNVISKGY 331

>ACL016C [1033] [Homologous to ScYMR005W (MPT1) - SH]
           (331298..332383) [1086 bp, 361 aa]
          Length = 361

 Score =  297 bits (761), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 147/254 (57%), Positives = 189/254 (74%), Gaps = 4/254 (1%)

Query: 81  GTGQKQKATDPNKMQDVLISAGVDLKEEEALLSSTVNV--SKTQQNAVVIPPHPPFLHPD 138
           G G  ++ +DP+K+ D L+SAGVD+KEEEALLSSTV    S +Q +   IP HPPFLHP 
Sbjct: 104 GAGAPKQQSDPDKLSDALLSAGVDIKEEEALLSSTVTTMKSNSQVSNSQIPLHPPFLHPS 163

Query: 139 QVSNFMKKVAKTQNFNLSFTKNTEILDMMSSACESYLRDIITNTIVVSRHRRKGVKVNYG 198
            V++ MKKVA  QNFN  F+K++E+L +MS+ACE Y+RDIITN+I++SRHRRK VK+N G
Sbjct: 164 HVASMMKKVAAEQNFNQDFSKSSELLSLMSTACELYIRDIITNSIIISRHRRKAVKLNSG 223

Query: 199 RRSQVAAALRSIAINQXXXXXXXXXXXIALGLEKEDYENKMDSEETLHRASNVTATLR-A 257
           RRS+    LR +A+ Q           IALGLEKE  + K+DS ETLHRASN TA +  A
Sbjct: 224 RRSETTRVLRDLALKQREQEERRVKRRIALGLEKEITDTKLDSGETLHRASNATANMMIA 283

Query: 258 GSKKQYGWLTSSINKPASIGVKSAGKVATEIAARGESGLKFREAREEPGIVMRDLLFALE 317
           G KK+Y WLTS  +K  +  +K+ GKV++ +AARG+ G+KFREAREEPGIVMRDLL ALE
Sbjct: 284 GGKKKYSWLTSG-SKVNATDLKNPGKVSSAVAARGDLGIKFREAREEPGIVMRDLLHALE 342

Query: 318 HRRIGVHNIISKGY 331
           +RR+GV+N I+KGY
Sbjct: 343 NRRVGVNNTIAKGY 356

>KLLA0C05962g complement(527216..528316) similar to sp|P50105
           Saccharomyces cerevisiae YMR005w MPT1 required for
           protein synthesis singleton, start by similarity
          Length = 366

 Score =  291 bits (744), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 137/253 (54%), Positives = 192/253 (75%), Gaps = 9/253 (3%)

Query: 85  KQKATDPNKMQDVLISAGVDLKEEEALLSSTVNVSKTQQNAVV----IPPHPPFLHPDQV 140
           K + +DP+K+ D L+SAGVD++EEEALLSSTV  ++T+   +     +P HPPFLHP  +
Sbjct: 112 KPQQSDPDKLSDALLSAGVDIREEEALLSSTV--ARTKATGISANNQVPSHPPFLHPKNI 169

Query: 141 SNFMKKVAKTQNFNLSFTKNTEILDMMSSACESYLRDIITNTIVVSRHRRKGVKVNYGRR 200
           S+FMK++A  QNF+  F KNT+IL +MS+ACE Y+RD+ITN++++S HRRKGVK+N GRR
Sbjct: 170 SDFMKRIASEQNFHQDFNKNTDILGLMSTACELYMRDVITNSLILSIHRRKGVKLNTGRR 229

Query: 201 SQVAAALRSIAINQXXXXXXXXXXXIALGLEKEDYENKMDSEETLHRASNVTATLR--AG 258
           S+V+ +LR +A+ Q           IALGLEK+  + ++D+EET +RASN TA L    G
Sbjct: 230 SEVSRSLRDLALRQKTQEERRVQRRIALGLEKQTTDARLDTEETQYRASNATANLMIAGG 289

Query: 259 SKKQYGWLTSSINKPASIGVKSAGKVATEIAARGESGLKFREAREEPGIVMRDLLFALEH 318
           +KK+Y WLT+  +K +S  +K+ G V++ +AARGE G+K+REAREEPGIVMRDLL ALE+
Sbjct: 290 NKKKYSWLTAG-SKSSSTDLKNQGNVSSAVAARGEMGIKYREAREEPGIVMRDLLLALEN 348

Query: 319 RRIGVHNIISKGY 331
           RR+GV+N+I+KGY
Sbjct: 349 RRVGVNNVITKGY 361

>Kwal_56.22505
          Length = 403

 Score =  282 bits (722), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 134/250 (53%), Positives = 183/250 (73%), Gaps = 8/250 (3%)

Query: 89  TDPNKMQDVLISAGVDLKEEEALLSSTVNVSKTQQNAVV------IPPHPPFLHPDQVSN 142
           TDP+K+ D L SAGVD++EEEALL+S++N++K+   A        IPP PP LHP  +++
Sbjct: 150 TDPDKLSDALFSAGVDIREEEALLNSSMNITKSSAQAGAQAINNQIPPQPPLLHPTHIAS 209

Query: 143 FMKKVAKTQNFNLSFTKNTEILDMMSSACESYLRDIITNTIVVSRHRRKGVKVNYGRRSQ 202
           FMKKV   QNFN  F+K  ++L +MS+ACE ++ DIITN++V+SRHRR+ +K+N GRRS+
Sbjct: 210 FMKKVGSEQNFNQDFSKAHDVLSLMSTACEFFMTDIITNSLVISRHRRRSIKLNSGRRSE 269

Query: 203 VAAALRSIAINQXXXXXXXXXXXIALGLEKEDYENKMDSEETLHRASNVTATLR-AGSKK 261
           V+ ALR +AI Q           I++GLEKE  E KM+++ETLHRASN TA +  AG KK
Sbjct: 270 VSRALRDLAIQQKEQEERRVKRRISMGLEKETAEAKMETDETLHRASNATANMMIAGGKK 329

Query: 262 QYGWLTSSINKPASIGVKSAGKVATEIAARGESGLKFREAREEPGIVMRDLLFALEHRRI 321
           +Y WL +   K  +  VK  GKV++++AARGE G+++REAREEPGIVMRDLL ALE+RR+
Sbjct: 330 KYSWLNAGA-KANNNSVKVLGKVSSDVAARGEIGIRYREAREEPGIVMRDLLNALENRRV 388

Query: 322 GVHNIISKGY 331
           GV+ +I KGY
Sbjct: 389 GVNKVIPKGY 398

>YPL254W (HFI1) [5196] chr16 (69485..70951) Component of the ADA
           complex, the SAGA transcriptional activator-histone
           acetyltransferase complex, and the SLIK (SAGA-like)
           complex, interacts with Taf12p to form a histone-like
           paired complex [1467 bp, 488 aa]
          Length = 488

 Score = 35.4 bits (80), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 31/55 (56%)

Query: 137 PDQVSNFMKKVAKTQNFNLSFTKNTEILDMMSSACESYLRDIITNTIVVSRHRRK 191
           PD  S +++ V   +   L  T +   ++++S A + YL++II  TI   R+RRK
Sbjct: 267 PDTDSFYLRMVGIAREHGLVGTVDARCVELISLALDQYLKNIIEFTIDTVRYRRK 321

>YJR107W (YJR107W) [2999] chr10 (627254..628240) Protein of unknown
           function, has similarity to acylglycerol lipase [987 bp,
           328 aa]
          Length = 328

 Score = 32.3 bits (72), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 4/53 (7%)

Query: 104 DLKEEEALLSSTVNVSKTQQNAV----VIPPHPPFLHPDQVSNFMKKVAKTQN 152
           D  E+E++L   +   K     V     IP  PPF HP  +  F+ KV   QN
Sbjct: 227 DAIEKESILKDEIQFRKGYFRVVHTGDYIPMVPPFYHPAGLEMFINKVGLPQN 279

>AFL171W [3024] [Homologous to ScYPL254W (HFI1) - SH]
           complement(114799..116097) [1299 bp, 432 aa]
          Length = 432

 Score = 31.6 bits (70), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 30/55 (54%)

Query: 137 PDQVSNFMKKVAKTQNFNLSFTKNTEILDMMSSACESYLRDIITNTIVVSRHRRK 191
           PD  S +++ V+  +   L  T +   ++++S A E YL+ I+ + I   R+R K
Sbjct: 257 PDNDSLYLRMVSIAREHGLVGTVDGRCVEILSLALEYYLKTILESAIDTVRYREK 311

>Scas_699.13
          Length = 433

 Score = 31.6 bits (70), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 31/55 (56%)

Query: 137 PDQVSNFMKKVAKTQNFNLSFTKNTEILDMMSSACESYLRDIITNTIVVSRHRRK 191
           PD  S +++ V+  +   L    +   ++++S A + YL++II  TI   R+RRK
Sbjct: 258 PDADSLYLRMVSIAREHGLVGNVDARGIELLSMALDHYLKNIIEFTIDTVRYRRK 312

>KLLA0B10351g complement(904656..905954) similar to sp|Q12060
           Saccharomyces cerevisiae YPL254w HFI1 transcriptional
           coactivator singleton, hypothetical start
          Length = 432

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 32/58 (55%)

Query: 134 FLHPDQVSNFMKKVAKTQNFNLSFTKNTEILDMMSSACESYLRDIITNTIVVSRHRRK 191
           ++ PD  S +++ +   +   +    ++  +D++S A E YL+ II +TI   R+R K
Sbjct: 253 YVLPDNESLYLRMLGIARENGIVGQIDSRCVDIVSLALEYYLKTIIESTIDTVRYREK 310

>KLLA0D10065g complement(851283..852683) similar to sp|Q03212
           Saccharomyces cerevisiae YMR171c, start by similarity
          Length = 466

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 25/42 (59%), Gaps = 2/42 (4%)

Query: 95  QDVLISAGV--DLKEEEALLSSTVNVSKTQQNAVVIPPHPPF 134
           QDVL+ +    D+ + E++ S ++N   T Q+  ++PP P F
Sbjct: 375 QDVLLESAFEDDVSDSESITSDSINEQITDQSGNILPPPPGF 416

>Kwal_56.24540
          Length = 442

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 11/45 (24%), Positives = 27/45 (60%)

Query: 155 LSFTKNTEILDMMSSACESYLRDIITNTIVVSRHRRKGVKVNYGR 199
           ++ ++  E+LD+  S  E+++ D++   ++ ++  R    VN+GR
Sbjct: 356 INLSRLNELLDLTESETETFISDLVNLGVIYAKINRPAKIVNFGR 400

>Kwal_23.6059
          Length = 432

 Score = 28.9 bits (63), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 13/55 (23%), Positives = 30/55 (54%)

Query: 137 PDQVSNFMKKVAKTQNFNLSFTKNTEILDMMSSACESYLRDIITNTIVVSRHRRK 191
           PD  S +++ ++  +   L    +   +++M+ A E YL++++ + I   R+R K
Sbjct: 259 PDNDSLYLRMISIAREHGLVGAVDGRCVEIMTLALEIYLKNLVESAIDTVRYREK 313

>AAR100C [286] [Homologous to ScYPR120C (CLB5) - SH; ScYGR109C
           (CLB6) - SH] (523005..524219) [1215 bp, 404 aa]
          Length = 404

 Score = 28.9 bits (63), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 12/57 (21%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 142 NFMKKVAKTQNFNLSFTKNTEILDMMSSACESYLRDIITNTIVVSRHRRKGVKVNYG 198
           NF+++++K  N+N +     ++    +  C  ++   IT +++ +   R  + +NYG
Sbjct: 280 NFLRRISKADNYNHNTRNYAKVFLEYAMCCPKFV--AITPSVLAAMSMRCAMMLNYG 334

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.308    0.124    0.332 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,258,772
Number of extensions: 348572
Number of successful extensions: 1155
Number of sequences better than 10.0: 25
Number of HSP's gapped: 1144
Number of HSP's successfully gapped: 25
Length of query: 331
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 229
Effective length of database: 13,065,073
Effective search space: 2991901717
Effective search space used: 2991901717
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 62 (28.5 bits)