Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0J11704g50950125860.0
Scas_644.1051241213121e-178
YMR004W (MVP1)51152713121e-178
Sklu_2419.353140212461e-168
ACL014C52444611971e-160
Kwal_56.2249952743111801e-157
KLLA0C06006g51239811651e-155
Kwal_23.2896421901494e-10
KLLA0C10967g4001581485e-10
Scas_690.224281461423e-09
ACR074W4101151352e-08
Scas_663.191691501264e-08
CAGL0L10472g6382921166e-06
ADR390C163961043e-05
CAGL0J01001g430911084e-05
YOR069W (VPS5)6751501094e-05
CAGL0G06424g164961026e-05
YOR357C (GRD19)16274982e-04
Scas_712.333571251022e-04
YJL036W (SNX4)4231471013e-04
ADR211W60098996e-04
YDL113C (ATG20)64035940.003
Sklu_2428.664795930.003
KLLA0F16643g66592910.005
Kwal_23.343861434910.005
Sklu_1971.416567870.006
Scas_322.217667870.006
Kwal_26.6858160121850.008
KLLA0E09141g63631890.009
Sklu_2167.4349107860.016
Sklu_2219.2634107870.018
Kwal_55.2153315967830.018
Scas_698.3269973870.019
CAGL0H10428g75331860.022
Scas_580.318363830.022
YHR105W (YPT35)21487830.025
CAGL0I01144g17397820.028
ADR192C60384840.032
Scas_613.21649106830.046
Kwal_55.21745629104810.089
YGL212W (VAM7)316111780.17
CAGL0J06556g107885770.28
Sklu_2404.316359730.29
Sklu_2221.567166750.44
KLLA0A03718g16469720.48
Kwal_47.1907934583730.67
AER438C34883720.93
Scas_714.5863682664.8
Scas_564.550997665.5
YKR078W58540656.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J11704g
         (501 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J11704g 1138009..1139538 similar to sp|P40959 Saccharomyces...  1000   0.0  
Scas_644.10                                                           509   e-178
YMR004W (MVP1) [3969] chr13 (274017..275552) Protein required fo...   509   e-178
Sklu_2419.3 YMR004W, Contig c2419 3267-4862 reverse complement        484   e-168
ACL014C [1035] [Homologous to ScYMR004W (MVP1) - SH] (333900..33...   465   e-160
Kwal_56.22499                                                         459   e-157
KLLA0C06006g complement(530169..531707) similar to sp|P40959 Sac...   453   e-155
Kwal_23.2896                                                           62   4e-10
KLLA0C10967g 943312..944514 similar to sp|P47057 Saccharomyces c...    62   5e-10
Scas_690.22                                                            59   3e-09
ACR074W [1121] [Homologous to ScYJL036W (SNX4) - SH] complement(...    57   2e-08
Scas_663.19                                                            53   4e-08
CAGL0L10472g 1117867..1119783 similar to sp|Q92331 Saccharomyces...    49   6e-06
ADR390C [2131] [Homologous to ScYOR357C (GRD19) - SH] (1410245.....    45   3e-05
CAGL0J01001g 98637..99929 similar to sp|P47057 Saccharomyces cer...    46   4e-05
YOR069W (VPS5) [4876] chr15 (453769..455796) Member of the sorti...    47   4e-05
CAGL0G06424g complement(621136..621630) highly similar to sp|Q08...    44   6e-05
YOR357C (GRD19) [5134] chr15 complement(1009220..1009708) Protei...    42   2e-04
Scas_712.33                                                            44   2e-04
YJL036W (SNX4) [2875] chr10 (378741..380012) Putative nexin sort...    44   3e-04
ADR211W [1952] [Homologous to ScYOR069W (VPS5) - SH; ScYKR078W -...    43   6e-04
YDL113C (ATG20) [756] chr4 complement(256633..258555) Protein th...    41   0.003
Sklu_2428.6 YOR069W, Contig c2428 9095-11038 reverse complement        40   0.003
KLLA0F16643g 1533628..1535625 similar to sp|Q92331 Saccharomyces...    40   0.005
Kwal_23.3438                                                           40   0.005
Sklu_1971.4 YHR105W, Contig c1971 6476-6973                            38   0.006
Scas_322.2                                                             38   0.006
Kwal_26.6858                                                           37   0.008
KLLA0E09141g complement(817829..819739) similar to sgd|S0002271 ...    39   0.009
Sklu_2167.4 YGL212W, Contig c2167 6607-7656 reverse complement         38   0.016
Sklu_2219.2 YDL113C, Contig c2219 4054-5958                            38   0.018
Kwal_55.21533                                                          37   0.018
Scas_698.32                                                            38   0.019
CAGL0H10428g 1016374..1018635 similar to tr|Q07528 Saccharomyces...    38   0.022
Scas_580.3                                                             37   0.022
YHR105W (YPT35) [2393] chr8 (324768..325412) Protein that may pl...    37   0.025
CAGL0I01144g 95410..95931 similar to sp|P38815 Saccharomyces cer...    36   0.028
ADR192C [1933] [Homologous to ScYDR425W - SH] (1037233..1039044)...    37   0.032
Scas_613.21                                                            37   0.046
Kwal_55.21745                                                          36   0.089
YGL212W (VAM7) [1784] chr7 (91435..92385) Subunit of the vacuola...    35   0.17 
CAGL0J06556g 628854..632090 weakly similar to sp|Q01846 Saccharo...    34   0.28 
Sklu_2404.3 YOR357C, Contig c2404 1457-1948                            33   0.29 
Sklu_2221.5 YDR425W, Contig c2221 7089-9104                            33   0.44 
KLLA0A03718g 334828..335322 similar to sp|Q08826 Saccharomyces c...    32   0.48 
Kwal_47.19079                                                          33   0.67 
AER438C [2938] [Homologous to ScYGL212W (VAM7) - SH] (1474934..1...    32   0.93 
Scas_714.58                                                            30   4.8  
Scas_564.5                                                             30   5.5  
YKR078W (YKR078W) [3328] chr11 (584594..586351) Protein with sim...    30   6.7  

>CAGL0J11704g 1138009..1139538 similar to sp|P40959 Saccharomyces
           cerevisiae YMR004w MVP1 required for vacuolar protein
           sorting, hypothetical start
          Length = 509

 Score = 1000 bits (2586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/501 (97%), Positives = 488/501 (97%)

Query: 1   MDTYSGQNGWADTSNASPWGDTNDTMPIDXXXXXXXXXXXXXEDINTVRANLTESIWGTE 60
           MDTYSGQNGWADTSNASPWGDTNDTMPID             EDINTVRANLTESIWGTE
Sbjct: 1   MDTYSGQNGWADTSNASPWGDTNDTMPIDNSLSNSLSGLQLNEDINTVRANLTESIWGTE 60

Query: 61  RTGAPNNVETGLEAKDSLNVSTNFNELNTAILSPTSSTSNIEEQNSFTESLESWINEVRK 120
           RTGAPNNVETGLEAKDSLNVSTNFNELNTAILSPTSSTSNIEEQNSFTESLESWINEVRK
Sbjct: 61  RTGAPNNVETGLEAKDSLNVSTNFNELNTAILSPTSSTSNIEEQNSFTESLESWINEVRK 120

Query: 121 TYNPQQLDIISIEEIPEREGLLFKHANYSVKHLIDLPNTEPPKNRTVVRRYSDFLWLQEV 180
           TYNPQQLDIISIEEIPEREGLLFKHANYSVKHLIDLPNTEPPKNRTVVRRYSDFLWLQEV
Sbjct: 121 TYNPQQLDIISIEEIPEREGLLFKHANYSVKHLIDLPNTEPPKNRTVVRRYSDFLWLQEV 180

Query: 181 LLKRYPFRMIPDLPPKKIGSQNLDPVFLNKRRIGLSKFINLVMKHPKLSKDDLVLTFLTV 240
           LLKRYPFRMIPDLPPKKIGSQNLDPVFLNKRRIGLSKFINLVMKHPKLSKDDLVLTFLTV
Sbjct: 181 LLKRYPFRMIPDLPPKKIGSQNLDPVFLNKRRIGLSKFINLVMKHPKLSKDDLVLTFLTV 240

Query: 241 PTDLTSWRKQVSYDTADEFTDKRISKDFVKIWKKDLAEIWNNTANCIDELIDKWTKISIL 300
           PTDLTSWRKQVSYDTADEFTDKRISKDFVKIWKKDLAEIWNNTANCIDELIDKWTKISIL
Sbjct: 241 PTDLTSWRKQVSYDTADEFTDKRISKDFVKIWKKDLAEIWNNTANCIDELIDKWTKISIL 300

Query: 301 VDRHEKRLQIIANERKIMNDLIHDVGNLTKSVYPIDQNPTILDINSGMTVISKHIEKTNE 360
           VDRHEKRLQIIANERKIMNDLIHDVGNLTKSVYPIDQNPTILDINSGMTVISKHIEKTNE
Sbjct: 301 VDRHEKRLQIIANERKIMNDLIHDVGNLTKSVYPIDQNPTILDINSGMTVISKHIEKTNE 360

Query: 361 NYNQQALDTKQKVLPKFRMYTDILRALKNVFERYKMLATNNVSMLQKHIDLNLQKLEDMK 420
           NYNQQALDTKQKVLPKFRMYTDILRALKNVFERYKMLATNNVSMLQKHIDLNLQKLEDMK
Sbjct: 361 NYNQQALDTKQKVLPKFRMYTDILRALKNVFERYKMLATNNVSMLQKHIDLNLQKLEDMK 420

Query: 421 GKPDASGQEYDRIKTTIRKDRKIMYEQSNRAWLIRECILEEFTIFQETQFMITGCFQEWA 480
           GKPDASGQEYDRIKTTIRKDRKIMYEQSNRAWLIRECILEEFTIFQETQFMITGCFQEWA
Sbjct: 421 GKPDASGQEYDRIKTTIRKDRKIMYEQSNRAWLIRECILEEFTIFQETQFMITGCFQEWA 480

Query: 481 KVQSTYSSLNLNEWENVTNHI 501
           KVQSTYSSLNLNEWENVTNHI
Sbjct: 481 KVQSTYSSLNLNEWENVTNHI 501

>Scas_644.10
          Length = 512

 Score =  509 bits (1312), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 237/412 (57%), Positives = 319/412 (77%), Gaps = 5/412 (1%)

Query: 93  SPTSSTSNIEEQNS---FTESLESWINEVRKTYNPQQLDIISIEEIPEREGLLFKHANYS 149
            PT   S+  EQ+S    +E    W +++RK+YNP   DII+IEEIPEREGLLFKH NYS
Sbjct: 95  GPTQGQSH--EQSSELDQSELFGQWCDQIRKSYNPLGPDIITIEEIPEREGLLFKHTNYS 152

Query: 150 VKHLIDLPNTEPPKNRTVVRRYSDFLWLQEVLLKRYPFRMIPDLPPKKIGSQNLDPVFLN 209
           VKHLI+LP  +  K+  VVRRYSDFLWLQE LL+RYPFRM+P+LPPKK+GSQ  D +FL 
Sbjct: 153 VKHLIELPGQDSAKDNCVVRRYSDFLWLQETLLRRYPFRMVPELPPKKLGSQIADKIFLE 212

Query: 210 KRRIGLSKFINLVMKHPKLSKDDLVLTFLTVPTDLTSWRKQVSYDTADEFTDKRISKDFV 269
           KRR GL +FINLVMKHP   KDDLVLTFLTVPT+L++WRKQ S+DT+DEF DKRI+  FV
Sbjct: 213 KRRKGLLRFINLVMKHPVFQKDDLVLTFLTVPTELSNWRKQASFDTSDEFIDKRIAASFV 272

Query: 270 KIWKKDLAEIWNNTANCIDELIDKWTKISILVDRHEKRLQIIANERKIMNDLIHDVGNLT 329
           K+W K ++E WNN A+ I+  ++ W++I ILV+RHE++L+ +A+E+ I   L++D+ NLT
Sbjct: 273 KMWHKGISEQWNNAASSIERTMEIWSRICILVERHERKLKQMAHEQSIFGSLVNDLSNLT 332

Query: 330 KSVYPIDQNPTILDINSGMTVISKHIEKTNENYNQQALDTKQKVLPKFRMYTDILRALKN 389
            ++YPI+Q+ T+LDIN+  ++I KH+ KT +     A  T   +LPKF+++TDIL +L+ 
Sbjct: 333 PNLYPIEQSDTVLDINNHFSIIKKHLNKTQDIAQDNATKTCNSLLPKFKLFTDILLSLRG 392

Query: 390 VFERYKMLATNNVSMLQKHIDLNLQKLEDMKGKPDASGQEYDRIKTTIRKDRKIMYEQSN 449
           +FERYK++ATNN+  LQ+H+ LN +KLE MKGKPDA+G EYDRIK +I +D+K + EQ N
Sbjct: 393 LFERYKIMATNNIPQLQRHVVLNREKLEAMKGKPDANGVEYDRIKMSITRDKKSISEQLN 452

Query: 450 RAWLIRECILEEFTIFQETQFMITGCFQEWAKVQSTYSSLNLNEWENVTNHI 501
           RAWL+R+CILEEFTIFQETQFM+T  FQ+W+K+ +++  +NLNEWE +   +
Sbjct: 453 RAWLVRKCILEEFTIFQETQFMLTRAFQDWSKLNASFVGINLNEWEKLEEQL 504

>YMR004W (MVP1) [3969] chr13 (274017..275552) Protein required for
           sorting proteins to the vacuole, interacts genetically
           with Vps1p [1536 bp, 511 aa]
          Length = 511

 Score =  509 bits (1312), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 277/527 (52%), Positives = 354/527 (67%), Gaps = 50/527 (9%)

Query: 1   MDTYSGQNGWADTSNA----------------------SPWGDTNDTMPIDXXXXXXXXX 38
           MD Y G + W  +SNA                        +   N + P+D         
Sbjct: 1   MDNYEGSDPWNTSSNAWTKDDDHVVSTTNSEPSLNGISGEFNTLNFSTPLDTNE------ 54

Query: 39  XXXXEDINTVRAN--LTESIWGTERT--GAPNNVETGLEAKDSLNVSTNFNELNTAILSP 94
               ED   +  N  L ESIW   R   GA     TG+    + N++ N     T I   
Sbjct: 55  ----EDTGFLPTNDVLEESIWDDSRNPLGA-----TGM--SQTPNIAAN----ETVIDKN 99

Query: 95  TSSTSNIEEQNSFTESLESWINEVRKTYNPQQLDIISIEEIPEREGLLFKHANYSVKHLI 154
            +   NIEE  +    L  W N VRKTY P   DII IEEIPEREGLLFKHANY VKHLI
Sbjct: 100 DARDQNIEESEA---DLLDWTNNVRKTYRPLDADIIIIEEIPEREGLLFKHANYLVKHLI 156

Query: 155 DLPNTEPPKNRTVVRRYSDFLWLQEVLLKRYPFRMIPDLPPKKIGSQNLDPVFLNKRRIG 214
            LP+T P + RTVVRRYSDFLWL+E+LLKRYPFRMIP+LPPK+IGSQN D +FL KRRIG
Sbjct: 157 ALPSTSPSEERTVVRRYSDFLWLREILLKRYPFRMIPELPPKRIGSQNADQLFLKKRRIG 216

Query: 215 LSKFINLVMKHPKLSKDDLVLTFLTVPTDLTSWRKQVSYDTADEFTDKRISKDFVKIWKK 274
           LS+FINLVMKHPKLS DDLVLTFLTV TDLTSWRKQ +YDT++EF DK+IS++F+K+WKK
Sbjct: 217 LSRFINLVMKHPKLSNDDLVLTFLTVRTDLTSWRKQATYDTSNEFADKKISQEFMKMWKK 276

Query: 275 DLAEIWNNTANCIDELIDKWTKISILVDRHEKRLQIIANERKIMNDLIHDVGNLTKSVYP 334
           + AE WN  A+CID  ++ W +I++L++RHEKR+  + +ER     L+ +   +T  +YP
Sbjct: 277 EFAEQWNQAASCIDTSMELWYRITLLLERHEKRIMQMVHERNFFETLVDNFSEVTPKLYP 336

Query: 335 IDQNPTILDINSGMTVISKHIEKTNENYNQQALDTKQKVLPKFRMYTDILRALKNVFERY 394
           + QN TILDIN+ +++I KH+E T+    Q+  +    + PKF+++TDIL +L+++FERY
Sbjct: 337 VQQNDTILDINNNLSIIKKHLETTSSICKQETEEISGTLSPKFKIFTDILLSLRSLFERY 396

Query: 395 KMLATNNVSMLQKHIDLNLQKLEDMKGKPDASGQEYDRIKTTIRKDRKIMYEQSNRAWLI 454
           K++A NNV  LQ+H++LN +KLE MKGKPD SG EYDRIK  I+KDR+ + EQSNRAWLI
Sbjct: 397 KIMAANNVVELQRHVELNKEKLESMKGKPDVSGAEYDRIKKIIQKDRRSIIEQSNRAWLI 456

Query: 455 RECILEEFTIFQETQFMITGCFQEWAKVQSTYSSLNLNEWENVTNHI 501
           R+CILEEFTIFQETQF+IT  FQ+WAK+ S ++ L LNEWE +   I
Sbjct: 457 RQCILEEFTIFQETQFLITRAFQDWAKLNSNHAGLKLNEWEKLVTSI 503

>Sklu_2419.3 YMR004W, Contig c2419 3267-4862 reverse complement
          Length = 531

 Score =  484 bits (1246), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 223/402 (55%), Positives = 308/402 (76%), Gaps = 1/402 (0%)

Query: 96  SSTSNIEEQNSFTESLESWINEVRKTYNPQQLDIISIEEIPEREGLLFKHANYSVKHLID 155
           +STSN    + F + L +WI  VR TYNP   DI+ +EEIPEREG+LFKH NY VKHLI 
Sbjct: 119 ASTSNKSTDDVFDDVLATWIEAVRTTYNPLSTDIVIVEEIPEREGILFKHTNYLVKHLIV 178

Query: 156 LPNTEPPKNRTVVRRYSDFLWLQEVLLKRYPFRMIPDLPPKKIGSQNLDPVFLNKRRIGL 215
           LP+T+P  +R+V+RRYSDF+WLQEVLLK+YPFRMIP+LPPKKIGS + D  FL KRR GL
Sbjct: 179 LPDTDPSSDRSVIRRYSDFVWLQEVLLKKYPFRMIPELPPKKIGSHSADRAFLLKRRRGL 238

Query: 216 SKFINLVMKHPKLSKDDLVLTFLTVPTDLTSWRKQVSYDTADEFTDKRISKDFVKIWKKD 275
           S+FINLVMKHP L+ DDLVLTFLTVPTDL+ WRKQ SYDT +EFTDK+ISK F+K+W+K+
Sbjct: 239 SRFINLVMKHPVLNHDDLVLTFLTVPTDLSGWRKQASYDTTEEFTDKKISKSFMKMWRKE 298

Query: 276 LAEIWNNTANCIDELIDKWTKISILVDRHEKRLQIIANERKIMNDLIHDVGNLTKSVYPI 335
           LAE WN   + ID  ++ W KI++LV+R+ +RL+ I+ +R +   ++++      S+YPI
Sbjct: 299 LAEQWNEADSKIDLALETWAKITVLVERYSRRLKQISEDRTLFESIVNEFTQTAPSLYPI 358

Query: 336 DQNPTILDINSGMTVISKHIEKTNENYNQQALDTKQKVLPKFRMYTDILRALKNVFERYK 395
           +++ TI DIN+   +I+KH+   N+  +++  +T   +L KF+++ D++ +LK +FERYK
Sbjct: 359 NKD-TIEDINAHTGIITKHLSDCNQLTSKEIEETHLNLLVKFKIFIDMIFSLKGLFERYK 417

Query: 396 MLATNNVSMLQKHIDLNLQKLEDMKGKPDASGQEYDRIKTTIRKDRKIMYEQSNRAWLIR 455
           +LA NN++ LQ+ ++LN++ + +MKGKPD  G EYD++K  +++D++ + EQ NR+WLIR
Sbjct: 418 ILAGNNIAQLQRRVELNIETMNNMKGKPDVRGAEYDKVKQAVQRDKRTIAEQMNRSWLIR 477

Query: 456 ECILEEFTIFQETQFMITGCFQEWAKVQSTYSSLNLNEWENV 497
           ECILEEFTIFQETQF+IT  FQEWAK+   Y+ LN NEWE +
Sbjct: 478 ECILEEFTIFQETQFVITHSFQEWAKLNMKYADLNSNEWERL 519

>ACL014C [1035] [Homologous to ScYMR004W (MVP1) - SH]
           (333900..335474) [1575 bp, 524 aa]
          Length = 524

 Score =  465 bits (1197), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 216/446 (48%), Positives = 314/446 (70%), Gaps = 18/446 (4%)

Query: 52  LTESIWGTERTGAPNNVETGLEAKDSLNVSTNFNELNTAILSPTSSTSNIEEQNSFTESL 111
           L +++WG      P+ ++  +              L+T++    S +S  +E +S  E L
Sbjct: 85  LEQTVWG----APPSQLDASISG------------LDTSMAPVASQSSMCDELHS--EDL 126

Query: 112 ESWINEVRKTYNPQQLDIISIEEIPEREGLLFKHANYSVKHLIDLPNTEPPKNRTVVRRY 171
           E+W+N  RKTYNP   +I+ +EEIPEREG+LFKH NY VKHL+ LPNT P  N+TV+RRY
Sbjct: 127 ENWMNSRRKTYNPLAKNIVVVEEIPEREGILFKHTNYLVKHLVVLPNTNPSSNQTVIRRY 186

Query: 172 SDFLWLQEVLLKRYPFRMIPDLPPKKIGSQNLDPVFLNKRRIGLSKFINLVMKHPKLSKD 231
           SDF WLQEVLLK+YPFRMIP+LPPKKIG+QN DP+FL +RR GL +FINLV+ HP L +D
Sbjct: 187 SDFNWLQEVLLKKYPFRMIPELPPKKIGAQNADPIFLARRRKGLCRFINLVIMHPVLKQD 246

Query: 232 DLVLTFLTVPTDLTSWRKQVSYDTADEFTDKRISKDFVKIWKKDLAEIWNNTANCIDELI 291
           DLVLTFLTVPTDL SWRKQ +YDT +EFTD++I K F+ +W K+L+  WN     IDEL+
Sbjct: 247 DLVLTFLTVPTDLGSWRKQANYDTTEEFTDQKIDKAFISLWHKELSNQWNKADAKIDELL 306

Query: 292 DKWTKISILVDRHEKRLQIIANERKIMNDLIHDVGNLTKSVYPIDQNPTILDINSGMTVI 351
           + W K S+LV+R+E+R++ ++ ER+++  +I +  + + ++YP+++     DINS ++ I
Sbjct: 307 ESWIKTSVLVERYERRMRQVSEERRLLGRVIEEFADNSVTLYPLEEGHLFHDINSHISTI 366

Query: 352 SKHIEKTNENYNQQALDTKQKVLPKFRMYTDILRALKNVFERYKMLATNNVSMLQKHIDL 411
           SKH+    +   ++  + ++ +  KF+ + DI+ ALK VF+RYK++A NN++ LQ+ +++
Sbjct: 367 SKHLNSLADTSKKERQEVEEHLSVKFKTFIDIIIALKGVFDRYKIMAGNNIAHLQRRVEI 426

Query: 412 NLQKLEDMKGKPDASGQEYDRIKTTIRKDRKIMYEQSNRAWLIRECILEEFTIFQETQFM 471
           N+ KL+ M+  PD  G EYD+++ TI++D++ + EQ NR+WLIR+CILEEF IFQETQF 
Sbjct: 427 NMDKLQSMESNPDVKGAEYDKLRQTIQRDKRTIAEQLNRSWLIRKCILEEFVIFQETQFC 486

Query: 472 ITGCFQEWAKVQSTYSSLNLNEWENV 497
           IT  FQEWAK+   Y++     WE V
Sbjct: 487 ITHVFQEWAKMHVKYANETTESWEKV 512

>Kwal_56.22499
          Length = 527

 Score =  459 bits (1180), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 221/431 (51%), Positives = 293/431 (67%), Gaps = 3/431 (0%)

Query: 73  EAKDSLN--VSTNFNELNTAILSPTSSTSNIEEQNSFTESLESWINEVRKTYNPQQLDII 130
           E+ D+ N  VS+   + N A   P    +  +  +S  +  ESW   VRK+YNP   DII
Sbjct: 90  ESLDTTNHRVSSELVKGNMAAEEPFVGAAVADSASSGRQDFESWSEAVRKSYNPLVADII 149

Query: 131 SIEEIPEREGLLFKHANYSVKHLIDLPNTEPPKNRTVVRRYSDFLWLQEVLLKRYPFRMI 190
            +EE+PEREGLLFKH NY V+HLIDLP+T P  +R+V+RRYSDF+WLQEVLLK+YPFRMI
Sbjct: 150 VVEELPEREGLLFKHTNYLVRHLIDLPDTSPSSDRSVIRRYSDFVWLQEVLLKKYPFRMI 209

Query: 191 PDLPPKKIGSQNLDPVFLNKRRIGLSKFINLVMKHPKLSKDDLVLTFLTVPTDLTSWRKQ 250
           PDLPPK+IGS   DPVF  KRR GLS+FINLV+KHP   KDDLVLTFLTVPTDL  WRKQ
Sbjct: 210 PDLPPKRIGSHTTDPVFSIKRRNGLSRFINLVVKHPVFKKDDLVLTFLTVPTDLLGWRKQ 269

Query: 251 VSYDTADEFTDKRISKDFVKIWKKDLAEIWNNTANCIDELIDKWTKISILVDRHEKRLQI 310
            SYDT+DEFTD+++S  FVK+W K LAE WN     ID  ++ W KI++L+DR+E+R+  
Sbjct: 270 ASYDTSDEFTDRKVSVTFVKMWHKGLAERWNEADANIDTALELWAKITVLIDRYERRMAF 329

Query: 311 IANERKIMNDLIHDVGNLTKSVYPIDQNPTILDINSGMTVISKHIEKTNENYNQQALDTK 370
           IA +R I+  ++         ++  D   T + I   +  +SKH    NE  +Q+  +  
Sbjct: 330 IAQDRDILRSMLDQFTEGMPHLFNSDDGSTNV-IGDHLGRVSKHFGSCNELVSQENQEAC 388

Query: 371 QKVLPKFRMYTDILRALKNVFERYKMLATNNVSMLQKHIDLNLQKLEDMKGKPDASGQEY 430
           +++ P+FR +TD L ALK +FERYK +A NNV  LQ+ I++N  +LE MK KPD  G EY
Sbjct: 389 KELSPRFRTFTDTLLALKGLFERYKAMAGNNVPQLQRRIEVNSDRLEQMKDKPDLKGAEY 448

Query: 431 DRIKTTIRKDRKIMYEQSNRAWLIRECILEEFTIFQETQFMITGCFQEWAKVQSTYSSLN 490
           DR+K +I++DRK + EQ NR+WL+RECIL+E+  FQE QF+I+  FQ W  +   Y  LN
Sbjct: 449 DRVKQSIQRDRKAIAEQMNRSWLVRECILQEYVYFQEAQFLISDIFQRWVLLNMKYYELN 508

Query: 491 LNEWENVTNHI 501
            NEW+ +   +
Sbjct: 509 SNEWDKLLQDV 519

>KLLA0C06006g complement(530169..531707) similar to sp|P40959
           Saccharomyces cerevisiae YMR004w MVP1 required for
           vacuolar protein sorting singleton, start by similarity
          Length = 512

 Score =  453 bits (1165), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 203/398 (51%), Positives = 290/398 (72%), Gaps = 1/398 (0%)

Query: 104 QNSFTESLESWINEVRKTYNPQQLDIISIEEIPEREGLLFKHANYSVKHLIDLPNTEPPK 163
           Q +  +  ++W+  VRKTY P   DI+S+EEIPEREGL+FKH NY VKHL  LPNT+P  
Sbjct: 108 QYAANDEYKNWVESVRKTYFPLAEDIVSVEEIPEREGLVFKHTNYLVKHLTPLPNTDPSD 167

Query: 164 NRTVVRRYSDFLWLQEVLLKRYPFRMIPDLPPKKIGSQNLDPVFLNKRRIGLSKFINLVM 223
           +RTVVRRYSDF WLQ+VLL++YPFRM+P+LPPKKIGSQN DP+FL KRR GLS+FINLVM
Sbjct: 168 DRTVVRRYSDFDWLQDVLLRKYPFRMVPELPPKKIGSQNADPLFLAKRRKGLSRFINLVM 227

Query: 224 KHPKLSKDDLVLTFLTVPTDLTSWRKQVSYDTADEFTDKRISKDFVKIWKKDLAEIWNNT 283
           KHP L  DDLVLTFLTVPTDL+ WRKQ  YDT DEFTDK IS  F+ +W+K+ +E WN  
Sbjct: 228 KHPVLRSDDLVLTFLTVPTDLSGWRKQAHYDTTDEFTDKHISSSFMNLWRKEFSEQWNKA 287

Query: 284 ANCIDELIDKWTKISILVDRHEKRLQIIANERKIMNDLIHDVGNLTKSVYPIDQNPTILD 343
              ID  +D W K+++L++R+EKR++ +A+ERK++  +++ + + T+++YP     T+  
Sbjct: 288 DERIDIALDTWVKVTVLIERYEKRMKQVAHERKLLGQILNAIPDTTEALYP-QSTATVSQ 346

Query: 344 INSGMTVISKHIEKTNENYNQQALDTKQKVLPKFRMYTDILRALKNVFERYKMLATNNVS 403
           IN G+ +I +H+    +   ++  +    +  +F+ + D++ ALK +FERYKM+A NN+ 
Sbjct: 347 INEGVGLIVEHLNSCADVIERENEEVDSGLSVRFKAFIDVIIALKGLFERYKMMAGNNIP 406

Query: 404 MLQKHIDLNLQKLEDMKGKPDASGQEYDRIKTTIRKDRKIMYEQSNRAWLIRECILEEFT 463
            LQ+ +++N ++L  ++  PD  G EYDR+K +I +D++ + +Q NR+WLIRECILEEFT
Sbjct: 407 QLQRRVEINQERLNTLESNPDVKGAEYDRVKQSISRDKRSILDQMNRSWLIRECILEEFT 466

Query: 464 IFQETQFMITGCFQEWAKVQSTYSSLNLNEWENVTNHI 501
           IF ETQF+IT CFQ W ++   Y++ N++ WE +   +
Sbjct: 467 IFHETQFLITDCFQRWIEINLRYTNNNVDNWEKICKKL 504

>Kwal_23.2896
          Length = 421

 Score = 62.0 bits (149), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 50/90 (55%), Gaps = 5/90 (5%)

Query: 167 VVRRYSDFLWLQEVLLKRYPFRMIPDLPPKK----IGSQNLDPVFLNKRRIGLSKFINLV 222
           V RRYSDFL LQ +L + +P  +IP LP KK    I        F  KR   L  F+  +
Sbjct: 70  VHRRYSDFLLLQSILSQDHPTCVIPPLPDKKVFQYIAGDRFSQSFTQKRCHSLQNFLRRI 129

Query: 223 MKHPKLSKDDLVLTFLTVPTDLTSWRKQVS 252
            +HP LSK  +++TFL +  D  ++R+ +S
Sbjct: 130 SEHPILSKSQVLMTFL-MSNDWEAYRRSLS 158

>KLLA0C10967g 943312..944514 similar to sp|P47057 Saccharomyces
           cerevisiae YJL036w SNX4 singleton, hypothetical start
          Length = 400

 Score = 61.6 bits (148), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 47/158 (29%), Positives = 81/158 (51%), Gaps = 17/158 (10%)

Query: 166 TVVRRYSDFLWLQEVLLKRYPFRMIPDLPPKKI----GSQNLDPVFLNKRRIGLSKFINL 221
            VVRRY+DF+ L ++L+  +P  ++P LP KK+            F  KR   L  F+  
Sbjct: 51  CVVRRYNDFVLLHQILINDHPALLVPPLPDKKVLNYLSGDRFSHSFTQKRCRSLQTFMRR 110

Query: 222 VMKHPKLSKDDLVLTFLTVPTDLTSWRKQVSYD-TADEFTD---------KRISKDFVKI 271
           ++ H +LSK  ++ TFLT  TD   +R+ ++   +  E +D          R   +FV+I
Sbjct: 111 LLSHSELSKSRILETFLT-STDWDVYRRSLTGQISTSEVSDVLINAFKHVNRQRDEFVEI 169

Query: 272 WKKDLAEIWNNTANCIDELIDKWTKISILVDRHEKRLQ 309
            +K  +E  ++  + +D+L  K  K   L+ ++ K+LQ
Sbjct: 170 KEK--SEKLDHNLSHLDKLFHKSVKRVDLIGQNLKKLQ 205

>Scas_690.22
          Length = 428

 Score = 59.3 bits (142), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 74/146 (50%), Gaps = 19/146 (13%)

Query: 167 VVRRYSDFLWLQEVLLKRYPFRMIPDLPPKK----IGSQNLDPVFLNKRRIGLSKFINLV 222
           V RRYSD + L ++L+  +P  +IP LP KK    I        F  KR   L  F+  V
Sbjct: 77  VHRRYSDLVLLHDILMNDHPTCIIPPLPDKKVLQYIAGDRFSQRFTQKRCHSLQNFLRRV 136

Query: 223 MKHPKLSKDDLVLTFLTVPTDLTSWRKQVSYD---TADEFTD---------KRISKDFVK 270
             HP LSK  ++ TFL +  D  ++RK +S +     +E TD          + S++FV+
Sbjct: 137 SLHPILSKSKILETFL-IDADWDAYRKSLSGNIQTNKEEVTDAFMNAFKTVHKQSEEFVE 195

Query: 271 IWKKDLAEIWNNTANCIDELIDKWTK 296
           I  K+ ++  ++T + +D+   K TK
Sbjct: 196 I--KEKSDKLDHTLSKLDKNFHKMTK 219

>ACR074W [1121] [Homologous to ScYJL036W (SNX4) - SH]
           complement(496156..497388) [1233 bp, 410 aa]
          Length = 410

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 59/115 (51%), Gaps = 9/115 (7%)

Query: 146 ANYSVKHLIDLPNTEPPKNR-----TVV-RRYSDFLWLQEVLLKRYPFRMIPDLPPKKIG 199
            +Y    +   P TE  K       TVV RRYSDF+ L ++L   YP  ++P LP KK+ 
Sbjct: 28  GSYVTYQISSKPATEGDKRSGEDDITVVHRRYSDFVLLYQILANDYPACIVPPLPDKKVL 87

Query: 200 S--QNLDPVFLNKRRIGLSKFINLVMKHPKLSKDDLVLTFLTVPTDLTSWRKQVS 252
           +        F  KR   L  F+  + +HP LS+  ++ TFL V +D  +++K ++
Sbjct: 88  NYLDRFSQSFTQKRCHSLQNFLQRLAQHPVLSQSKILHTFL-VSSDWDAYQKSLA 141

>Scas_663.19
          Length = 169

 Score = 53.1 bits (126), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 70/150 (46%), Gaps = 12/150 (8%)

Query: 96  SSTSNIEEQNSFTESLESWINEVRKT-YNP--QQLDIISIEEIPEREGLLFKHANYSVKH 152
           S+ SN  +Q SF E      N +  T +NP     + +    IP  +  +F   +Y +  
Sbjct: 13  STLSNTHKQQSFAEIYAEPENFLEITVHNPITHNSNGLGDVRIPNGDQNMF--TDYEIVC 70

Query: 153 LIDLPNTEPPKNRTVVRRYSDFLWLQEVLLKR------YPFRMIPDLPPKKIGSQNLDPV 206
             +LPN +  +N  V RRYSDF + ++ LLK       +P  MIP LP K   +   +P 
Sbjct: 71  HTNLPNFKS-RNSKVRRRYSDFEFFKKCLLKEISMFTNHPRIMIPHLPGKIFLNNRFNPE 129

Query: 207 FLNKRRIGLSKFINLVMKHPKLSKDDLVLT 236
            + +R  GL K++  V  HP L     VL 
Sbjct: 130 VIEERMQGLDKWLKTVAGHPLLQSGSKVLV 159

>CAGL0L10472g 1117867..1119783 similar to sp|Q92331 Saccharomyces
           cerevisiae YOR069w, start by similarity
          Length = 638

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 64/292 (21%), Positives = 112/292 (38%), Gaps = 49/292 (16%)

Query: 141 LLFKHANYSVKHLIDLPNTEPPKNRTVVRRYSDFLWLQEVLLKRYPFRMIPDLPPKKIGS 200
           L   H  Y+V    +L +   P    V RRY DF WL   L   +  ++IP  PP+K   
Sbjct: 253 LTSSHIKYTVNAESELLS---PNQNQVSRRYRDFRWLYRQLQNNHWGKVIPP-PPEKQTV 308

Query: 201 QNLDPVFLNKRRIGLSKFINLVMKHPKLSKDDLVLTFLTVPTDLTSWRKQVSYDTADEFT 260
               P F+  RR+ L   +  +     L +D+    FLT   +     K+VSY+T     
Sbjct: 309 GTFQPEFVETRRLQLQTMLRRIANDSDLQRDEHFHMFLT-SDNFAEDSKRVSYETGSNAN 367

Query: 261 -------------------------------DKRISKDFVKIWKKDLAEIWNNTANCIDE 289
                                          D    K F+ I    + +        +DE
Sbjct: 368 NDNNDISEVHISEIQLLGPEEGAFVIKNGGLDSEYKKGFMNISFSSIPKYNEPDKFFVDE 427

Query: 290 LIDKWTKISILVDRHEKRLQIIANERKIMNDLIHDVGNLTKSVYPIDQNPTILDINSGMT 349
           L D+ T +   + +  K ++ I  +R+ ++   +D+ +L +S+         LD+  G T
Sbjct: 428 L-DRITDLENQLKKMLKAVESIEEQRRELSSYTYDLASLIESL-------GALDVTKGST 479

Query: 350 VISKHIEKTN----ENYNQQALDTKQKVLPKFRMYTDILRALKNVF-ERYKM 396
            +   + +T     E+  + AL     +      Y   L +L+++F +R K+
Sbjct: 480 KLCYELAETQKRVKESLERDALQEAITMGATLDEYVRSLASLRSIFYQRAKL 531

>ADR390C [2131] [Homologous to ScYOR357C (GRD19) - SH]
           (1410245..1410736) [492 bp, 163 aa]
          Length = 163

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 49/96 (51%), Gaps = 6/96 (6%)

Query: 145 HANYSVKHLIDLPNTEPPKNRTVVRRYSDFLWLQEVLLKR-----YPFRMIPDLPPKKIG 199
           + +Y V    +LP+  P +   V RRYSDF + +  L K      +P  +IP LP K + 
Sbjct: 58  YTDYLVVCRTNLPSF-PQRVSHVRRRYSDFEFFKRCLFKELSLSAHPRVVIPALPGKILW 116

Query: 200 SQNLDPVFLNKRRIGLSKFINLVMKHPKLSKDDLVL 235
           ++      + +RR GL+++++ V  HP L     VL
Sbjct: 117 ARRFHDEVIEERREGLAQWLSTVAGHPLLQSGSKVL 152

>CAGL0J01001g 98637..99929 similar to sp|P47057 Saccharomyces
           cerevisiae YJL036w SNX4, hypothetical start
          Length = 430

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 45/91 (49%), Gaps = 5/91 (5%)

Query: 166 TVVRRYSDFLWLQEVLLKRYPFRMIPDLPPKK----IGSQNLDPVFLNKRRIGLSKFINL 221
            V RRY+D + L ++L   +P  +IP LP KK    I        F  +R   L  F+  
Sbjct: 79  VVHRRYNDVVLLHDILQNDHPTCIIPPLPDKKVLQYIAGDRFGRRFTQRRCHSLQNFLRR 138

Query: 222 VMKHPKLSKDDLVLTFLTVPTDLTSWRKQVS 252
           V +HP LS   ++  FL V  +  ++RK ++
Sbjct: 139 VSQHPILSTSKVLEIFL-VGNEWDTYRKNIA 168

>YOR069W (VPS5) [4876] chr15 (453769..455796) Member of the sorting
           nexin family involved in Golgi retention and vacuolar
           sorting [2028 bp, 675 aa]
          Length = 675

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 68/150 (45%), Gaps = 19/150 (12%)

Query: 145 HANYSV---KHLIDLPNTEPPKNRTVVRRYSDFLWLQEVLLKRYPFRMIPDLPPKKIGSQ 201
           H  Y+V     L++L      K   V RRY DF WL   L   +  ++IP  PP+K    
Sbjct: 298 HVEYTVISESSLLEL------KYAQVSRRYRDFRWLYRQLQNNHWGKVIPP-PPEKQSVG 350

Query: 202 NLDPVFLNKRRIGLSKFINLVMKHPKLSKDDLVLTFLTVPTDLTSWRKQVSYDT------ 255
           +    F+  RR  +   +  + + P L KD   L FLT   D +S  K+ ++ T      
Sbjct: 351 SFKENFIENRRFQMESMLKKICQDPVLQKDKDFLLFLT-SDDFSSESKKRAFLTGSGAIN 409

Query: 256 -ADEFTDKRISKDFVKIWKKDLAEIWNNTA 284
            +++ ++ RIS +   +  +D AE+  N  
Sbjct: 410 DSNDLSEVRIS-EIQLLGAEDAAEVLKNGG 438

>CAGL0G06424g complement(621136..621630) highly similar to sp|Q08826
           Saccharomyces cerevisiae YOR357c GRD19, hypothetical
           start
          Length = 164

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 47/96 (48%), Gaps = 6/96 (6%)

Query: 145 HANYSVKHLIDLPNTEPPKNRTVVRRYSDFLWLQEVLLKRY-----PFRMIPDLPPKKIG 199
           + +Y +    +LPN     +R V RRYSDF + ++ LLK       P  ++P LP K   
Sbjct: 59  YTDYEIICRTNLPNFHKRASR-VRRRYSDFEFFRKCLLKEISMLNNPRVVVPHLPGKIYL 117

Query: 200 SQNLDPVFLNKRRIGLSKFINLVMKHPKLSKDDLVL 235
           S       + +RR GL++++ +V  HP L      L
Sbjct: 118 SNRFSDEVIEERRQGLNRWMQIVAGHPLLQSGSKTL 153

>YOR357C (GRD19) [5134] chr15 complement(1009220..1009708) Protein
           involved in retrieval of late Golgi membrane proteins
           from the prevacuolar compartment [489 bp, 162 aa]
          Length = 162

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 38/74 (51%), Gaps = 5/74 (6%)

Query: 167 VVRRYSDFLWLQEVLLKR-----YPFRMIPDLPPKKIGSQNLDPVFLNKRRIGLSKFINL 221
           V RRYSDF + ++ L+K      +P  M+P LP K + S       + +RR GL+ ++  
Sbjct: 78  VRRRYSDFEFFRKCLIKEISMLNHPKVMVPHLPGKILLSNRFSNEVIEERRQGLNTWMQS 137

Query: 222 VMKHPKLSKDDLVL 235
           V  HP L     VL
Sbjct: 138 VAGHPLLQSGSKVL 151

>Scas_712.33
          Length = 357

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 63/125 (50%), Gaps = 21/125 (16%)

Query: 145 HANYSV--KHLIDLPNTEPP-------KNRTVVRRYSDFLWLQEVLLKRYPFRMIPDLPP 195
           +ANY +  K ++D  + +P        ++R + +R+S+FL L+  L K +   +  +LP 
Sbjct: 21  YANYGIHLKVVVDDRDQDPMNDDNQVLEDRHIYKRFSEFLELKRRLEKEFNSELPYELPS 80

Query: 196 KKIG---------SQNLDPVFLNKRRIGLSKFINLVMKHP---KLSKDDLVLTFLTVPTD 243
           +  G         + ++DPV   +RRI L+KF++ ++      K    +LV  FL +P +
Sbjct: 81  RHHGPIFNVWTRSTTSIDPVITEERRIQLAKFVSDMLNDSFDTKWKNSELVRVFLQLPLN 140

Query: 244 LTSWR 248
              +R
Sbjct: 141 WNDYR 145

>YJL036W (SNX4) [2875] chr10 (378741..380012) Putative nexin sorting
           protein, possibly involved in proteasome function [1272
           bp, 423 aa]
          Length = 423

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 70/147 (47%), Gaps = 21/147 (14%)

Query: 167 VVRRYSDFLWLQEVLLKRYPFRMIPDLPPKK----IGSQNLDPVFLNKRRIGLSKFINLV 222
           V RRYSD L L ++LL R+P  +IP LP KK    I        F  KR   L  F+  V
Sbjct: 75  VHRRYSDLLLLHDILLNRFPTCIIPPLPDKKVFQYIAGDRFSQRFTQKRCHSLQNFLRRV 134

Query: 223 MKHPKLSKDDLVLTFLTVPTDLTSWRKQVSYDT----ADEFTD---------KRISKDFV 269
             HP LS+  +  TFL V  D  S RK V  D+     DE TD          + +++F 
Sbjct: 135 SLHPDLSQSKVFKTFL-VSKDWESHRK-VLQDSLQPNKDEVTDAFMNAFKTVHKQNEEFT 192

Query: 270 KIWKKDLAEIWNNTANCIDELIDKWTK 296
           +I +K  ++  + T   ID+L  K  K
Sbjct: 193 EIREK--SDKLDRTVTKIDKLFHKVVK 217

>ADR211W [1952] [Homologous to ScYOR069W (VPS5) - SH; ScYKR078W -
           SH] complement(1072310..1074112) [1803 bp, 600 aa]
          Length = 600

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 44/98 (44%), Gaps = 6/98 (6%)

Query: 143 FKHANYSVKHLIDLPNTEPPKNRTVVRRYSDFLWLQEVLLKRYPFRMIPDLPPK-KIGSQ 201
           F H  YSV+    L         +V RRY DF WL   L   +  ++IP  P K K+G  
Sbjct: 219 FSHVEYSVRTRSPLVGD---AEVSVQRRYRDFRWLYRQLQSNHWGKVIPPPPDKQKVGRF 275

Query: 202 NLDPVFLNKRRIGLSKFINLVMKHPKLSKDDLVLTFLT 239
             D  F+  RR  + + +  + ++  L  D   L FLT
Sbjct: 276 KQD--FIENRRFQMERMLQRIAQNAALQNDQDFLLFLT 311

>YDL113C (ATG20) [756] chr4 complement(256633..258555) Protein that
           may play a role in vesicular transport, has similarity
           to human SNX1 [1923 bp, 640 aa]
          Length = 640

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 25/35 (71%)

Query: 163 KNRTVVRRYSDFLWLQEVLLKRYPFRMIPDLPPKK 197
           +N TV RRYSDF  L+ +L++ +P  +IP +P K+
Sbjct: 185 ENSTVQRRYSDFESLRSILIRLFPMTLIPPIPEKQ 219

>Sklu_2428.6 YOR069W, Contig c2428 9095-11038 reverse complement
          Length = 647

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 40/95 (42%), Gaps = 4/95 (4%)

Query: 145 HANYSVKHLIDLPNTEPPKNRTVVRRYSDFLWLQEVLLKRYPFRMIPDLPPKKIGSQNLD 204
           H  Y+VK      N   P    V RRY DF WL   L      R+IP  PP+K       
Sbjct: 268 HVEYTVKTK---SNAIQPSECQVKRRYRDFRWLYRQLQNNNWGRIIPP-PPEKQTVGRFK 323

Query: 205 PVFLNKRRIGLSKFINLVMKHPKLSKDDLVLTFLT 239
             F+  RR  + + +  +     L KD+  + FLT
Sbjct: 324 EDFIESRRFQMERMLKKISSDSILQKDEDFIMFLT 358

>KLLA0F16643g 1533628..1535625 similar to sp|Q92331 Saccharomyces
           cerevisiae YOR069w VPS5 involved in Golgi retention and
           vacuolar sorting, start by similarity
          Length = 665

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 43/92 (46%), Gaps = 3/92 (3%)

Query: 167 VVRRYSDFLWLQEVLLKRYPFRMIPDLPPKKIGSQNLDPVFLNKRRIGLSKFINLVMKHP 226
           V RRY DF WL   L   +  ++IP  PP+K         F+  RR  + + +  +  + 
Sbjct: 306 VKRRYRDFRWLYRQLQHNHWGKIIPP-PPEKQAVGRFKQDFIENRRAQMERMLQHIASNH 364

Query: 227 KLSKDDLVLTFLTVP--TDLTSWRKQVSYDTA 256
            L KD+  + FLT    +  +  R+Q+S   A
Sbjct: 365 VLQKDEDFILFLTSEKWSQESKVREQISGSKA 396

>Kwal_23.3438
          Length = 614

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 25/34 (73%)

Query: 164 NRTVVRRYSDFLWLQEVLLKRYPFRMIPDLPPKK 197
           ++ V RRYSDF  L+++L+K +P  +IP +P K+
Sbjct: 166 DKVVKRRYSDFESLRKILIKLFPMSLIPPIPEKQ 199

>Sklu_1971.4 YHR105W, Contig c1971 6476-6973
          Length = 165

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 35/67 (52%), Gaps = 10/67 (14%)

Query: 167 VVRRYSDFLWLQEVLLKRYPFRM---IPDLPPK-------KIGSQNLDPVFLNKRRIGLS 216
           + +RYSDF  L+  L++  P  +   IP LPPK       +    N D  +L KRR GL 
Sbjct: 80  LYKRYSDFENLRNRLIQALPSELHQSIPSLPPKVRWYESWRYQDVNFDKKWLAKRRAGLE 139

Query: 217 KFINLVM 223
            F+N V+
Sbjct: 140 YFLNQVL 146

>Scas_322.2
          Length = 176

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 35/67 (52%), Gaps = 10/67 (14%)

Query: 167 VVRRYSDFLWLQEVLLKRYPFRM---IPDLPPK-------KIGSQNLDPVFLNKRRIGLS 216
           + +RYSDF  L+  L++  P  +   IP LPPK       +    N D  +L KRR GL 
Sbjct: 91  LYKRYSDFENLRNRLIQALPSELHQSIPSLPPKVRWYESWRYQDVNFDKKWLAKRRAGLE 150

Query: 217 KFINLVM 223
            F+N V+
Sbjct: 151 YFLNQVL 157

>Kwal_26.6858
          Length = 160

 Score = 37.4 bits (85), Expect = 0.008,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 57/121 (47%), Gaps = 19/121 (15%)

Query: 120 KTYNPQQLDIISIEEIPEREGLLFKHANYSVKHLIDLPNTEPPKNRTVVRRYSDFLWLQE 179
           KT+ PQ          P++ G+   + +Y V    ++P      ++ V RRYS+F   ++
Sbjct: 43  KTHFPQ----------PDQHGM---YTDYEVICRTNVPAFSKRMSK-VRRRYSEFELFRK 88

Query: 180 VLLKR-----YPFRMIPDLPPKKIGSQNLDPVFLNKRRIGLSKFINLVMKHPKLSKDDLV 234
            L+K      +P  ++P LP K +     +   + +R+ GL+K++  V  HP L     V
Sbjct: 89  CLIKELSLSSHPKVVVPHLPGKILLGNRFNDEVIEERKQGLNKWLVAVAGHPLLQSGSKV 148

Query: 235 L 235
           L
Sbjct: 149 L 149

>KLLA0E09141g complement(817829..819739) similar to sgd|S0002271
           Saccharomyces cerevisiae YDL113c, start by similarity
          Length = 636

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 23/31 (74%)

Query: 167 VVRRYSDFLWLQEVLLKRYPFRMIPDLPPKK 197
           V RRYSDF  L++VL+K +P  +IP +P K+
Sbjct: 193 VKRRYSDFESLRKVLVKLFPISLIPPIPEKQ 223

>Sklu_2167.4 YGL212W, Contig c2167 6607-7656 reverse complement
          Length = 349

 Score = 37.7 bits (86), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 52/107 (48%), Gaps = 14/107 (13%)

Query: 166 TVVRRYSDFLWLQEVLLKRYPFRMIPDLPPKKIG-----SQNLDPVFLNKRRIGLSKFIN 220
           TV RR+S+F+ L++ L + +   +  +LPP+  G     S + DP  + +R+  LS F+ 
Sbjct: 42  TVSRRFSEFVSLKKQLEQEFNAELPYELPPRHYGFWNKSSHSCDPQVIQERKSKLSTFLL 101

Query: 221 LVMKHP---KLSKDDLVLTFLTVPTD------LTSWRKQVSYDTADE 258
            ++      +  K   +  FL +P +      L S  +Q    T+DE
Sbjct: 102 DLLNDSFDTRWKKSPFLCHFLQLPGNWDTQDVLPSHTRQSFTHTSDE 148

>Sklu_2219.2 YDL113C, Contig c2219 4054-5958
          Length = 634

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 49/107 (45%), Gaps = 34/107 (31%)

Query: 166 TVVRRYSDFLWLQEVLLKRYPFRMIPDLPPKKI--------------------------- 198
           TV RRYS+F  L+++L+K +P  +IP +P K+                            
Sbjct: 188 TVRRRYSEFESLRKILVKLFPMTLIPPIPEKQSITSYGKSITGSKSNYLLPSEGAGSVDL 247

Query: 199 ------GSQNLDPVFLNKRRIG-LSKFINLVMKHPKLSKDDLVLTFL 238
                 GS N +   L + RI  L+ F+N ++K+ +++K  ++  FL
Sbjct: 248 SLSVINGSVNTNDEKLIRHRIRMLTSFLNRLLKNEEITKTSIITDFL 294

>Kwal_55.21533
          Length = 159

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 34/67 (50%), Gaps = 10/67 (14%)

Query: 167 VVRRYSDFLWLQEVLLKRYPFRM---IPDLPPK-------KIGSQNLDPVFLNKRRIGLS 216
           + +RYSDF+  +E L+     ++   IP LPPK       +    N    +L +RR GL 
Sbjct: 74  IYKRYSDFVRFREELMATLSPKLRTGIPALPPKLSWFDSWRYDDANFKSAWLARRRAGLE 133

Query: 217 KFINLVM 223
            F+N V+
Sbjct: 134 FFLNQVL 140

>Scas_698.32
          Length = 699

 Score = 38.1 bits (87), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 32/73 (43%), Gaps = 1/73 (1%)

Query: 167 VVRRYSDFLWLQEVLLKRYPFRMIPDLPPKKIGSQNLDPVFLNKRRIGLSKFINLVMKHP 226
           V RRY DF WL   L   +  ++IP  PP+K         F+  RR+ +   +  +    
Sbjct: 337 VYRRYRDFRWLYRQLQNNHWGKIIPP-PPEKQAVGRFKQDFIENRRLQMENMLQTIASSD 395

Query: 227 KLSKDDLVLTFLT 239
            L  D   + FLT
Sbjct: 396 SLQNDSDFILFLT 408

>CAGL0H10428g 1016374..1018635 similar to tr|Q07528 Saccharomyces
           cerevisiae YDL113c, hypothetical start
          Length = 753

 Score = 37.7 bits (86), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 22/31 (70%)

Query: 167 VVRRYSDFLWLQEVLLKRYPFRMIPDLPPKK 197
           V RRYSDF  L+ +L+K +P  +IP +P K+
Sbjct: 316 VRRRYSDFESLRSILVKLFPLMVIPPIPEKE 346

>Scas_580.3
          Length = 183

 Score = 36.6 bits (83), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 33/63 (52%), Gaps = 8/63 (12%)

Query: 169 RRYSDFLWLQEVLLKRYPFRM-IPDLPPK-------KIGSQNLDPVFLNKRRIGLSKFIN 220
           +RYSDF+  +  ++ +   RM IP LPP        K    N D  +L KRR GL +F+ 
Sbjct: 102 KRYSDFVAFRNSIMNKLGDRMEIPSLPPGVPWYDSWKYQDVNFDKKWLAKRRRGLERFLE 161

Query: 221 LVM 223
            V+
Sbjct: 162 QVL 164

>YHR105W (YPT35) [2393] chr8 (324768..325412) Protein that may play
           a role in vesicular transport, has similarity to Grd19p,
           bacterial helix-turn-helix regulator protein of the argR
           group, and human SNX1 [645 bp, 214 aa]
          Length = 214

 Score = 36.6 bits (83), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 46/87 (52%), Gaps = 17/87 (19%)

Query: 169 RRYSDFLWLQEVLLKRY----PFRM----IPDLPPK-------KIGSQNLDPVFLNKRRI 213
           +RYSDF+ L+E LL R     P ++    IP LPP        K    NL+  +L KR+ 
Sbjct: 121 KRYSDFVRLRENLLTRIKTAKPEKLNCLQIPHLPPSVQWYSSWKYQEVNLNKDWLAKRQR 180

Query: 214 GLSKFINLVMKHPKLSK--DDLVLTFL 238
           GL  F+N ++ +  L +   D+++ FL
Sbjct: 181 GLEYFLNHIILNSSLVEMTKDILIQFL 207

>CAGL0I01144g 95410..95931 similar to sp|P38815 Saccharomyces
           cerevisiae YHR105w, start by similarity
          Length = 173

 Score = 36.2 bits (82), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 44/97 (45%), Gaps = 15/97 (15%)

Query: 157 PNTEPPKNRTVVRRYSDFLWLQEVLLKRYPFRM------IPDLPPK-------KIGSQNL 203
           PN+         +RYSDF+  +  LL R   +       IP+LPP        K    NL
Sbjct: 73  PNSSGSYRIHTYKRYSDFVEFRNALLDRVRTKRPASVSEIPELPPPVKWYYSWKYNEINL 132

Query: 204 DPVFLNKRRIGLSKFINLVMKHPKLS--KDDLVLTFL 238
           +  +L  RR GL  FIN V+ +  +     DLV+ FL
Sbjct: 133 NKEWLANRRKGLELFINQVLLNGNIVDIAKDLVIQFL 169

>ADR192C [1933] [Homologous to ScYDR425W - SH] (1037233..1039044)
           [1812 bp, 603 aa]
          Length = 603

 Score = 37.0 bits (84), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 42/84 (50%), Gaps = 16/84 (19%)

Query: 146 ANYSVKHLIDLPNTEPPKNRTVVRRYSDFLWLQEVLLKRYPFRMIPDLPPKK-------- 197
            NY++ + I        + R V RRYS+F  L++ L +  P  +IP +P K         
Sbjct: 141 GNYAIGYTIAY------EGRQVTRRYSEFDSLRQALARLLPTVIIPPIPSKHPLIRYFLN 194

Query: 198 -IGSQNLDPVFLNKRRIGLSKFIN 220
            + ++N D   + KRR  LS+F+N
Sbjct: 195 PLNAEN-DIRIIEKRRRLLSRFLN 217

>Scas_613.21
          Length = 649

 Score = 36.6 bits (83), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 46/106 (43%), Gaps = 34/106 (32%)

Query: 167 VVRRYSDFLWLQEVLLKRYPFRMIPDLPPKK---------IGSQ---------------- 201
           V RRYSDF  L+ VL++ +P  +IP +P K+          GS                 
Sbjct: 204 VRRRYSDFESLRNVLVRLFPITLIPPIPEKESIKTYGKAIAGSSSKYQLPSDPAGSVDLT 263

Query: 202 ---------NLDPVFLNKRRIGLSKFINLVMKHPKLSKDDLVLTFL 238
                    N D   +  R   L++F+N ++++P++ K  ++  FL
Sbjct: 264 LSVINGSVNNRDEKLIRHRIRMLTQFLNKLLQNPEIMKTTIISDFL 309

>Kwal_55.21745
          Length = 629

 Score = 35.8 bits (81), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 47/104 (45%), Gaps = 5/104 (4%)

Query: 136 PEREG-LLFKHANYSVKHLIDLPNTEPPKNRTVVRRYSDFLWLQEVLLKRYPFRMIPDLP 194
           P++ G L   H  Y++    D  N   P+ R V RRY DF WL   L   +  ++IP  P
Sbjct: 243 PQKVGDLTSAHVEYTILSKSD--NLNNPEVR-VQRRYRDFRWLYRQLQNNHWGKIIPP-P 298

Query: 195 PKKIGSQNLDPVFLNKRRIGLSKFINLVMKHPKLSKDDLVLTFL 238
           P+K         F+  RR  + + +  + +   L +D   + FL
Sbjct: 299 PEKQTVGRFKDDFIENRRFQMERMLTKISQDKDLQEDVDFVMFL 342

>YGL212W (VAM7) [1784] chr7 (91435..92385) Subunit of the vacuolar
           SNARE complex involved in morphogenesis of the vacuole;
           homologous to SNAP-25 [951 bp, 316 aa]
          Length = 316

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 55/111 (49%), Gaps = 20/111 (18%)

Query: 164 NRTVVRRYSDFLWLQEVLLKRYPFRMIPDLPPKKIGSQNL-------DPVFLNKRRIGLS 216
           N+ + +RYS+F W  +  L+R     IP   P+K G  +        DP  +++RRIGL 
Sbjct: 35  NKRLYKRYSEF-WKLKTRLERDVGSTIPYDFPEKPGVLDRRWQRRYDDPEMIDERRIGLE 93

Query: 217 KFINLVM--------KHPKLSKDDLVLTFLTVPTDLTSWRKQVSYDTADEF 259
           +F+N +         +  K+++D L L+      +++  + Q   +TADE 
Sbjct: 94  RFLNELYNDRFDSRWRDTKIAQDFLQLS----KPNVSQEKSQQHLETADEV 140

>CAGL0J06556g 628854..632090 weakly similar to sp|Q01846
           Saccharomyces cerevisiae YML104c MDM1 intermediate
           filament protein, hypothetical start
          Length = 1078

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 45/85 (52%), Gaps = 6/85 (7%)

Query: 167 VVRRYSDFLWLQEVLLKRYPFRMIP-DLP-PKKI---GSQNLDPV-FLNKRRIGLSKFIN 220
           V RR+++F  L + L   Y  ++   DL  P KI    + N+  V   N+RRI    F+N
Sbjct: 773 VSRRFNEFAVLYKYLHANYSKKLKKLDLSFPSKIPITENYNIAKVDICNERRIKFELFLN 832

Query: 221 LVMKHPKLSKDDLVLTFLTVPTDLT 245
            +++  ++ +DDL  TFLT P   +
Sbjct: 833 QLLQIQEICEDDLFRTFLTNPLSFS 857

>Sklu_2404.3 YOR357C, Contig c2404 1457-1948
          Length = 163

 Score = 32.7 bits (73), Expect = 0.29,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 31/59 (52%)

Query: 177 LQEVLLKRYPFRMIPDLPPKKIGSQNLDPVFLNKRRIGLSKFINLVMKHPKLSKDDLVL 235
           ++E+ L  +P  ++P LP K + S   +   + +RR GL +++  V  HP L     VL
Sbjct: 94  VKELALSSHPRVVVPHLPGKILLSNRFNDEIIEERRQGLQQWLLNVAGHPLLQSGSKVL 152

>Sklu_2221.5 YDR425W, Contig c2221 7089-9104
          Length = 671

 Score = 33.5 bits (75), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 10/66 (15%)

Query: 164 NRTVVRRYSDFLWLQEVLLKRYPFRMIPDLPPKK---------IGSQNLDPVFLNKRRIG 214
           N+ V RRYS+F  L++ L +  P  +IP +P K          + ++N D   ++KR+  
Sbjct: 206 NKQVTRRYSEFDTLRQALCRLLPSVIIPPIPSKHPLIKYFLNPLNAEN-DVKIIDKRKRL 264

Query: 215 LSKFIN 220
           L+ F+N
Sbjct: 265 LTSFLN 270

>KLLA0A03718g 334828..335322 similar to sp|Q08826 Saccharomyces
           cerevisiae YOR357c GRD19 singleton, start by similarity
          Length = 164

 Score = 32.3 bits (72), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 1/69 (1%)

Query: 175 LWLQEVLLKRYPFRMIPDLPPKKIGSQNLDPVFLNKRRIGLSKFINLVMKHPKLSKDDLV 234
           L ++E+ L  +P   +  LP K + S       + +RR GL+K++  V  HP L     V
Sbjct: 93  LLIKELQLSNHPKVSVQHLPGKILLSNRFSDAVIEERRQGLNKWLASVAGHPLLQTGSKV 152

Query: 235 LT-FLTVPT 242
           L  F+  PT
Sbjct: 153 LVRFIQDPT 161

>Kwal_47.19079
          Length = 345

 Score = 32.7 bits (73), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 42/83 (50%), Gaps = 8/83 (9%)

Query: 169 RRYSDFLWLQEVLLKRYPFRMIPDLPPKKIG-----SQNLDPVFLNKRRIGLSKFINLVM 223
           RR+SDF+ L++ L +     +  +LPP++       S + DP  + +R   LS F++ ++
Sbjct: 46  RRFSDFVKLKKDLEQEVGSELPYELPPRRFNKWMRPSGSCDPDVIEERVKELSTFLHDLL 105

Query: 224 KHP---KLSKDDLVLTFLTVPTD 243
                 +  K   V  FL +P+D
Sbjct: 106 NDSFDTRWKKSPYVCHFLQIPSD 128

>AER438C [2938] [Homologous to ScYGL212W (VAM7) - SH]
           (1474934..1475980) [1047 bp, 348 aa]
          Length = 348

 Score = 32.3 bits (72), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 41/83 (49%), Gaps = 8/83 (9%)

Query: 169 RRYSDFLWLQEVLLKRYPFRMIPDLPPKK-----IGSQNLDPVFLNKRRIGLSKFINLVM 223
           RR+S+FL L+  L + +   +  D P +K     + S++ DP  +++RR  L+ F+  ++
Sbjct: 44  RRFSEFLQLKLDLEREFDAEIPYDFPARKFNLWNMKSRSCDPAVVDERRERLTSFLTDLL 103

Query: 224 KHP---KLSKDDLVLTFLTVPTD 243
                 +      +  FL +P D
Sbjct: 104 NDSFDVRWKTSPTLCAFLNMPDD 126

>Scas_714.58
          Length = 636

 Score = 30.0 bits (66), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 39/82 (47%), Gaps = 8/82 (9%)

Query: 165 RTVVRRYSDFLWLQEVLLKRYPFRMIPDLPPKK------IGSQNL--DPVFLNKRRIGLS 216
           + V RRYS+F  L +VL +  P  +IP +P K       I   N+  D   ++KR+   +
Sbjct: 195 KRVTRRYSEFDSLYQVLKRLLPTIVIPPIPTKHPLINYLINPINVNNDTKIIDKRKRKFN 254

Query: 217 KFINLVMKHPKLSKDDLVLTFL 238
            F+N     P++    +   FL
Sbjct: 255 SFLNNCNDIPEIRNHVVFQKFL 276

>Scas_564.5
          Length = 509

 Score = 30.0 bits (66), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 45/97 (46%), Gaps = 6/97 (6%)

Query: 190 IPDLPPKKIGSQNLDPVFLNKRRIGLSKFINLVMKHPKLSKDDLVLTFLTVPTDLTSWRK 249
            P +P ++   QNL+P FL  R   + K   L    P+++ D+  L  L+   D+ S   
Sbjct: 294 CPSVPLRRTRQQNLNPNFL--RLYSIEKSCRLKKILPEINIDERALGQLSY-DDIRSLDI 350

Query: 250 QVSYDTADEFTDKRISKDFV---KIWKKDLAEIWNNT 283
             + + ADE +   +    +   K+W + L E+  +T
Sbjct: 351 SANNEGADEISSHDVKLALITKKKLWSEMLCEVRQDT 387

>YKR078W (YKR078W) [3328] chr11 (584594..586351) Protein with
           similarity to Uso1p [1758 bp, 585 aa]
          Length = 585

 Score = 29.6 bits (65), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 2/40 (5%)

Query: 158 NTEPPKNRTVVRRYSDFLWLQEVLLKRYPFRMIPDLPPKK 197
           +T+P   +T+ R +SDF WL   L   +  + IP  PP +
Sbjct: 140 STQPDVEKTIARAFSDFYWLYHQLQNNHWGKTIP--PPTR 177

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.132    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,072,549
Number of extensions: 755220
Number of successful extensions: 3118
Number of sequences better than 10.0: 109
Number of HSP's gapped: 3184
Number of HSP's successfully gapped: 112
Length of query: 501
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 395
Effective length of database: 12,926,601
Effective search space: 5106007395
Effective search space used: 5106007395
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)