Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0J11682g1591004793e-62
YMR002W1561013872e-48
Sklu_2419.61581023203e-38
Kwal_56.224921521003161e-37
KLLA0C06094g1491003142e-37
ACL010C153963073e-36
Scas_686.141521012978e-35
KLLA0E06875g41825613.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J11682g
         (157 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J11682g 1136601..1137080 similar to sp|Q03667 Saccharomyces...   189   3e-62
YMR002W (YMR002W) [3967] chr13 (272193..272663) Member of the DU...   153   2e-48
Sklu_2419.6 YMR002W, Contig c2419 8567-9043 reverse complement        127   3e-38
Kwal_56.22492                                                         126   1e-37
KLLA0C06094g complement(535470..535919) similar to sp|Q03667 Sac...   125   2e-37
ACL010C [1039] [Homologous to ScYMR002W - SH] (338678..339139) [...   122   3e-36
Scas_686.14                                                           119   8e-35
KLLA0E06875g complement(625608..626864) similar to sp|P38174 Sac...    28   3.1  

>CAGL0J11682g 1136601..1137080 similar to sp|Q03667 Saccharomyces
           cerevisiae YMR002w, start by similarity
          Length = 159

 Score =  189 bits (479), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 91/100 (91%), Positives = 91/100 (91%)

Query: 58  GLFAQMASTAAGVAVGSTIGHTLGAGITGMFSGSGSSEVSDQQQQPMQNFDXXXXXXXXX 117
           GLFAQMASTAAGVAVGSTIGHTLGAGITGMFSGSGSSEVSDQQQQPMQNFD         
Sbjct: 58  GLFAQMASTAAGVAVGSTIGHTLGAGITGMFSGSGSSEVSDQQQQPMQNFDAAAQQQQQQ 117

Query: 118 FRTCDADAKNFTRCLDENNGNFQICDYYLQQLKACQEAAR 157
           FRTCDADAKNFTRCLDENNGNFQICDYYLQQLKACQEAAR
Sbjct: 118 FRTCDADAKNFTRCLDENNGNFQICDYYLQQLKACQEAAR 157

>YMR002W (YMR002W) [3967] chr13 (272193..272663) Member of the
           DUF657 protein of unknown function family, which may
           bind metal, has high similarity to uncharacterized C.
           albicans Orf6.159p [471 bp, 156 aa]
          Length = 156

 Score =  153 bits (387), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 82/101 (81%), Gaps = 1/101 (0%)

Query: 58  GLFAQMASTAAGVAVGSTIGHTLGAGITGMFSGSGS-SEVSDQQQQPMQNFDXXXXXXXX 116
           G+FAQMASTAAGVAVGSTIGHTLGAGITGMFSGSGS S   +QQQQ M N          
Sbjct: 54  GMFAQMASTAAGVAVGSTIGHTLGAGITGMFSGSGSDSAPVEQQQQNMANTSGQTQTDQQ 113

Query: 117 XFRTCDADAKNFTRCLDENNGNFQICDYYLQQLKACQEAAR 157
             RTC+ DA+NFTRCLDENNGNFQICDYYLQQLKACQEAAR
Sbjct: 114 LGRTCEIDARNFTRCLDENNGNFQICDYYLQQLKACQEAAR 154

>Sklu_2419.6 YMR002W, Contig c2419 8567-9043 reverse complement
          Length = 158

 Score =  127 bits (320), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 68/102 (66%), Positives = 78/102 (76%), Gaps = 2/102 (1%)

Query: 58  GLFAQMASTAAGVAVGSTIGHTLGAGITGMFSGSGSSEVSDQQQQPMQNFDXXXXXXXXX 117
           GLFAQMASTAAGVAVGS +GHT+GAG+TG+FSGSGSS    +QQQ  Q            
Sbjct: 55  GLFAQMASTAAGVAVGSAVGHTVGAGLTGLFSGSGSSAAPAEQQQQQQLAAAPAQQSLAQ 114

Query: 118 FRT--CDADAKNFTRCLDENNGNFQICDYYLQQLKACQEAAR 157
            +   CD DA+NFTRCL+EN+GNFQICD+YLQQLKACQEAAR
Sbjct: 115 NQATHCDVDARNFTRCLEENDGNFQICDFYLQQLKACQEAAR 156

>Kwal_56.22492
          Length = 152

 Score =  126 bits (316), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 78/100 (78%), Gaps = 1/100 (1%)

Query: 58  GLFAQMASTAAGVAVGSTIGHTLGAGITGMFSGSGSSEVSDQQQQPMQNFDXXXXXXXXX 117
           GLFAQMASTAAGVAVGS +GHT+GAG+TGMFSGS SS  ++QQQQ +             
Sbjct: 52  GLFAQMASTAAGVAVGSAVGHTVGAGLTGMFSGS-SSAPAEQQQQQLAAAPAQQGFAQEQ 110

Query: 118 FRTCDADAKNFTRCLDENNGNFQICDYYLQQLKACQEAAR 157
            R CD DA++FTRCL+ENNGN QICD+YLQQLKACQEAAR
Sbjct: 111 GRACDVDARSFTRCLEENNGNMQICDFYLQQLKACQEAAR 150

>KLLA0C06094g complement(535470..535919) similar to sp|Q03667
           Saccharomyces cerevisiae YMR002w singleton, start by
           similarity
          Length = 149

 Score =  125 bits (314), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 77/100 (77%), Gaps = 1/100 (1%)

Query: 58  GLFAQMASTAAGVAVGSTIGHTLGAGITGMFSGSGSSEVSDQQQQPMQNFDXXXXXXXXX 117
           G+FAQMASTAAGVAVGSTIGHTLGAGITGMFSGS SS  ++QQQQ +             
Sbjct: 49  GMFAQMASTAAGVAVGSTIGHTLGAGITGMFSGS-SSAPAEQQQQQVAAPVQADTFQNQQ 107

Query: 118 FRTCDADAKNFTRCLDENNGNFQICDYYLQQLKACQEAAR 157
              CD DA+NFTRCL++N GN QICDYYLQQLKACQEAAR
Sbjct: 108 ATHCDVDARNFTRCLEDNGGNMQICDYYLQQLKACQEAAR 147

>ACL010C [1039] [Homologous to ScYMR002W - SH] (338678..339139) [462
           bp, 153 aa]
          Length = 153

 Score =  122 bits (307), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 60/96 (62%), Positives = 70/96 (72%), Gaps = 1/96 (1%)

Query: 58  GLFAQMASTAAGVAVGSTIGHTLGAGITGMFSGSGSSEVSDQQQQPMQNFDXXXXXXXXX 117
           GLFAQMASTAAGVAVGS +GHT+GAG+TG+FSGSGS+    Q QQ +             
Sbjct: 49  GLFAQMASTAAGVAVGSAVGHTIGAGLTGLFSGSGSAPAEAQPQQ-LAAAPVQQDTFQTQ 107

Query: 118 FRTCDADAKNFTRCLDENNGNFQICDYYLQQLKACQ 153
            R CD DA+NFTRCL++NNGNFQICDYYLQQ +  Q
Sbjct: 108 ARHCDTDARNFTRCLEDNNGNFQICDYYLQQFEGLQ 143

>Scas_686.14
          Length = 152

 Score =  119 bits (297), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 71/101 (70%), Gaps = 5/101 (4%)

Query: 58  GLFAQMASTAAGVAVGSTIGHTLGAGITGMFSGSGSSEVSDQ-QQQPMQNFDXXXXXXXX 116
           G+FAQMASTAAGVAVGST+GH     ++G+  G GS+      QQQ M  +         
Sbjct: 54  GMFAQMASTAAGVAVGSTVGH----AVSGLLFGGGSAPAEQPVQQQAMDPYASQRTLDQE 109

Query: 117 XFRTCDADAKNFTRCLDENNGNFQICDYYLQQLKACQEAAR 157
             ++CD  AK+FT+CLDENNGNFQICDYYLQQLKACQEAAR
Sbjct: 110 PAQSCDGAAKSFTKCLDENNGNFQICDYYLQQLKACQEAAR 150

>KLLA0E06875g complement(625608..626864) similar to sp|P38174
           Saccharomyces cerevisiae YBL091c MAP2 methionine
           aminopeptidase, isoform 2 singleton, start by similarity
          Length = 418

 Score = 28.1 bits (61), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 14/25 (56%)

Query: 125 AKNFTRCLDENNGNFQICDYYLQQL 149
           AKN  + +DEN G    C  YL +L
Sbjct: 339 AKNLLKVIDENFGTIPFCRRYLDRL 363

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.129    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,710,407
Number of extensions: 84333
Number of successful extensions: 282
Number of sequences better than 10.0: 8
Number of HSP's gapped: 272
Number of HSP's successfully gapped: 8
Length of query: 157
Length of database: 16,596,109
Length adjustment: 93
Effective length of query: 64
Effective length of database: 13,376,635
Effective search space: 856104640
Effective search space used: 856104640
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 57 (26.6 bits)