Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0J08734g74273039260.0
YAL023C (PMT2)75970328940.0
Scas_505.275273428190.0
Kwal_26.710574073128160.0
KLLA0F15829g74173027570.0
ACR290W75573325460.0
Scas_643.2476974824860.0
YOR321W (PMT3)75372523640.0
CAGL0F00759g73472121260.0
KLLA0F21978g75774717790.0
Kwal_33.1547175575417640.0
YGR199W (PMT6)75974917060.0
CAGL0K00979g73072016330.0
Scas_408.1*3913829071e-115
CAGL0L07216g8587189371e-114
KLLA0E01342g8387338871e-107
YDL095W (PMT1)8177278831e-107
Kwal_23.36238767308611e-103
ADR279C8176708042e-95
YDL093W (PMT5)7436717581e-89
KLLA0B03762g7727097392e-86
Scas_442.13093006761e-82
CAGL0M00220g7657587014e-81
ABL085W7576956962e-80
YJR143C (PMT4)7626986647e-76
Scas_710.19197166551e-73
Kwal_47.167347927036431e-72
Scas_719.807627476271e-70
CAGL0L07172g7776434802e-50
Scas_30.11281053852e-43
Scas_329.12732123622e-38
Sklu_2215.66536683789e-38
AAL050W6574783141e-29
Scas_588.77265482731e-24
Kwal_33.143576574222491e-21
YDR307W6623411741e-12
KLLA0C14828g6294871642e-11
Scas_710.0d2711511475e-10
CAGL0J11044g7364161212e-06
CAGL0B01705g67268780.29
YGL255W (ZRT1)376161770.37
YMR014W (BUD22)51942721.5
Scas_715.5134158666.2
Kwal_47.1807780977677.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J08734g
         (730 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J08734g 860389..862617 highly similar to sp|P31382 Saccharo...  1516   0.0  
YAL023C (PMT2) [45] chr1 complement(106275..108554) Mannosyltran...  1119   0.0  
Scas_505.2                                                           1090   0.0  
Kwal_26.7105                                                         1089   0.0  
KLLA0F15829g complement(1464112..1466337) similar to sp|P31382 S...  1066   0.0  
ACR290W [1337] [Homologous to ScYAL023C (PMT2) - SH; ScYOR321W (...   985   0.0  
Scas_643.24                                                           962   0.0  
YOR321W (PMT3) [5103] chr15 (916025..918286) Mannosyltransferase...   915   0.0  
CAGL0F00759g complement(85452..87656) similar to sp|P31382 Sacch...   823   0.0  
KLLA0F21978g 2042656..2044929 similar to sp|P42934 Saccharomyces...   689   0.0  
Kwal_33.15471                                                         684   0.0  
YGR199W (PMT6) [2149] chr7 (897505..899784) Protein with similar...   661   0.0  
CAGL0K00979g complement(97306..99498) similar to sp|P42934 Sacch...   633   0.0  
Scas_408.1*                                                           353   e-115
CAGL0L07216g complement(799529..802105) similar to sp|P33775 Sac...   365   e-114
KLLA0E01342g complement(134691..137207) similar to sp|P33775 Sac...   346   e-107
YDL095W (PMT1) [773] chr4 (287059..289512) Mannosyltransferase (...   344   e-107
Kwal_23.3623                                                          336   e-103
ADR279C [2020] [Homologous to ScYDL095W (PMT1) - SH; ScYDL093W (...   314   2e-95
YDL093W (PMT5) [774] chr4 (289909..292140) Member of the PMT O-m...   296   1e-89
KLLA0B03762g 339424..341742 similar to sp|P46971 Saccharomyces c...   289   2e-86
Scas_442.1                                                            265   1e-82
CAGL0M00220g 28137..30434 similar to sp|P46971 Saccharomyces cer...   274   4e-81
ABL085W [507] [Homologous to ScYJR143C (PMT4) - SH] complement(2...   272   2e-80
YJR143C (PMT4) [3035] chr10 complement(698241..700529) Mannosylt...   260   7e-76
Scas_710.1                                                            256   1e-73
Kwal_47.16734                                                         252   1e-72
Scas_719.80                                                           246   1e-70
CAGL0L07172g complement(796354..798687) similar to sp|P33775 Sac...   189   2e-50
Scas_30.1                                                             152   2e-43
Scas_329.1                                                            144   2e-38
Sklu_2215.6 YDR307W, Contig c2215 9395-11356 reverse complement       150   9e-38
AAL050W [137] [Homologous to ScYDR307W - SH] complement(256490.....   125   1e-29
Scas_588.7                                                            109   1e-24
Kwal_33.14357                                                         100   1e-21
YDR307W (YDR307W) [1135] chr4 (1075857..1077845) Protein contain...    72   1e-12
KLLA0C14828g complement(1292713..1294602) weakly similar to sp|Q...    68   2e-11
Scas_710.0d                                                            61   5e-10
CAGL0J11044g complement(1073988..1076198) weakly similar to sp|Q...    51   2e-06
CAGL0B01705g 157245..159263 highly similar to sp|P46944 Saccharo...    35   0.29 
YGL255W (ZRT1) [1745] chr7 (20978..22108) High-affinity zinc tra...    34   0.37 
YMR014W (BUD22) [3978] chr13 (298867..300426) Protein with possi...    32   1.5  
Scas_715.51                                                            30   6.2  
Kwal_47.18077                                                          30   7.0  

>CAGL0J08734g 860389..862617 highly similar to sp|P31382
           Saccharomyces cerevisiae YAL023c PMT2 or sp|P47190
           Saccharomyces cerevisiae YOR321w PMT3, hypothetical
           start
          Length = 742

 Score = 1516 bits (3926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 730/730 (100%), Positives = 730/730 (100%)

Query: 1   MSSTGFQGSEKSDAELKARKQTSVDDVLIEEKEDTSKLKDAKVSQSPLLQLEAYLMPLVF 60
           MSSTGFQGSEKSDAELKARKQTSVDDVLIEEKEDTSKLKDAKVSQSPLLQLEAYLMPLVF
Sbjct: 1   MSSTGFQGSEKSDAELKARKQTSVDDVLIEEKEDTSKLKDAKVSQSPLLQLEAYLMPLVF 60

Query: 61  TGLALFVRMYRIGINGNVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYN 120
           TGLALFVRMYRIGINGNVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYN
Sbjct: 61  TGLALFVRMYRIGINGNVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYN 120

Query: 121 GSFDFESGHEYPEYVDFVKMRLFNASFSAMCVPLAYFTAKAIGFSLPAVWLFTCMVLFEN 180
           GSFDFESGHEYPEYVDFVKMRLFNASFSAMCVPLAYFTAKAIGFSLPAVWLFTCMVLFEN
Sbjct: 121 GSFDFESGHEYPEYVDFVKMRLFNASFSAMCVPLAYFTAKAIGFSLPAVWLFTCMVLFEN 180

Query: 181 SYSTLGRFILLDSMLLFFTVASVFSFVMFHNQRSRPFSRKWWKWLLLTGINLGCTISVKM 240
           SYSTLGRFILLDSMLLFFTVASVFSFVMFHNQRSRPFSRKWWKWLLLTGINLGCTISVKM
Sbjct: 181 SYSTLGRFILLDSMLLFFTVASVFSFVMFHNQRSRPFSRKWWKWLLLTGINLGCTISVKM 240

Query: 241 VGLFVITLVGIYTVIDLLQMLNEKKMSWKSYTGHWLARIVALICVPMAVFMICFKLHFDL 300
           VGLFVITLVGIYTVIDLLQMLNEKKMSWKSYTGHWLARIVALICVPMAVFMICFKLHFDL
Sbjct: 241 VGLFVITLVGIYTVIDLLQMLNEKKMSWKSYTGHWLARIVALICVPMAVFMICFKLHFDL 300

Query: 301 LWHSGTGDANMPSLFQAGLVGSDVGGGPRDVAIGSSVSIKNQALSGALLHSHVQTYPEGS 360
           LWHSGTGDANMPSLFQAGLVGSDVGGGPRDVAIGSSVSIKNQALSGALLHSHVQTYPEGS
Sbjct: 301 LWHSGTGDANMPSLFQAGLVGSDVGGGPRDVAIGSSVSIKNQALSGALLHSHVQTYPEGS 360

Query: 361 NQQQVTAYSYKDANNNWVFHRVREESLWDINETDIEYVVDGAVYRLVHANTQKNLHTHSI 420
           NQQQVTAYSYKDANNNWVFHRVREESLWDINETDIEYVVDGAVYRLVHANTQKNLHTHSI
Sbjct: 361 NQQQVTAYSYKDANNNWVFHRVREESLWDINETDIEYVVDGAVYRLVHANTQKNLHTHSI 420

Query: 421 AAPVDKKNWEVSGYGNHTIGDAKDYWVLEIVDQKGSENTTQVHPLTTSFRLRNKELDCYL 480
           AAPVDKKNWEVSGYGNHTIGDAKDYWVLEIVDQKGSENTTQVHPLTTSFRLRNKELDCYL
Sbjct: 421 AAPVDKKNWEVSGYGNHTIGDAKDYWVLEIVDQKGSENTTQVHPLTTSFRLRNKELDCYL 480

Query: 481 AQTGNHLPEWGFRQHEISCVKDPFRRDKRTWWNVESHENEKLPTPEEFKYPGSGFLKDFI 540
           AQTGNHLPEWGFRQHEISCVKDPFRRDKRTWWNVESHENEKLPTPEEFKYPGSGFLKDFI
Sbjct: 481 AQTGNHLPEWGFRQHEISCVKDPFRRDKRTWWNVESHENEKLPTPEEFKYPGSGFLKDFI 540

Query: 541 HLNLAMMATNNALVPESDKFDYLASSAWEWPTLHVGLRLCGWGDNNPKYFLLGTPVTTWA 600
           HLNLAMMATNNALVPESDKFDYLASSAWEWPTLHVGLRLCGWGDNNPKYFLLGTPVTTWA
Sbjct: 541 HLNLAMMATNNALVPESDKFDYLASSAWEWPTLHVGLRLCGWGDNNPKYFLLGTPVTTWA 600

Query: 601 SSVAVISFMILFVVLLLRWQRQYNDFSNKDDFNLFLMGGFYPILGWGLHFVPFVIMSRVT 660
           SSVAVISFMILFVVLLLRWQRQYNDFSNKDDFNLFLMGGFYPILGWGLHFVPFVIMSRVT
Sbjct: 601 SSVAVISFMILFVVLLLRWQRQYNDFSNKDDFNLFLMGGFYPILGWGLHFVPFVIMSRVT 660

Query: 661 YVHHYLPALYFALIILTYIIDATTKRWMKSKCGSIMRLVVFAISIASVVGCFWYFSPISF 720
           YVHHYLPALYFALIILTYIIDATTKRWMKSKCGSIMRLVVFAISIASVVGCFWYFSPISF
Sbjct: 661 YVHHYLPALYFALIILTYIIDATTKRWMKSKCGSIMRLVVFAISIASVVGCFWYFSPISF 720

Query: 721 GMTGPAINYH 730
           GMTGPAINYH
Sbjct: 721 GMTGPAINYH 730

>YAL023C (PMT2) [45] chr1 complement(106275..108554)
           Mannosyltransferase (dolichyl
           phosphate-D-mannose:protein O-D-mannosyltransferase),
           responsible for initiation of O-glycosylation [2280 bp,
           759 aa]
          Length = 759

 Score = 1119 bits (2894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/703 (74%), Positives = 605/703 (86%), Gaps = 4/703 (0%)

Query: 30  EEKEDTSKLKDAKVSQSPLLQLEAYLMPLVFTGLALFVRMYRIGINGNVVWDEAHFGKFG 89
            + ED SK K A  +QS LL+LE+ +MP++FT LALF RMY+IGIN +VVWDEAHFGKFG
Sbjct: 43  RDAEDFSKEKPA--AQSSLLRLESVVMPVIFTALALFTRMYKIGINNHVVWDEAHFGKFG 100

Query: 90  SYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSFDFESGHEYPEYVDFVKMRLFNASFSA 149
           SYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGS+DF SG  YP+Y+D+VKMRLFNASFSA
Sbjct: 101 SYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEIYPDYLDYVKMRLFNASFSA 160

Query: 150 MCVPLAYFTAKAIGFSLPAVWLFTCMVLFENSYSTLGRFILLDSMLLFFTVASVFSFVMF 209
           +CVPLAYFTAKAIGFSLP VWL T +VLFENSYSTLGRFILLDSMLLFFTVAS FSFVMF
Sbjct: 161 LCVPLAYFTAKAIGFSLPTVWLMTVLVLFENSYSTLGRFILLDSMLLFFTVASFFSFVMF 220

Query: 210 HNQRSRPFSRKWWKWLLLTGINLGCTISVKMVGLFVITLVGIYTVIDLLQMLNEKKMSWK 269
           HNQRS+PFSRKWWKWLL+TGI+LGCTISVKMVGLF+IT+VGIYTVIDL   L +K MSWK
Sbjct: 221 HNQRSKPFSRKWWKWLLITGISLGCTISVKMVGLFIITMVGIYTVIDLWTFLADKSMSWK 280

Query: 270 SYTGHWLARIVALICVPMAVFMICFKLHFDLLWHSGTGDANMPSLFQAGLVGSDVGGGPR 329
           +Y  HWLARI  LI VP  +F++CFK+HFDLL HSGTGDANMPSLFQA LVGSDVG GPR
Sbjct: 281 TYINHWLARIFGLIIVPFCIFLLCFKIHFDLLSHSGTGDANMPSLFQARLVGSDVGQGPR 340

Query: 330 DVAIGSS-VSIKNQALSGALLHSHVQTYPEGSNQQQVTAYSYKDANNNWVFHRVREESLW 388
           D+A+GSS VSIKNQAL G+LLHSH+QTYP+GSNQQQVT Y YKDANN W F+R R    W
Sbjct: 341 DIALGSSVVSIKNQALGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNEWFFNRERGLPSW 400

Query: 389 DINETDIEYVVDGAVYRLVHANTQKNLHTHSIAAPVDKKNWEVSGYGNHTIGDAKDYWVL 448
             NETDIEY+  G  YRLVH +T +NLHTH +AAPV K  WEVSGYG++ +GD KD WV+
Sbjct: 401 SENETDIEYLKPGTSYRLVHKSTGRNLHTHPVAAPVSKTQWEVSGYGDNVVGDNKDNWVI 460

Query: 449 EIVDQKGSENTTQVHPLTTSFRLRNKELDCYLAQTGNHLPEWGFRQHEISCVKDPFRRDK 508
           EI+DQ+G E+  ++H LTTSFR++N E+ CYLAQTGN LPEWGFRQ E+ C+K+PF+RDK
Sbjct: 461 EIMDQRGDEDPEKLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPFKRDK 520

Query: 509 RTWWNVESHENEKL-PTPEEFKYPGSGFLKDFIHLNLAMMATNNALVPESDKFDYLASSA 567
           RTWWN+E+HENE+L P PE+F+YP + FLKDFIHLNLAMMATNNALVP+ DKFDYLASSA
Sbjct: 521 RTWWNIETHENERLPPRPEDFQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASSA 580

Query: 568 WEWPTLHVGLRLCGWGDNNPKYFLLGTPVTTWASSVAVISFMILFVVLLLRWQRQYNDFS 627
           W+WPTL+VGLRLCGWGD+NPKYFLLGTP +TWASSVAV++FM   V+LL+RWQRQY D  
Sbjct: 581 WQWPTLNVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLR 640

Query: 628 NKDDFNLFLMGGFYPILGWGLHFVPFVIMSRVTYVHHYLPALYFALIILTYIIDATTKRW 687
           N  ++N+FLMGGFYP+L WGLH++PFVIMSRVTYVHHYLPALYFALIIL Y  DA  ++W
Sbjct: 641 NPSNWNVFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQKW 700

Query: 688 MKSKCGSIMRLVVFAISIASVVGCFWYFSPISFGMTGPAINYH 730
            +SKCG IMR V++A  +A V+GCFWYFSPISFGM GP+ N+ 
Sbjct: 701 SRSKCGRIMRFVLYAGFMALVIGCFWYFSPISFGMEGPSSNFR 743

>Scas_505.2
          Length = 752

 Score = 1090 bits (2819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/734 (68%), Positives = 605/734 (82%), Gaps = 6/734 (0%)

Query: 2   SSTGFQGSEKSDAELKARKQTSVD--DVLIEEKEDTSK--LKDAKVSQSPLLQLEAYLMP 57
           S+TGF+  EK   E+KAR+  ++D  + +I+EKED  K  +   K   + LL++E+ +MP
Sbjct: 3   SATGFKAREKDTEEVKARQDINIDTHEEIIDEKEDLKKEIVSTEKKESNTLLRVESIIMP 62

Query: 58  LVFTGLALFVRMYRIGINGNVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLA 117
           LVFTGLA+F+RMY+IGIN +VVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLA
Sbjct: 63  LVFTGLAIFIRMYKIGINDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLA 122

Query: 118 GYNGSFDFESGHEYPEYVDFVKMRLFNASFSAMCVPLAYFTAKAIGFSLPAVWLFTCMVL 177
           GYNGSFDF SG EYP+YVD+VKMR+FNA+FSAMCVP+AYFTAKAIGFS+P VWLFT  VL
Sbjct: 123 GYNGSFDFSSGAEYPDYVDYVKMRIFNAAFSAMCVPVAYFTAKAIGFSIPTVWLFTITVL 182

Query: 178 FENSYSTLGRFILLDSMLLFFTVASVFSFVMFHNQRSRPFSRKWWKWLLLTGINLGCTIS 237
           FENSY+TLG+FILLDSMLLFFTV S   FV+FHNQRS+PFSRKWWKW+LLTG+++GC IS
Sbjct: 183 FENSYTTLGKFILLDSMLLFFTVLSYMCFVIFHNQRSKPFSRKWWKWMLLTGLSMGCAIS 242

Query: 238 VKMVGLFVITLVGIYTVIDLLQMLNEKKMSWKSYTGHWLARIVALICVPMAVFMICFKLH 297
           VKMVGLF+IT+VGIYT+IDL   L +K MSWK+Y GHWLARI+ LI VP  VF+ CFK+H
Sbjct: 243 VKMVGLFIITVVGIYTIIDLWNFLGDKTMSWKAYIGHWLARIICLIIVPFLVFLACFKIH 302

Query: 298 FDLLWHSGTGDANMPSLFQAGLVGSDVGGGPRDVAIGSS-VSIKNQALSGALLHSHVQTY 356
           FDLL HSGTGDANM SLFQA L+GSDVG GPRDVA+GSS +SIKNQAL GALLHSH   Y
Sbjct: 303 FDLLTHSGTGDANMSSLFQANLIGSDVGAGPRDVAVGSSIISIKNQALGGALLHSHYNAY 362

Query: 357 PEGSNQQQVTAYSYKDANNNWVFHRVREESLWDINETDIEYVVDGAVYRLVHANTQKNLH 416
           PEGSNQQQVTAYSYKDANN W F R R E  +  NETDIEYV+  + YRLVH  T KNLH
Sbjct: 363 PEGSNQQQVTAYSYKDANNEWFFDRPRGEPFYHENETDIEYVLGDSQYRLVHHKTGKNLH 422

Query: 417 THSIAAPVDKKNWEVSGYGNHTIGDAKDYWVLEIVDQKGSENTTQVHPLTTSFRLRNKEL 476
           TH + AP+    WEVSGYG+   GD++D W++EIVDQ+G E+ T++HPLTTSFR+ N ++
Sbjct: 423 THPVRAPISSTQWEVSGYGDAEQGDSRDNWLIEIVDQRGDEDKTKLHPLTTSFRIYNPDM 482

Query: 477 DCYLAQTGNHLPEWGFRQHEISCVKDPFRRDKRTWWNVESHENEKL-PTPEEFKYPGSGF 535
           DCYL+QTGNHLPEWGF+Q E++CV++PFRRDKRTWWN+E++EN+ L P P +FK+P + F
Sbjct: 483 DCYLSQTGNHLPEWGFKQFEVACVQNPFRRDKRTWWNIETNENDVLPPRPADFKFPKTNF 542

Query: 536 LKDFIHLNLAMMATNNALVPESDKFDYLASSAWEWPTLHVGLRLCGWGDNNPKYFLLGTP 595
            KDFI LNLAMMATNNALVP+ +KFD LASSAW+WPTL+ GLR+C WG++  KYFLLGTP
Sbjct: 543 FKDFIQLNLAMMATNNALVPDPEKFDILASSAWQWPTLYWGLRICSWGEDVVKYFLLGTP 602

Query: 596 VTTWASSVAVISFMILFVVLLLRWQRQYNDFSNKDDFNLFLMGGFYPILGWGLHFVPFVI 655
            +TW SS+AV+  M+  VVLL+RWQRQY+D  +  D N F+MG FYP+L WGLH+ PFVI
Sbjct: 603 ASTWGSSLAVVGLMVYIVVLLIRWQRQYSDLQDPKDLNTFMMGAFYPLLAWGLHYAPFVI 662

Query: 656 MSRVTYVHHYLPALYFALIILTYIIDATTKRWMKSKCGSIMRLVVFAISIASVVGCFWYF 715
           MSRVTYVHHYLPALYFALIIL Y+ DA  K   K+K   I+R+V++  +  +V+GCFWYF
Sbjct: 663 MSRVTYVHHYLPALYFALIILAYVFDAGLKFLTKTKSTQILRIVIYLAAYVTVIGCFWYF 722

Query: 716 SPISFGMTGPAINY 729
           SPISFGM GP  NY
Sbjct: 723 SPISFGMVGPMENY 736

>Kwal_26.7105
          Length = 740

 Score = 1089 bits (2816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/731 (69%), Positives = 616/731 (84%), Gaps = 5/731 (0%)

Query: 1   MSSTGFQGSEKSDAELKARKQTSVDDVLIEEKEDTSKLKDAKVSQSPLLQLEAYLMPLVF 60
           MS+TGF  S  SD  LK RK T+VD++   E +D  ++++  V  +PLL+LE+  MP++F
Sbjct: 1   MSATGFD-SRISDGTLKQRKVTTVDEIPDIEVDD--RIEEKSVEVNPLLRLESIAMPMIF 57

Query: 61  TGLALFVRMYRIGINGNVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYN 120
           T +  F RMY+IG+N +VVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSG++AGYN
Sbjct: 58  TAVGFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGWMAGYN 117

Query: 121 GSFDFESGHEYPEYVDFVKMRLFNASFSAMCVPLAYFTAKAIGFSLPAVWLFTCMVLFEN 180
           GS+DF SG EYP+Y+D+VKMR+FNA+FSA+C+PLAYFTAKAIGFSLP VWLFT +V+FEN
Sbjct: 118 GSWDFPSGEEYPDYLDYVKMRIFNATFSALCIPLAYFTAKAIGFSLPTVWLFTILVIFEN 177

Query: 181 SYSTLGRFILLDSMLLFFTVASVFSFVMFHNQRSRPFSRKWWKWLLLTGINLGCTISVKM 240
           SY+TLGRFILLDSMLLFFTVAS+F FV FHNQRS+PFSRKWWKWLLLTG++LGCTISVKM
Sbjct: 178 SYATLGRFILLDSMLLFFTVASMFCFVTFHNQRSKPFSRKWWKWLLLTGVSLGCTISVKM 237

Query: 241 VGLFVITLVGIYTVIDLLQMLNEKKMSWKSYTGHWLARIVALICVPMAVFMICFKLHFDL 300
           VGLF+ITLVGIYTVI+L  +L +KK+S K+Y GHWLARI+ LI VP  +F+ CFK+HFDL
Sbjct: 238 VGLFIITLVGIYTVIELWTLLGDKKVSKKAYAGHWLARILCLIIVPFLIFLACFKVHFDL 297

Query: 301 LWHSGTGDANMPSLFQAGLVGSDVGGGPRDVAIGSS-VSIKNQALSGALLHSHVQTYPEG 359
           L HSGTGDANMPSLFQAGL GSDVG GPRD+A+GSS VSIKNQAL G+LLHSHVQ YPEG
Sbjct: 298 LSHSGTGDANMPSLFQAGLAGSDVGDGPRDIAVGSSIVSIKNQALGGSLLHSHVQGYPEG 357

Query: 360 SNQQQVTAYSYKDANNNWVFHRVREESLWDINETDIEYVVDGAVYRLVHANTQKNLHTHS 419
           SNQQQVT Y +KD+NNNW+F R+R  + W   ET+IE+V  G+ YRLVH NT KNLHTH 
Sbjct: 358 SNQQQVTCYGHKDSNNNWLFDRIRPLTPWSEEETEIEFVKPGSSYRLVHPNTGKNLHTHP 417

Query: 420 IAAPVDKKNWEVSGYGNHTIGDAKDYWVLEIVDQKGSENTTQVHPLTTSFRLRNKELDCY 479
           IAAP+ K  WEVSGYG   +GD KD+WV+E+V Q GSE+ +++HPLT+SFR++N EL CY
Sbjct: 418 IAAPITKSEWEVSGYGTAEVGDPKDHWVVEVVAQHGSEDESRLHPLTSSFRIKNAELGCY 477

Query: 480 LAQTGNHLPEWGFRQHEISCVKDPFRRDKRTWWNVESHENEKLP-TPEEFKYPGSGFLKD 538
           LAQTG HLPEWGFRQ E++C+K+PF+RDKRTWWNVE+H NEKLP  P +FKYP   F+K+
Sbjct: 478 LAQTGAHLPEWGFRQSEVACLKNPFKRDKRTWWNVETHTNEKLPGRPADFKYPKINFIKN 537

Query: 539 FIHLNLAMMATNNALVPESDKFDYLASSAWEWPTLHVGLRLCGWGDNNPKYFLLGTPVTT 598
           FIHLNLAMMATNNALVP+ DK D LASSAW+WPTL+VG+RLCGWGD+  KYFL+G+P +T
Sbjct: 538 FIHLNLAMMATNNALVPDPDKLDNLASSAWQWPTLNVGIRLCGWGDDTVKYFLMGSPAST 597

Query: 599 WASSVAVISFMILFVVLLLRWQRQYNDFSNKDDFNLFLMGGFYPILGWGLHFVPFVIMSR 658
           W S++AV+ FM L V+LLLRWQRQY D S+  DFNLF+MGGFYP+LGWGLH++PFVIMSR
Sbjct: 598 WLSTIAVVGFMGLVVLLLLRWQRQYQDLSDAHDFNLFMMGGFYPLLGWGLHYMPFVIMSR 657

Query: 659 VTYVHHYLPALYFALIILTYIIDATTKRWMKSKCGSIMRLVVFAISIASVVGCFWYFSPI 718
           VTYVHHYLPALYFAL+IL+Y+ +A  K   K+K G + R +++    A V+  F+YFSPI
Sbjct: 658 VTYVHHYLPALYFALLILSYLFEAGLKGLNKTKGGQLARTLIYVTYGAIVIYGFYYFSPI 717

Query: 719 SFGMTGPAINY 729
           SFG++GP+ NY
Sbjct: 718 SFGLSGPSSNY 728

>KLLA0F15829g complement(1464112..1466337) similar to sp|P31382
           Saccharomyces cerevisiae YAL023c PMT2
           mannosyltransferase, start by similarity
          Length = 741

 Score = 1066 bits (2757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/730 (67%), Positives = 597/730 (81%), Gaps = 4/730 (0%)

Query: 3   STGFQGSEKSDAELKARKQTSVDDVLIEEKEDTSKLKDAKVSQSPLLQLEAYLMPLVFTG 62
           S    G E   +     K    +  ++ E ED SK K   V++SPLL+LE+ LMP++FTG
Sbjct: 2   SASLSGDELQSSLRHRGKDVVEEVEVLPEAEDLSKQK--HVNESPLLKLESILMPIIFTG 59

Query: 63  LALFVRMYRIGINGNVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGS 122
           LA F+RMY+IG N +VVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVG SGYLAGYNGS
Sbjct: 60  LAFFIRMYKIGANDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGFSGYLAGYNGS 119

Query: 123 FDFESGHEYPEYVDFVKMRLFNASFSAMCVPLAYFTAKAIGFSLPAVWLFTCMVLFENSY 182
           +DF SG +YPEY+DFVKMRLFNA FSA+CVP+AYFTAK+IGFSLP VWLFT +VLFENSY
Sbjct: 120 WDFPSGEQYPEYIDFVKMRLFNALFSALCVPVAYFTAKSIGFSLPTVWLFTTLVLFENSY 179

Query: 183 STLGRFILLDSMLLFFTVASVFSFVMFHNQRSRPFSRKWWKWLLLTGINLGCTISVKMVG 242
           +TLGRFILLDSMLLFFTV S+F FV FHN RS+PF++KWWKWL  TG +LGCTISVKMVG
Sbjct: 180 TTLGRFILLDSMLLFFTVLSMFCFVKFHNVRSKPFTKKWWKWLFYTGFSLGCTISVKMVG 239

Query: 243 LFVITLVGIYTVIDLLQMLNEKKMSWKSYTGHWLARIVALICVPMAVFMICFKLHFDLLW 302
           L +IT+VGIYTV+DL  ML + KMS K Y  HW +R V LI VP AVF+ CFK+HFDLL 
Sbjct: 240 LLIITMVGIYTVVDLWNMLADTKMSKKVYAAHWASRFVFLILVPFAVFLACFKIHFDLLS 299

Query: 303 HSGTGDANMPSLFQAGLVGSDVGGGPRDVAIGSS-VSIKNQALSGALLHSHVQTYPEGSN 361
           HSGTGDANMPSLFQA L+GSDVG GPRDVA+GSS ++IKNQAL G LLHSH+QTYPEGS 
Sbjct: 300 HSGTGDANMPSLFQANLIGSDVGEGPRDVALGSSEITIKNQALGGGLLHSHIQTYPEGSQ 359

Query: 362 QQQVTAYSYKDANNNWVFHRVREESLWDINETDIEYVVDGAVYRLVHANTQKNLHTHSIA 421
           QQQVT Y +KD+NN W F R R  + +D NET+ E+V DGA YRLVH NT +NLHTH   
Sbjct: 360 QQQVTTYGHKDSNNVWTFDRQRFSAPYDKNETETEFVTDGARYRLVHLNTGRNLHTHPHR 419

Query: 422 APVDKKNWEVSGYGNHTIGDAKDYWVLEIVDQKGSENTTQVHPLTTSFRLRNKELDCYLA 481
           APV    WEVSGYG+  +GD KD W++EIVDQKG E+ T++HPLT+SFRL+N E+ CYL+
Sbjct: 420 APVQANAWEVSGYGDAKVGDPKDDWIIEIVDQKGPEDETKLHPLTSSFRLKNAEMGCYLS 479

Query: 482 QTGNHLPEWGFRQHEISCVKDPFRRDKRTWWNVESHENEKLPT-PEEFKYPGSGFLKDFI 540
           QTGN LP+WGFRQ+E++CVK+PF+RDKRTWWN+E++ NEKLP  PE FKYP + F+KDFI
Sbjct: 480 QTGNTLPQWGFRQNEVACVKNPFKRDKRTWWNIETNVNEKLPPRPENFKYPKTSFIKDFI 539

Query: 541 HLNLAMMATNNALVPESDKFDYLASSAWEWPTLHVGLRLCGWGDNNPKYFLLGTPVTTWA 600
           HLNLAMMATNNALVP ++K D LASSAW+WPTL+VG+RLCGWG+ N KYFL+G+P +TW 
Sbjct: 540 HLNLAMMATNNALVPNAEKLDKLASSAWQWPTLNVGIRLCGWGEQNIKYFLIGSPASTWP 599

Query: 601 SSVAVISFMILFVVLLLRWQRQYNDFSNKDDFNLFLMGGFYPILGWGLHFVPFVIMSRVT 660
           S++AV++FM+L  V L+RWQRQY+D +N +D NLFLMGG YP+L WGLHFVPF+IMSRVT
Sbjct: 600 STIAVLAFMVLVAVYLIRWQRQYSDLTNPEDINLFLMGGIYPLLAWGLHFVPFIIMSRVT 659

Query: 661 YVHHYLPALYFALIILTYIIDATTKRWMKSKCGSIMRLVVFAISIASVVGCFWYFSPISF 720
           YVHHYLPALYFAL++L Y+ + + K+W KSKCG +MR  ++   +A V+  F+YF+PISF
Sbjct: 660 YVHHYLPALYFALLVLAYLFEISMKKWNKSKCGKVMRYTIYGSYMAIVIYGFYYFAPISF 719

Query: 721 GMTGPAINYH 730
           GM+GP+ +Y 
Sbjct: 720 GMSGPSTDYE 729

>ACR290W [1337] [Homologous to ScYAL023C (PMT2) - SH; ScYOR321W
           (PMT3) - SH] complement(886525..888792) [2268 bp, 755
           aa]
          Length = 755

 Score =  985 bits (2546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/733 (63%), Positives = 576/733 (78%), Gaps = 6/733 (0%)

Query: 1   MSSTGFQGSEKSDAELKARKQTSVDDVLIEEKEDTSKLKDAKVSQSPLLQLEAYLMPLVF 60
           MS+TG+Q  E   A    R + S +D    ++ED SKL++ +  ++PL +LEA++MP++F
Sbjct: 13  MSTTGYQRHEAGPA--NKRGKASAEDGAGVQEEDVSKLREVQQERNPLYKLEAFVMPVLF 70

Query: 61  TGLALFVRMYRIGINGNVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYN 120
           T LAL+ RM++IG N  VVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGY+AGYN
Sbjct: 71  TLLALYTRMHKIGANNRVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYIAGYN 130

Query: 121 GSFDFESGHEYPEYVDFVKMRLFNASFSAMCVPLAYFTAKAIGFSLPAVWLFTCMVLFEN 180
           GS+DF SG EYPEY+D+VKMR+FNA FSAMC P+AYFT KAIGFSLP VWLF+ +V+FEN
Sbjct: 131 GSWDFPSGEEYPEYIDYVKMRMFNAVFSAMCAPVAYFTGKAIGFSLPTVWLFSILVVFEN 190

Query: 181 SYSTLGRFILLDSMLLFFTVASVFSFVMFHNQRSRPFSRKWWKWLLLTGINLGCTISVKM 240
           SY+TLGRFILLDSMLLFFTV S ++FV+FHN+R RPF RKWWKWL   G++LGCTISVKM
Sbjct: 191 SYATLGRFILLDSMLLFFTVCSFYTFVLFHNERHRPFGRKWWKWLFFLGVSLGCTISVKM 250

Query: 241 VGLFVITLVGIYTVIDLLQMLNEKKMSWKSYTGHWLARIVALICVPMAVFMICFKLHFDL 300
           VGLF+I++VGIYTV+DL   L+E  MS   + GH+ AR + LI VP  VF+ CFKLHF+ 
Sbjct: 251 VGLFIISVVGIYTVVDLWNKLSEPNMSVSRFAGHFSARALCLIVVPFMVFLFCFKLHFEF 310

Query: 301 LWHSGTGDANMPSLFQAGLVGSDVGGGPRDVAIGSS-VSIKNQALSGALLHSHVQTYPEG 359
           L  SGTGDA MPSLFQAGL GS VG GPRD+A+GSS VSIKNQAL G LLHSHVQTYP G
Sbjct: 311 LSVSGTGDAMMPSLFQAGLSGSSVGIGPRDIAVGSSLVSIKNQALGGTLLHSHVQTYPSG 370

Query: 360 SNQQQVTAYSYKDANNNWVFHRVREESLWDINETDIEYVVDGAVYRLVHANTQKNLHTHS 419
           S+QQQVT Y + D+NNNWVF R+R    W INET+ E+V DG  YRLVHANT +NLHTH 
Sbjct: 371 SSQQQVTTYGHNDSNNNWVFDRIRGLPAWSINETEHEFVQDGRPYRLVHANTGRNLHTHP 430

Query: 420 IAAPVDKKNWEVSGYGNHTIGDAKDYWVLEIVDQKGSENTTQVHPLTTSFRLRNKELDCY 479
           I APV K +WEVSGYG+  +GD KD W++E V Q   E+ + +H ++TSFR++N E+ CY
Sbjct: 431 IPAPVSKTHWEVSGYGDAQVGDPKDNWIIEFVSQPSDEDKSVLHTISTSFRIKNVEMGCY 490

Query: 480 LAQTGNHLPEWGFRQHEISCVKDPFRRDKRTWWNVESHENEKLPT-PEEFKYPGSGFLKD 538
           LAQTG  LPEWGFRQ E++C+ +PF+RDKRTWWN+E++ NE+LP  PE+FKYP + F KD
Sbjct: 491 LAQTGPSLPEWGFRQGEVACISNPFKRDKRTWWNIETNVNERLPPMPEDFKYPKTSFFKD 550

Query: 539 FIHLNLAMMATNNALVPESDKFDYLASSAWEWPTLHVGLRLCGWGDNNPKYFLLGTPVTT 598
           F+HLNLAMMATNNALVP+ DK D LASSAW+WPTL+VG+RLC W D+  KYFL+G+P +T
Sbjct: 551 FVHLNLAMMATNNALVPDPDKLDQLASSAWQWPTLNVGIRLCSWADDVRKYFLIGSPAST 610

Query: 599 WASSVAVISFMILFVVLLLRWQRQYNDFSNKDDFNLFLMGGFYPILGWGLHFVPFVIMSR 658
           W S+ AV  F ++ V  LL+WQRQ   F   DD N+FLMGG YP+LGWGLH++PF +M R
Sbjct: 611 WPSTAAVGVFCLITVYYLLKWQRQLVLFQASDDANIFLMGGIYPLLGWGLHYLPFAVMGR 670

Query: 659 VTYVHHYLPALYFALIILTYIIDATTKRWMKSKCG--SIMRLVVFAISIASVVGCFWYFS 716
           VTYVHHYLPALYFAL+IL Y+ +A+ +   +S+     I+  VV+A+   +++  F+YF 
Sbjct: 671 VTYVHHYLPALYFALLILAYVFEASLRAARQSQKSYWKILVYVVYAVYYCTIICGFYYFY 730

Query: 717 PISFGMTGPAINY 729
           PI+ GM GP+ NY
Sbjct: 731 PITVGMEGPSSNY 743

>Scas_643.24
          Length = 769

 Score =  962 bits (2486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/748 (62%), Positives = 563/748 (75%), Gaps = 23/748 (3%)

Query: 4   TGFQGSEKSDAELKARKQTSV--------DDVLIEEKEDTSKLKDAKVSQSPLLQLEAYL 55
           +GF+  +K  ++LK R+  S         D   I+EK++  K +     +SPL ++EA++
Sbjct: 9   SGFE-PKKEASDLKVRQHNSSAATSKAAKDSASIDEKDENVKKQQPPSEESPLCKVEAWV 67

Query: 56  MPLVFTGLALFVRMYRIGINGNVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGY 115
           MP+VFTGL+ F RMY+IG+N +VVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGY
Sbjct: 68  MPIVFTGLSFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGY 127

Query: 116 LAGYNGSFDFESGHEYPEYVDFVKMRLFNASFSAMCVPLAYFTAKAIGFSLPAVWLFTCM 175
           LAGYNGS+DF SG EYP+Y+D+VKMRLF A+FS++CVP+AY TAKAIGFS+PAVWLFTC+
Sbjct: 128 LAGYNGSWDFPSGEEYPDYLDYVKMRLFQATFSSLCVPMAYITAKAIGFSIPAVWLFTCL 187

Query: 176 VLFENSYSTLGRFILLDSMLLFFTVASVFSFVMFHNQRSRPFSRKWWKWLLLTGINLGCT 235
           VLFENSY+TLGRFILLDSML FFTVAS   F++FH QR  PFS KWW  L L G NLGC 
Sbjct: 188 VLFENSYATLGRFILLDSMLQFFTVASFMFFILFHTQRKNPFSIKWWTTLALLGFNLGCA 247

Query: 236 ISVKMVGLFVITLVGIYTVIDLLQML-------NEKKMSWKSYTGHWLARIVALICVPMA 288
           ISVKMVGLF+ITLVGIYTV DL  +L        +K  +WK Y  HW+ARIV LI +P  
Sbjct: 248 ISVKMVGLFIITLVGIYTVADLWTLLPKQATLKTKKLQAWKVYGCHWIARIVCLIIIPFL 307

Query: 289 VFMICFKLHFDLLWHSGTGDANMPSLFQAGLVGSDVGGGPRDVAIGSS-VSIKNQALSGA 347
           VF+ CF++HF LL HSGTGDANMPSLFQA L GSDVG GPRDVA+GSS VSIKNQAL GA
Sbjct: 308 VFLTCFRIHFALLSHSGTGDANMPSLFQATLDGSDVGKGPRDVALGSSFVSIKNQALGGA 367

Query: 348 LLHSHVQTYPEGSNQQQVTAYSYKDANNNWVFHRVR---EESLWDINETDIEYVVDGAVY 404
           LLHSHVQT+P+GSNQQQVT Y+Y D NN W F R+R    +   +  ETDIEYV  G  Y
Sbjct: 368 LLHSHVQTFPQGSNQQQVTGYAYNDDNNIWFFDRIRIPGNQPWSNETETDIEYVRVGNEY 427

Query: 405 RLVHANTQKNLHTHSIAAPVDKKNWEVSGYG-NHTIGDAKDYWVLEIVDQKGSENTTQVH 463
           RLVH +T+KNLH   I APV K +WEV+G+G    +GD  D W++E+++Q G E+ + +H
Sbjct: 428 RLVHRSTRKNLHADKIVAPVSKNDWEVAGFGYGFEVGDDMDNWIIEVIEQAGDEDKSMIH 487

Query: 464 PLTTSFRLRNKELDCYLAQTGNHLPEWGFRQHEISCVKDPFRRDKRTWWNVESHENEKLP 523
           PLTT+F +++  L CYL QT   LPEWGFRQ E++C     + DKRTWWNVESHENEKLP
Sbjct: 488 PLTTTFHIKHAVLGCYLTQTLKQLPEWGFRQSEMTCSHKISKNDKRTWWNVESHENEKLP 547

Query: 524 TPE-EFKYPGSGFLKDFIHLNLAMMATNNALVPESDKFDYLASSAWEWPTLHVGLRLCGW 582
            P+  F YP + F KDF+ LN  MMATNNALVP+SDK+D LAS+AW+WPTL+VGLRLCGW
Sbjct: 548 DPDASFHYPKTNFFKDFLFLNRIMMATNNALVPDSDKYDSLASAAWQWPTLNVGLRLCGW 607

Query: 583 GDNNPKYFLLGTPVTTWASSVAVISFMILFVVLLLRWQRQYNDFSNKDDFNLFLMGGFYP 642
            D+  KYFLLG+P +TW S+V+VI  MI  VVL  RWQRQ  +F+N    N F+MG FYP
Sbjct: 608 NDDTVKYFLLGSPASTWPSTVSVIVLMIFIVVLAFRWQRQLTNFANDKALNTFMMGAFYP 667

Query: 643 ILGWGLHFVPFVIMSRVTYVHHYLPALYFALIILTYIIDATTKRWMKSKCGSIMRLVVFA 702
           +L WGLHF+PFVIM+RVTYVHHYLPALYFAL++L Y  +A  +R  K      +  +   
Sbjct: 668 LLAWGLHFMPFVIMARVTYVHHYLPALYFALLVLAYFFEAIIRR-PKGTLAKYITYITLV 726

Query: 703 ISIASVVGCFWYFSPISFGMTGPAINYH 730
           +  A V+G F+YFSPISFGM GP+ NY 
Sbjct: 727 LYFAVVIGGFFYFSPISFGMDGPSKNYR 754

>YOR321W (PMT3) [5103] chr15 (916025..918286) Mannosyltransferase
           (dolichyl phosphate-D-mannose:protein
           O-D-mannosyltransferase), involved in initiation of
           O-glycosylation [2262 bp, 753 aa]
          Length = 753

 Score =  915 bits (2364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/725 (59%), Positives = 542/725 (74%), Gaps = 16/725 (2%)

Query: 21  QTSVDDVLI-------EEKEDT-------SKLKDAKVSQSPLLQLEAYLMPLVFTGLALF 66
           + S DD LI       EE ED        ++L D   ++S +  L+  +MP++FT L +F
Sbjct: 11  EKSTDDDLIWRTPIVKEELEDADNFLKDDAELYDKVKNESAVSHLDTIVMPIIFTVLGMF 70

Query: 67  VRMYRIGINGNVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSFDFE 126
            RMY+IG N +VVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGS+DF 
Sbjct: 71  TRMYKIGRNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFP 130

Query: 127 SGHEYPEYVDFVKMRLFNASFSAMCVPLAYFTAKAIGFSLPAVWLFTCMVLFENSYSTLG 186
           SG  YP+Y+D+VKMRLF A FS++CVPLAYFT +AIGFS  +VWLFT +V+FENSY+TLG
Sbjct: 131 SGEVYPDYIDYVKMRLFQAMFSSLCVPLAYFTGRAIGFSRLSVWLFTILVIFENSYATLG 190

Query: 187 RFILLDSMLLFFTVASVFSFVMFHNQRSRPFSRKWWKWLLLTGINLGCTISVKMVGLFVI 246
           +FILLDSMLLFFTV+S F    FH  R  PFS +WW WL LTG+NLGC ISVKMVGLF+I
Sbjct: 191 KFILLDSMLLFFTVSSYFCLAKFHTMRKSPFSARWWLWLCLTGLNLGCAISVKMVGLFII 250

Query: 247 TLVGIYTVIDLLQMLNEKKMSWKSYTGHWLARIVALICVPMAVFMICFKLHFDLLWHSGT 306
           ++VGIYT+ +L  +L+++ +SWK Y  HWLARI  LI +P+ VF++CFK+HFDLL +SG 
Sbjct: 251 SVVGIYTISELWNLLSDRSVSWKVYVNHWLARIFGLIIIPVCVFLLCFKIHFDLLSNSGP 310

Query: 307 GDANMPSLFQAGLVGSDVGGGPRDVAIGSS-VSIKNQALSGALLHSHVQTYPEGSNQQQV 365
           GD+ MPSLFQA L G+ VG GPRDVA+GSS +SIKNQAL GALLHSHVQ +PEGS QQQV
Sbjct: 311 GDSTMPSLFQASLNGTKVGKGPRDVALGSSIISIKNQALGGALLHSHVQPFPEGSEQQQV 370

Query: 366 TAYSYKDANNNWVFHRVREESLW-DINETDIEYVVDGAVYRLVHANTQKNLHTHSIAAPV 424
           T Y Y DANN W F R+R    W D     IE+V  G +YRL+H  T KNLHTH + AP+
Sbjct: 371 TVYGYSDANNEWFFQRIRGVEPWTDAENKTIEFVKGGEMYRLMHRLTGKNLHTHEVPAPI 430

Query: 425 DKKNWEVSGYGNHTIGDAKDYWVLEIVDQKGSENTTQVHPLTTSFRLRNKELDCYLAQTG 484
            K  +EVS YG+  +GD KD W++EIV+Q G E+ T +HPL+TSFR++N  L CYLAQ+G
Sbjct: 431 SKSEYEVSAYGDVDLGDYKDNWIIEIVEQVGEEDPTLLHPLSTSFRIKNSILGCYLAQSG 490

Query: 485 NHLPEWGFRQHEISCVKDPFRRDKRTWWNVESHENEKLPTPEEFKYPGSGFLKDFIHLNL 544
            HLPEWGFRQ E+ C+K   +RDKRTWWN+E+HENE+LP  E+F YP + F ++F+ LN 
Sbjct: 491 KHLPEWGFRQGEVVCLKHASKRDKRTWWNIETHENERLPQGEDFVYPKTSFFRNFMQLNS 550

Query: 545 AMMATNNALVPESDKFDYLASSAWEWPTLHVGLRLCGWGDNNPKYFLLGTPVTTWASSVA 604
           AMMATNNALVP  +KFD +ASSAW+WPTL+VG+RLC W + + KYFLLG+P + W SS+A
Sbjct: 551 AMMATNNALVPNPEKFDGIASSAWQWPTLNVGVRLCEWSEKSIKYFLLGSPASVWPSSIA 610

Query: 605 VISFMILFVVLLLRWQRQYNDFSNKDDFNLFLMGGFYPILGWGLHFVPFVIMSRVTYVHH 664
           V + +I  + L L+WQRQ    S+  + ++F+M  FYP+L W LH++PFV+MSRV Y HH
Sbjct: 611 VCALIIHVIFLTLKWQRQCVILSDPVERDVFVMAAFYPLLAWLLHYMPFVVMSRVVYAHH 670

Query: 665 YLPALYFALIILTYIIDATTKRWMKSKCGSIMRLVVFAISIASVVGCFWYFSPISFGMTG 724
           YLP LYFAL+IL+Y  D  TKRW     G  +RL  + +  + V+  F+YFSP SFGM G
Sbjct: 671 YLPTLYFALMILSYYFDMITKRWATRNTGKFLRLGAYIVYGSIVIAGFFYFSPFSFGMDG 730

Query: 725 PAINY 729
           P  +Y
Sbjct: 731 PVDDY 735

>CAGL0F00759g complement(85452..87656) similar to sp|P31382
           Saccharomyces cerevisiae YAL023c PMT2 or sp|P47190
           Saccharomyces cerevisiae YOR321w PMT3, hypothetical
           start
          Length = 734

 Score =  823 bits (2126), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/721 (54%), Positives = 509/721 (70%), Gaps = 4/721 (0%)

Query: 13  DAELKARKQTSVDDVLIEEKEDTSKLKDAKVSQSP----LLQLEAYLMPLVFTGLALFVR 68
           D+EL+ARK  SV +V +E         D K  ++      L+LE   MP+VFT LAL VR
Sbjct: 2   DSELRARKAPSVSEVKVEHDHGHDLANDNKEQKASNKQFWLRLERVAMPIVFTLLALLVR 61

Query: 69  MYRIGINGNVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSFDFESG 128
           +YR+ +   V WDEAHFGKFGSYYLRH FYHDVHPPLGKMLVG SGYLAGYNGS+DF SG
Sbjct: 62  LYRLDVVKKVTWDEAHFGKFGSYYLRHTFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPSG 121

Query: 129 HEYPEYVDFVKMRLFNASFSAMCVPLAYFTAKAIGFSLPAVWLFTCMVLFENSYSTLGRF 188
             YP+YV FVKMR+F  + SA+CVP+ YF AKAIGFSLP VWL T +VL ENSY+TLG+ 
Sbjct: 122 QPYPDYVPFVKMRIFQGAVSALCVPMTYFAAKAIGFSLPTVWLTTILVLCENSYTTLGKL 181

Query: 189 ILLDSMLLFFTVASVFSFVMFHNQRSRPFSRKWWKWLLLTGINLGCTISVKMVGLFVITL 248
           ILLDS+LLFFTVA+   F  FH+   +PFS +W  WL LTG ++GC ISVKMVGLFVITL
Sbjct: 182 ILLDSLLLFFTVATFMCFQKFHSYHRKPFSFQWCLWLFLTGASMGCAISVKMVGLFVITL 241

Query: 249 VGIYTVIDLLQMLNEKKMSWKSYTGHWLARIVALICVPMAVFMICFKLHFDLLWHSGTGD 308
           VGI+T+++L  +L +K ++WK Y  HW+ARI+ LI  P  +F +CFK+HF LLW SG GD
Sbjct: 242 VGIHTIVELWTLLGDKNITWKRYANHWIARIICLIVTPFLIFALCFKIHFALLWGSGPGD 301

Query: 309 ANMPSLFQAGLVGSDVGGGPRDVAIGSSVSIKNQALSGALLHSHVQTYPEGSNQQQVTAY 368
             MP  FQA L G+++G GPRDV+IGS+++++N    GA LHSH QTYPEGS Q+QVT Y
Sbjct: 302 HEMPPRFQAALNGTNIGQGPRDVSIGSTITLQNMKPRGAYLHSHHQTYPEGSKQRQVTCY 361

Query: 369 SYKDANNNWVFHRVREESLWDINETDIEYVVDGAVYRLVHANTQKNLHTHSIAAPVDKKN 428
           +Y D NN+W+ +R   + +W +N+T+ E + +G   RLVH  T  NLH+H + AP++K +
Sbjct: 362 NYVDGNNDWIVYRPHGKPIWHVNDTEHEAIRNGDTIRLVHKGTGSNLHSHQVEAPLNKLD 421

Query: 429 WEVSGYGNHTIGDAKDYWVLEIVDQKGSENTTQVHPLTTSFRLRNKELDCYLAQTGNHLP 488
           +EVSGYGN TIGD KD+WV+EI+   G+E+   +HP+TT  R R+  L+CYLAQ+  HLP
Sbjct: 422 YEVSGYGNLTIGDLKDHWVVEIIKDDGNEDKNLIHPITTHVRFRHAVLNCYLAQSNEHLP 481

Query: 489 EWGFRQHEISCVKDPFRRDKRTWWNVESHENEKLPTPEEFKYPGSGFLKDFIHLNLAMMA 548
           EWGF Q E+ C+++P + D +T W V++H +  L  PE F YP   F  DF  LN  MMA
Sbjct: 482 EWGFSQAEVRCIREPEKNDIKTMWIVDTHTHPNLEAPENFIYPRRSFWSDFFELNKRMMA 541

Query: 549 TNNALVPESDKFDYLASSAWEWPTLHVGLRLCGWGDNNPKYFLLGTPVTTWASSVAVISF 608
           TNNAL    DK DYL S +WEWPTL+  LR+  W +N+ +Y LLG+P +TW S+VAV+  
Sbjct: 542 TNNALTVSKDKHDYLRSESWEWPTLYRSLRINSWNENDTRYLLLGSPASTWPSTVAVLFL 601

Query: 609 MILFVVLLLRWQRQYNDFSNKDDFNLFLMGGFYPILGWGLHFVPFVIMSRVTYVHHYLPA 668
           +   +  +L+W RQ   F N+ D  LF+ GG YP+LGW LHF PFVIM RV YVHHYLPA
Sbjct: 602 VFALLYKVLKWNRQMQIFQNEHDEELFIYGGVYPLLGWFLHFFPFVIMGRVKYVHHYLPA 661

Query: 669 LYFALIILTYIIDATTKRWMKSKCGSIMRLVVFAISIASVVGCFWYFSPISFGMTGPAIN 728
           LYFAL +L YI DA  + + K+K   I++  ++A  ++ V+G F  F+P S+GMTG   N
Sbjct: 662 LYFALFVLAYIFDAGLRYYNKTKTQRIIKFCIYAGYMSVVIGGFILFAPFSYGMTGKLEN 721

Query: 729 Y 729
           Y
Sbjct: 722 Y 722

>KLLA0F21978g 2042656..2044929 similar to sp|P42934 Saccharomyces
           cerevisiae YGR199w PMT6 putative mannosyltransferase,
           start by similarity
          Length = 757

 Score =  689 bits (1779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/747 (46%), Positives = 473/747 (63%), Gaps = 31/747 (4%)

Query: 3   STGFQGSEKSDAELKARK-QTSVDDVLIEEKEDTSKLKDAKVS--QSPLL-----QLEAY 54
           S+GF     SD  L+ RK Q    +VL +   D   ++D  V   +S +      +   Y
Sbjct: 5   SSGFL-PNSSDLRLRERKAQFDGTEVLEDFLRDNEPVEDKLVKPLKSSIFSNRNHRFHTY 63

Query: 55  LMPLVFTGLALFVRMYRIGINGNVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSG 114
           +  L+ T ++  +R Y+I  +  VVWDEAHFGKFGSYYL+HEFYHDVHPPLGKML+GL  
Sbjct: 64  VC-LLLTLVSFVLRFYKIDRSNIVVWDEAHFGKFGSYYLKHEFYHDVHPPLGKMLIGLGE 122

Query: 115 YLAGYNGSFDFESGHEYPEYVDFVKMRLFNASFSAMCVPLAYFTAKAIGFSLPAVWLFTC 174
           YLAG++G+FDF S   YP+ V+F  MR FNA FS++C PLA++ A+ + FS+P V+L   
Sbjct: 123 YLAGFDGNFDFSSNSSYPDEVNFKIMRQFNAIFSSLCTPLAFYAARNLNFSMPTVYLVAL 182

Query: 175 MVLFENSYSTLGRFILLDSMLLFFTVASVFSFVMFHNQRSRPFSRKWWKWLLLTGINLGC 234
           MV FE+SY  LG+F+LLDSMLLFFTV + +     +  R    + KW  W+L TG ++GC
Sbjct: 183 MVCFEHSYIVLGKFVLLDSMLLFFTVLTFYCLSQLYRLRECQLTVKWLAWILATGFSIGC 242

Query: 235 TISVKMVGLFVITLVGIYTVIDLLQMLNEKKMSWKSYTGHWLARIVALICVPMAVFMICF 294
             SVK VGL +  LVGIYTV +L  +  ++ +S   Y GHW+ RI ALI  P+ ++M+ F
Sbjct: 243 VCSVKWVGLLITALVGIYTVSELYCLHCDRSLSKTKYLGHWIVRISALIVFPLILYMVFF 302

Query: 295 KLHFDLLWHSGTGDANMPSLFQAGLVGSDVGGGPRDVAIGSSVSIKNQALSGALLHSHVQ 354
           K+HF LL+ +GTGD++  SLFQA L G+ +   PRD+A GS +S+++  LS  LLHSH Q
Sbjct: 303 KIHFTLLYKTGTGDSSTHSLFQANLEGAQIKPSPRDIAFGSCISLRSHGLSPGLLHSHPQ 362

Query: 355 TYPEGSNQQQVTAYSYKDANNNWVFHRVREESLWDINET----DIEYVVDGAVYRLVHAN 410
           TYP+GSNQ+QVT YSY+D NNNW+    R        E     +I ++ DG + RLVH  
Sbjct: 363 TYPDGSNQRQVTGYSYRDGNNNWIVKYSRSSGKASAEERVYSDNILFLKDGDLLRLVHEK 422

Query: 411 TQKNLHTHSIAAPVDKKNWEVSGYGNHTIGDAKDYWVLEIVDQKGS-----ENTTQVHPL 465
           T+ NLHTH I + V K ++EVSGYGN  +GD KD W++E+V+Q  +     EN   +HPL
Sbjct: 423 TKNNLHTHQIPSHVSKGHYEVSGYGNDAVGDLKDDWIIEVVEQLPTGNNTMENKALIHPL 482

Query: 466 TTSFRLRNKELDCYLAQTGNHLPEWGFRQHEISCVKDPFRRDKRTWWNVESHENEKLPTP 525
           TTSFRLRNKEL CYLA TG   P WG+ Q EI C     +RDK TWWNVE H N  L   
Sbjct: 483 TTSFRLRNKELGCYLAATGLSYPGWGYNQAEIVCKYPWNQRDKSTWWNVEDHINSNLHID 542

Query: 526 EEFKYPGSGFLKDFIHLNLAMMATNNALVPESDKFDYLASSAWEWPTLHVGLRLCGWGDN 585
           + F  P + F  DF+ +N AM A+NNAL+P+ DK+D +AS  WEWP L+ GLR+C W D 
Sbjct: 543 QTFTPPPTKFWTDFVVINFAMAASNNALIPDLDKYDRIASEPWEWPILYKGLRMCNWNDK 602

Query: 586 NPKYFLLGTPVTTWASSVAVISFMILFVVLLLRWQRQYNDFSNKDDFNLFLMGGFYPILG 645
             KY+LLG+P  TW S+ A+   +IL  + L R+QRQ    + K  +NLF   G    +G
Sbjct: 603 TVKYYLLGSPFNTWLSTAALPILLILVSMELFRYQRQSLQLNEKKAWNLFACAGL-SFIG 661

Query: 646 WGLHFVPFVIMSRVTYVHHYLPALYFALIILTYIID---ATTKRWMKSKCGSIMRLVVFA 702
           W LH+ PF IM RVTY+HHY+PAL+FA++   Y++D   A + R++K        +V ++
Sbjct: 662 WLLHYAPFFIMGRVTYIHHYVPALFFAIMTFAYVVDFALANSNRYLK--------VVAYS 713

Query: 703 ISIASVVGCFWYFSPISFGMTGPAINY 729
              A     +WYF+P   GM  P + Y
Sbjct: 714 SLYAGCTFTYWYFAPFCQGMPEPNLTY 740

>Kwal_33.15471
          Length = 755

 Score =  684 bits (1764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/754 (46%), Positives = 480/754 (63%), Gaps = 37/754 (4%)

Query: 1   MSSTGFQGSEKSDAELKARKQTSVDDVL-----------IEEKEDTSKLK--DAKVSQSP 47
           MSS+GF   + S+  L+ R++   ++ L           ++EK   +K K   + +S++ 
Sbjct: 1   MSSSGFL-PKSSELNLRERQKNFTENELSIPPNESLDSDVDEKNSKNKTKFASSSISRNV 59

Query: 48  LLQLEAYLMPLVFTGLALFVRMYRIGINGNVVWDEAHFGKFGSYYLRHEFYHDVHPPLGK 107
           LLQ+   ++    T L+ +VR  +I  N  VVWDEAHFGKFGSYY+++EFYHDVHPPLGK
Sbjct: 60  LLQVTGVIL---LTILSFYVRFNKIDANDEVVWDEAHFGKFGSYYIKNEFYHDVHPPLGK 116

Query: 108 MLVGLSGYLAGYNGSFDFESGHEYPEYVDFVKMRLFNASFSAMCVPLAYFTAKAIGFSLP 167
           ML+ LS YLAG+NG F F+SG  YP  +++  MR FNA+F A+C P+   TAK +GFS  
Sbjct: 117 MLIALSQYLAGFNGDFAFDSGAPYPSGMNYKFMRQFNATFGALCAPIMLLTAKNLGFSNL 176

Query: 168 AVWLFTCMVLFENSYSTLGRFILLDSMLLFFTVASVFSFVMFHNQRSRPFSRKWWKWLLL 227
             +    MV  E S+  L +FILLDSMLLFFT  +       H  R+RPF+R+W  W+LL
Sbjct: 177 GSYFLGMMVALELSFVALSKFILLDSMLLFFTATTFHCITELHKVRNRPFTRRWSLWMLL 236

Query: 228 TGINLGCTISVKMVGLFVITLVGIYTVIDLLQMLNEKKMSWKSYTGHWLARIVALICVPM 287
            G+++GC  SVK VGLF+  + GIYTV+DL     +K++S  SY  HWL RI+ LI +P 
Sbjct: 237 LGLSVGCVCSVKWVGLFITVIAGIYTVVDLFSYHYDKELSRLSYYKHWLVRIIDLIVIPF 296

Query: 288 AVFMICFKLHFDLLWHSGTGDANMPSLFQAGLVGSDVGGGPRDVAIGSSVSIKNQALSGA 347
            V++ CFK+HF +L  SGTGDA   +LFQ  L G+ +  GPR+VA GS V+I++  LS  
Sbjct: 297 LVYLFCFKIHFAILHKSGTGDAATNTLFQVNLDGNKIEIGPRNVAFGSEVTIRSHGLSPN 356

Query: 348 LLHSHVQTYPEGSNQQQVTAYSYKDANNNWVFHRVREESLW----DINETDIEYVVDGAV 403
           LLHSHVQ YP GS Q QVT Y + D NNNWV    RE  L      + +   + + +G+ 
Sbjct: 357 LLHSHVQLYPFGSGQHQVTGYGHSDDNNNWVIKYPREGGLKAAENGLQDVQSDLLTEGSE 416

Query: 404 YRLVHANTQKNLHTHSIAAPVDKKNWEVSGYGNHTIGDAKDYWVLEIVDQKGSENT---- 459
            RLVH NT  NLH+H I A V K ++EVSGYG+  IGD KD WV+EIV Q  S+N+    
Sbjct: 417 IRLVHKNTGANLHSHEIPAHVSKGSFEVSGYGDEEIGDIKDDWVVEIVQQLDSDNSSFPK 476

Query: 460 ---TQVHPLTTSFRLRNKELDCYLAQTGNHLPEWGFRQHEISCVKDPFRRDKRTWWNVES 516
              + +HP++TSFRLR+K L CYLA TG   P WGF+Q EI C     +RDK TWWN+E 
Sbjct: 477 EDPSLLHPISTSFRLRHKYLGCYLATTGLAYPAWGFKQAEIVCKHTWMKRDKSTWWNIED 536

Query: 517 HENEKLPTPEEFKYPGSGFLKDFIHLNLAMMATNNALVPESDKFDYLASSAWEWPTLHVG 576
           H N  L   E +  P S F  DFI +N AM ++NNALVP+ DK+D LAS AW+WPTLHVG
Sbjct: 537 HWNPNLEKSEGYVPPKSKFWPDFILINFAMASSNNALVPDEDKYDSLASEAWQWPTLHVG 596

Query: 577 LRLCGWGDNNPKYFLLGTPVTTWASSVAVISFMILFVVLLLRWQRQYNDFSNKDDFNLFL 636
           LR+C W ++  KYFLLG+P  TW S++++  F+++ + L  +WQRQ  + +  ++ +   
Sbjct: 597 LRMCSWSNDTVKYFLLGSPFQTWLSTLSLFIFVLILLRLAFKWQRQTVNLTG-NELSEIS 655

Query: 637 MGGFYPILGWGLHFVPFVIMSRVTYVHHYLPALYFALIILTYIIDAT-TKRWMKSKCGSI 695
           M G  P L W LH++PFV+M RVTYVHHY+PALYFA+++  ++++    KR+        
Sbjct: 656 MQGVLPFLAWLLHYLPFVLMGRVTYVHHYVPALYFAILVFGFVLETCLPKRYF------- 708

Query: 696 MRLVVFAISIASVVGCFWYFSPISFGMTGPAINY 729
           +  +V+    A  +  +  FSPI+ G+ GPA N+
Sbjct: 709 LNYIVYTALYAGCIYIYVLFSPIAQGIDGPAHNF 742

>YGR199W (PMT6) [2149] chr7 (897505..899784) Protein with similarity
           to O-mannosyltransferases Pmt1p, Pmt2p, Pmt3p, Pmt4p and
           Pmt5p [2280 bp, 759 aa]
          Length = 759

 Score =  661 bits (1706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/749 (44%), Positives = 472/749 (63%), Gaps = 32/749 (4%)

Query: 4   TGFQGSEKSDAELKAR----KQTSVDDVLIEEKEDTSKLKDAKVSQ-----SPLLQLEAY 54
           TGF   +  D  L+ R     + +  D+  E+ +   +L++   ++     + L  L   
Sbjct: 7   TGFSSIDTEDENLRERYVNQPKANASDIQDEQLDCFEQLEEKHRTKKNEEYTALKILRDV 66

Query: 55  LMPLVFTGLALFVRMYRIGINGNVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSG 114
           + PL+ T  + ++R   I  N  VVWDEAHFGKFGSYY++HE+YHDVHPPLGKML+ LS 
Sbjct: 67  IGPLLLTITSFYLRFQHIDQNNYVVWDEAHFGKFGSYYIKHEYYHDVHPPLGKMLIALSE 126

Query: 115 YLAGYNGSFDFESGHEYPEYVDFVKMRLFNASFSAMCVPLAYFTAKAIGFSLPAVWLFTC 174
           ++AG++G FDF S + YPE V+F  MR FNA+F A+C P+A+FTAK +GF+   V+L   
Sbjct: 127 WMAGFDGQFDFSSNNAYPENVNFKLMRQFNATFGALCTPVAFFTAKWMGFNYFTVYLIAT 186

Query: 175 MVLFENSYSTLGRFILLDSMLLFFTVASVFSFVMFHNQRSRPFSRKWWKWLLLTGINLGC 234
           MV  E+SY  L +FILLDSMLLFF++ +    +  +  R +  ++KW  W+LLTG+++GC
Sbjct: 187 MVTLEHSYIVLSKFILLDSMLLFFSMTTFACMIKLYTLRKQQMTKKWSLWMLLTGLSIGC 246

Query: 235 TISVKMVGLFVITLVGIYTVIDLLQMLNEKKMSWKSYTGHWLARIVALICVPMAVFMICF 294
             SVK VGLF+  +VG+YT I+L  +  +K++    Y  HWL RI+ LI +P  +++ CF
Sbjct: 247 VCSVKWVGLFITVVVGLYTCIELFLLYCDKELPRIKYYKHWLIRIINLIVIPFLIYLYCF 306

Query: 295 KLHFDLLWHSGTGDANMPSLFQAGLVGSDVGGGPRDVAIGSSVSIKNQALSGALLHSHVQ 354
           K+HF LL+ SGTGD+   +LFQ  L G+ +  GPRDVA GS ++I++  LS  LLHSH+Q
Sbjct: 307 KIHFVLLYKSGTGDSTTNTLFQINLEGTQIEAGPRDVAFGSELTIRSHGLSPNLLHSHIQ 366

Query: 355 TYPEGSNQQQVTAYSYKDANNNWVFHRVREESL-WDINET---DIEYVVDGAVYRLVHAN 410
            YPEGS Q+Q+T Y + D+NN W F   R   L  D N T    I  + DG   RL H N
Sbjct: 367 VYPEGSGQRQITGYGFADSNNVWKFEFSRSSGLELDQNGTLNGKIIPITDGVEVRLSHKN 426

Query: 411 TQKNLHTHSIAAPVDKKNWEVSGYGNHTIGDAKDYWVLEIVDQKGS-------ENTTQVH 463
           T  NLH+H + + V + N+EVSGYG+ ++GD KD W++EIV Q  S       EN+T +H
Sbjct: 427 TGSNLHSHDVPSHVSRGNYEVSGYGSQSVGDEKDDWIVEIVKQMDSPNPVYSNENSTILH 486

Query: 464 PLTTSFRLRNKELDCYLAQTGNHLPEWGFRQHEISCVKDPFRRDKRTWWNVESHENEKLP 523
           P++T FRLR+K L CYLA TG   P WGF+Q EI C     RRDK TWWNVE H N  L 
Sbjct: 487 PVSTFFRLRHKVLGCYLASTGLTYPAWGFKQAEIVCKDSWSRRDKSTWWNVEDHWNHNLE 546

Query: 524 TPEEFKYPGSGFLKDFIHLNLAMMATNNALVPESDKFDYLASSAWEWPTLHVGLRLCGWG 583
           T E++  P S F  DFI  N AM ++NNALVP+ DK+D L+S AWEWPTLH GLR+C W 
Sbjct: 547 TAEDYVPPKSNFWTDFILTNFAMASSNNALVPDEDKYDSLSSDAWEWPTLHKGLRMCSWA 606

Query: 584 DNNPKYFLLGTPVTTWASSVAVISFMILFVVLLLRWQRQYNDFSNKDDFNLFLMGGFYPI 643
               +Y+L+G+P  TW S+V++I F  + + +L RW+RQ    S+   + + + G F P 
Sbjct: 607 GYITRYYLMGSPFNTWISTVSLIIFPFIILFILYRWRRQTLYLSDDQIWQITIQGIF-PF 665

Query: 644 LGWGLHFVPFVIMSRVTYVHHYLPALYFALIILTYIIDATTKRWMKSKCGSIMRLVVFAI 703
           + W  H++PF +M RVTYVHHY+PALYFA+++  +++D T  R        +  +V + I
Sbjct: 666 ISWMTHYLPFAMMGRVTYVHHYVPALYFAMLVFGFVLDFTLTR--------VHWMVKYPI 717

Query: 704 SIASVVGCFW---YFSPISFGMTGPAINY 729
            ++   GC +    F+PI  GM G    Y
Sbjct: 718 YLSLFGGCIYIYNLFAPICQGMHGDKAEY 746

>CAGL0K00979g complement(97306..99498) similar to sp|P42934
           Saccharomyces cerevisiae YGR199w
           Dolichyl-phosphate-mannose--protein mannosyltransferase
           6, hypothetical start
          Length = 730

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/720 (47%), Positives = 457/720 (63%), Gaps = 25/720 (3%)

Query: 25  DDVLIEEKEDTSKLKDAKVSQSPLLQLEAYLMPLVFTGLALFVRMYRIGINGNVVWDEAH 84
           D+   E KE+T              +    +  L FT L+  +R   I  N +VVWDEAH
Sbjct: 8   DEKTTETKENTPDQTKVVPRACNFAKYRDLIACLGFTVLSFVLRFQGIDKNNSVVWDEAH 67

Query: 85  FGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSFDFESGHEYPEYVDFVKMRLFN 144
           FGKFGSYY+RHEFYHDVHPPLGKML+ LS +LAG++G FDFESGH+YP+ V+F  MR FN
Sbjct: 68  FGKFGSYYIRHEFYHDVHPPLGKMLIALSEWLAGFDGEFDFESGHQYPDGVNFKFMRQFN 127

Query: 145 ASFSAMCVPLAYFTAKAIGFSLPAVWLFTCMVLFENSYSTLGRFILLDSMLLFFTVASVF 204
           A+F A+C P+ +FTAK +  S P V+L T MV  E+S+  L +FILLDSMLLFFT  +  
Sbjct: 128 ATFGALCTPVVFFTAKTMNLSWPIVYLVTLMVTLEHSFIALSKFILLDSMLLFFTATTFA 187

Query: 205 SFVMFHNQRSRPFSRKWWKWLLLTGINLGCTISVKMVGLFVITLVGIYTVIDLLQMLNEK 264
             V     R    +R+W  WLLLTG+++GC  SVK VGLF+  +VG++T+IDLL+    K
Sbjct: 188 CMVKLIQLRGCQLTRQWLWWLLLTGLSIGCVCSVKWVGLFITLVVGLFTIIDLLEHYWNK 247

Query: 265 KMSWKSYTGHWLARIVALICVPMAVFMICFKLHFDLLWHSGTGDANMPSLFQAGLVGSDV 324
           K S K Y  HW+ RI+ LI +P  V++ CFK+HF LL+ SGTGDA+  SLFQ  L G+ +
Sbjct: 248 KESRKIYYKHWILRIINLIIIPFLVYLFCFKIHFLLLYKSGTGDASTNSLFQVNLEGTQI 307

Query: 325 GGGPRDVAIGSSVSIKNQALSGALLHSHVQTYPEGSNQQQVTAYSYKDANNNWV--FHRV 382
              PR V  GS V+I++  LS  LLHSHVQ YP+GS Q+QVT Y + D NNNW+  F R 
Sbjct: 308 QNSPRTVMYGSEVTIRSHGLSPNLLHSHVQLYPDGSRQRQVTGYGHSDGNNNWMIKFGRT 367

Query: 383 REESLWDINET---DIEYVVDGAVYRLVHANTQKNLHTHSIAAPVDKKNWEVSGYGNHTI 439
               L + N+    ++  V DG   RL H     NLH+H+I++ V K N+EVSGYG+  +
Sbjct: 368 TGRYLDEDNKRLNGELVPVRDGDTIRLFHVRMGCNLHSHTISSHVSKGNYEVSGYGSEEV 427

Query: 440 GDAKDYWVLEIVDQKGSENTT-------QVHPLTTSFRLRNKELDCYLAQTGNHLPEWGF 492
           GD KD W++EI++Q  S NT         +HP++T FRLR+K+L CYLA TG   P WGF
Sbjct: 428 GDEKDDWIIEIMEQLDSANTNFGKEDNEVLHPISTMFRLRHKDLGCYLASTGLSYPTWGF 487

Query: 493 RQHEISCVKDPFRRDKRTWWNVESHENEKLPTPEEFKYPGSGFLKDFIHLNLAMMATNNA 552
            Q EI C     +RDK TWWNVE H N++L   EE+  P S F  DFI +N AM ++NNA
Sbjct: 488 HQAEIVCKYSWGKRDKSTWWNVEDHWNDQLVVDEEYVPPKSKFWTDFILINFAMASSNNA 547

Query: 553 LVPESDKFDYLASSAWEWPTLHVGLRLCGWGDNNPKYFLLGTPVTTWASSVAVISFMILF 612
           LVP+ DK+DYLAS AWEWP LH GLRLCGW     +Y+LLG+P  TW SS+A++  ++L 
Sbjct: 548 LVPDEDKYDYLASKAWEWPILHKGLRLCGWSSAGVRYYLLGSPFNTWLSSIALLVNILLG 607

Query: 613 VVLLLRWQRQYNDFSNKDDFNLFLMGGFYPILGWGLHFVPFVIMSRVTYVHHYLPALYFA 672
           +V+ ++W+RQ +   N++          +P L W  +F+P+V+M RVTYVHHY+PALYFA
Sbjct: 608 MVVAIKWRRQ-SIVINEESCWKLFTLLLFPFLAWLANFMPYVMMGRVTYVHHYMPALYFA 666

Query: 673 LIILTYIIDATTKRWMKSKCGSIMRLVVFAISIASVVGC---FWYFSPISFGMTGPAINY 729
           +I    I +     +   K           ++  S+VGC   +WYF+PI  G+ G   +Y
Sbjct: 667 IIAFGSITEYLLADYCTVKA---------FLAFLSMVGCTYIYWYFAPICQGLHGIGSHY 717

>Scas_408.1*
          Length = 391

 Score =  353 bits (907), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 177/382 (46%), Positives = 254/382 (66%), Gaps = 12/382 (3%)

Query: 2   SSTGFQGSEKSDAELKARKQTSVD-DVLIEEKEDTSKLKD-------AKVSQSPLLQLEA 53
           S+     ++ S  E KA  QTS + D+   E +D+ + K        AK+S S    + +
Sbjct: 8   STVSIHPTDSSLRERKAVTQTSTELDIKQHEPDDSKQNKSRYPYVTTAKISSS----MRS 63

Query: 54  YLMPLVFTGLALFVRMYRIGINGNVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLS 113
           Y+ PL+ T L+  +R + IG N +VVWDEAHFGKFGSYY+ HEFYHDVHPPLGKML+ LS
Sbjct: 64  YIGPLLLTILSFQLRFHDIGKNNHVVWDEAHFGKFGSYYITHEFYHDVHPPLGKMLIALS 123

Query: 114 GYLAGYNGSFDFESGHEYPEYVDFVKMRLFNASFSAMCVPLAYFTAKAIGFSLPAVWLFT 173
            YLAG++G F+F+S   YPE V+++ MR FNA F A+CVP+  FT +++GF+    +L T
Sbjct: 124 EYLAGFDGHFNFDSNEAYPEEVNYIFMRQFNAMFGALCVPVTLFTTRSMGFNWLTSYLVT 183

Query: 174 CMVLFENSYSTLGRFILLDSMLLFFTVASVFSFVMFHNQRSRPFSRKWWKWLLLTGINLG 233
            MV  E+SY  L +FILLDS+LLFFT+ +    V  +  + R  +++W  W+LLTG+++G
Sbjct: 184 LMVTLEHSYIVLSKFILLDSILLFFTLTTFACMVKLYTLKKRQLTKQWSLWMLLTGLSVG 243

Query: 234 CTISVKMVGLFVITLVGIYTVIDLLQMLNEKKMSWKSYTGHWLARIVALICVPMAVFMIC 293
           C  SVK VGLF+  +VG++T+++L     +K +    Y  HW+ RI+ LI +P  ++M C
Sbjct: 244 CVCSVKWVGLFITIIVGLFTIMELFTHHYDKTLPRVKYYKHWMIRIIDLIIIPFLIYMFC 303

Query: 294 FKLHFDLLWHSGTGDANMPSLFQAGLVGSDVGGGPRDVAIGSSVSIKNQALSGALLHSHV 353
           FK+HF LL+ SGTGD+   +LFQ  L G+ +  GPRDV  GS V+I++  LS  LLHSHV
Sbjct: 304 FKIHFTLLYKSGTGDSATNTLFQVNLEGTTIENGPRDVMYGSEVTIRSHGLSPNLLHSHV 363

Query: 354 QTYPEGSNQQQVTAYSYKDANN 375
           Q YP+GS Q+Q+T Y + D+++
Sbjct: 364 QLYPDGSRQRQITGYGHSDSSS 385

>CAGL0L07216g complement(799529..802105) similar to sp|P33775
           Saccharomyces cerevisiae YDL095w PMT1
           mannosyltransferase or sp|P52867 Saccharomyces
           cerevisiae YDL093w, hypothetical start
          Length = 858

 Score =  365 bits (937), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 248/718 (34%), Positives = 366/718 (50%), Gaps = 37/718 (5%)

Query: 15  ELKARKQTSVDDVLIEEKEDTSKLKDAKVSQSPLLQLEAYLMPLVFTGLALFVRMYRIGI 74
           E+K  K      +  E   DT+KL+  K        L+  LM  +   +  FVR+Y++  
Sbjct: 29  EVKINKGPLRPYIDFEGDYDTAKLRTVKT-------LKEKLMVAILLIITAFVRLYKLSW 81

Query: 75  NGNVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSFDFES-GHEYPE 133
             +VV+DE HFG F S Y++ +F+ DVHPPL KML    G LAGY G F F+  G EYP+
Sbjct: 82  PSSVVFDEVHFGGFASKYIKGDFFMDVHPPLAKMLFAGVGALAGYTGDFSFKPIGEEYPD 141

Query: 134 YVDFVKMRLFNASFSAMCVPLAYFTAKAIGFSLPAVWLFTCMVLFENSYSTLGRFILLDS 193
            V F  MRLF+AS     V + Y T +A G  L   +LF  +  FENS+ T+ R+ILLD+
Sbjct: 142 TVPFYTMRLFSASLGVFTVLMLYLTLRASGVRLGVAYLFALVFAFENSFVTISRYILLDA 201

Query: 194 MLLFFTVASVFSFVMFHNQRSRPFSRKWWKWLLLTGINLGCTISVKMVGLFVITLVGIYT 253
            L+ F  A+V+S+       +  F  +  K LL TGI LG   S K VGLF +  VG+  
Sbjct: 202 PLICFIAAAVYSYKKSELYPTNSF--RALKSLLATGIALGLASSSKWVGLFTVAWVGLLC 259

Query: 254 VIDLLQMLNEKKMSWKSYTGHWLARIVALICVPMAVFMICFKLHFDLLWHSGTGDANMPS 313
           V  L  M+ +   S  +     + ++V L+ VP+ +++  F +HF  L H G+G +  PS
Sbjct: 260 VWKLWFMIGDLNKSPCTIVKAAIGKLVLLLGVPILLYVAFFYVHFQALIHDGSGSSFFPS 319

Query: 314 LFQAGLVGSDVGGG-PRDVAIGSSVSIKNQALSGALLHSHVQTYPEGSNQQQVTAYSYKD 372
            F+A L G+ +      DV +GS V++K+ +  G  LHSH   YP GS QQQ+T Y + D
Sbjct: 320 EFRATLEGNQIPSDVVYDVGVGSIVTLKHLSTEGGYLHSHSHAYPTGSEQQQITLYPFLD 379

Query: 373 ANNNWVFHRVREESLWDINETDIEYVVDGAVYRLVHANTQKNLHTHSIAAPV-DKKNW-- 429
            NN WV  R     L   +  D   + +G    L+H  T   LH+H    PV +  +W  
Sbjct: 380 DNNKWVIER---SHLPGASLKDFIGLKNGESISLLHLATGVRLHSHDHKPPVSESADWQK 436

Query: 430 EVSGYGNHTI-GDAKDYWVLEIVDQKGSE---NTTQVHPLTTSFRLRNKELDCYLAQTGN 485
           EVSGYG     GD  D+W +EI DQ  S+      +V  + T F+LR+    CYL     
Sbjct: 437 EVSGYGYLGFTGDINDHWTIEI-DQSSSKPGIAQHEVRAIDTKFKLRHAT-GCYLFSHEV 494

Query: 486 HLPEWGFRQHEISCVKDPFRRDKRTWWNVESHENEKLP--TPEEFKYPGSGFLKDFIHLN 543
            LP+WGF Q E++C      + +   W +E  EN +LP  TP    Y    F++ FI  +
Sbjct: 495 KLPKWGFDQQEVTCATQ--GKPELLLWYIEGSENPQLPENTP-RISYKPMNFIEKFIENH 551

Query: 544 LAMMATNNALVPESDKFDYLASSAWEWPTLHVGLRLCGWGDNNPKYFLLGTPVTTWASSV 603
             M   N  L        Y  S A+EWP +  G+    WG+++ K +LLG  VT WA S 
Sbjct: 552 KKMWKINKGLTGTH----YYESLAYEWPLMRRGIGY--WGEHHRKIYLLGNAVTWWAVSA 605

Query: 604 AVISFMILFVVLLLRWQRQYNDFSNKDDFNLFLMGGFYPILGWGLHFVPFVIMSRVTYVH 663
            ++ +  +       +        +K+  N  +    Y +LG+ +H+VPF +M R  ++H
Sbjct: 606 FILVYAAILAFEAGSFLVGKPILQDKNVINFHVQVLHY-LLGFAIHYVPFFLMGRQLFLH 664

Query: 664 HYLPALYFALIILTYIIDATTKRWMKSKCGSIMRLVVFAISIASVVGCFWYFSPISFG 721
           HYLPA YF ++ L +  D       K++  +   L++  +  A+ +  F   SPI++G
Sbjct: 665 HYLPAYYFGILALAHAFDIIITFVCKNRKQAAYALLI--LFTAASIYFFHAHSPIAYG 720

>KLLA0E01342g complement(134691..137207) similar to sp|P33775
           Saccharomyces cerevisiae YDL095w PMT1
           mannosyltransferase, start by similarity
          Length = 838

 Score =  346 bits (887), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 242/733 (33%), Positives = 363/733 (49%), Gaps = 47/733 (6%)

Query: 17  KARKQTSVDDVLIEEKEDTSKLKDAKVSQSPLLQLEAYLMP---------------LVFT 61
           K +  T V D ++    D   + D +V + PL        P               LV  
Sbjct: 3   KTKTSTKVQDCVL----DVDSVGDIQVEKGPLRPFLVTEPPKNLKSIRTMTSSKERLVVI 58

Query: 62  GLALF---VRMYRIGINGNVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAG 118
            LA+    VR++ +    +VV+DE HFGKF + Y++  F+ DVHPPL KML    G LAG
Sbjct: 59  ALAVIASVVRLWNLSDPNSVVFDEVHFGKFAAKYIKGIFFTDVHPPLAKMLFAGIGSLAG 118

Query: 119 YNGSFDFES-GHEYPEYVDFVKMRLFNASFSAMCVPLAYFTAKAIGFSLPAVWLFTCMVL 177
           + G F+F+  G  +P    +  MR F+A      V L YFT +A G  +   ++ + M  
Sbjct: 119 FTGDFEFKDIGLAFPASTPYFAMRFFSAFLGLATVLLMYFTLRASGIRIWIAFVASLMFA 178

Query: 178 FENSYSTLGRFILLDSMLLFFTVASVFSFVMFHNQRSRPFSRKWWKWLLLTGINLGCTIS 237
            ENS+ T+ R+ILLD+ L+FF  A+ +S+  +    S  F+   +K LL TG++LG  +S
Sbjct: 179 LENSFVTISRYILLDAPLIFFIAAAAYSYKKYEIHPSESFNS--YKALLATGLSLGLAVS 236

Query: 238 VKMVGLFVITLVGIYTVIDLLQMLNEKKMSWKSYTGHWLARIVALICVPMAVFMICFKLH 297
            K VGLF I  VG  ++  L   + + K   +S   H + +   L+  P A+++  F +H
Sbjct: 237 SKWVGLFTIAWVGALSLFKLWFDIGDLKKPVQSTLRHTVVKATLLLAAPAALYLFFFYIH 296

Query: 298 FDLLWHSGTGDANMPSLFQAGLVGSDVGGG-PRDVAIGSSVSIKNQALSGALLHSHVQTY 356
           F  L ++  G     S F++ L+G+++    P DV +GSSVSI++    G  LHSH   Y
Sbjct: 297 FQTLIYNSDGAGFFSSAFRSTLIGNNIPSNIPYDVGVGSSVSIRHTGTMGGYLHSHKHIY 356

Query: 357 PEGSNQQQVTAYSYKDANNNWVFHRVREESLWDINETDIEYVVDGAVYRLVHANTQKNLH 416
             GS QQQVT YS+ DANN+WV     +  +  I ET  E + DG   RL H  T + LH
Sbjct: 357 ETGSKQQQVTLYSHLDANNDWVIELYDQPEV--IPET-FEGLKDGTKIRLRHRLTDRRLH 413

Query: 417 THSIAAPV-DKKNW--EVSGYG-NHTIGDAKDYWVLEIVDQKGSENTTQ--VHPLTTSFR 470
           +H    PV +  +W  EVS YG ++  GDA D WV+EI  +  +    Q  V  L T FR
Sbjct: 414 SHDHKPPVSESSDWQKEVSAYGADNFTGDANDDWVIEIDHEASAPGEAQEYVKALDTKFR 473

Query: 471 LRNKELDCYLAQTGNHLPEWGFRQHEISCVKDPFRRDKRTWWNVESHENEKLPT-PEEFK 529
           LR+    C L      LP+WGF Q E++C          T W VE + N  LP    +  
Sbjct: 474 LRHAMTGCRLFSHEVKLPKWGFEQQEVTCASSGV--PSLTLWYVEHNSNPLLPEDAAKIS 531

Query: 530 YPGSGFLKDFIHLNLAMMATNNALVPESDKFDYLASSAWEWPTLHVGLRLCGWGDNNPKY 589
           Y    FL+ FI  +  M   N  L     +     S    WP L  G+    W  ++ + 
Sbjct: 532 YQTPTFLEKFIESHQRMWHINKNL----KEHHVYQSDPATWPLLLRGISY--WSQDHKQI 585

Query: 590 FLLGTPVTTWASSVAVISFMILFVVLLLRWQRQYNDFSNKDDFNLFLMGGFYPILGWGLH 649
           +LLG  V  W+ +  +  F+++ V  LL WQ   +   +K   N F +  F  +LGWGLH
Sbjct: 586 YLLGNAVVWWSVTAFIGVFVLVIVAELLAWQLGKSILQDKHVLN-FHIQTFQYLLGWGLH 644

Query: 650 FVPFVIMSRVTYVHHYLPALYFALIILTYIIDATTKRWMKSKCGSIMRLVVFAISIASVV 709
           + P  +M R  ++HHYLPA YF ++   + ++       K+K      +V+    +A+  
Sbjct: 645 YAPSFLMGRQLFLHHYLPAYYFGILAFAHALEIIVSYVFKNKKTVGYGVVI--TFLAAAT 702

Query: 710 GCFWYFSPISFGM 722
             F+ + P+ +G+
Sbjct: 703 AFFYVYKPLIYGL 715

>YDL095W (PMT1) [773] chr4 (287059..289512) Mannosyltransferase
           (dolichyl phosphate-D-mannose:protein
           O-D-mannosyltransferase), first step in O-glycosylation
           [2454 bp, 817 aa]
          Length = 817

 Score =  344 bits (883), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 245/727 (33%), Positives = 355/727 (48%), Gaps = 37/727 (5%)

Query: 14  AELKARKQTSVDDVLIEEKEDTSKLK-----DAKVSQSPLLQLEAYLMPLVFTGLALF-- 66
           +E K  K+   DD + E       ++     D     + L  +      L+   LA+F  
Sbjct: 2   SEEKTYKRVEQDDPVPELDIKQGPVRPFIVTDPSAELASLRTMVTLKEKLLVACLAVFTA 61

Query: 67  -VRMYRIGINGNVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSFDF 125
            +R++ +    +VV+DE HFG F S Y+R  ++ DVHPPL KML      L G+ G FDF
Sbjct: 62  VIRLHGLAWPDSVVFDEVHFGGFASQYIRGTYFMDVHPPLAKMLYAGVASLGGFQGDFDF 121

Query: 126 ES-GHEYPEYVDFVKMRLFNASFSAMCVPLAYFTAKAIGFSLPAVWLFTCMVLFENSYST 184
           E+ G  +P    +V MR F+AS  A+ V L Y T +  G  +    +       ENSY T
Sbjct: 122 ENIGDSFPSTTPYVLMRFFSASLGALTVILMYMTLRYSGVRMWVALMSAICFAVENSYVT 181

Query: 185 LGRFILLDSMLLFFTVASVFSFVMFHNQRSRPFSRKWWKWLLLTGINLGCTISVKMVGLF 244
           + R+ILLD+ L+FF  A+V+SF  +    +   S   +K LL TGI LG   S K VGLF
Sbjct: 182 ISRYILLDAPLMFFIAAAVYSFKKYEMYPAN--SLNAYKSLLATGIALGMASSSKWVGLF 239

Query: 245 VITLVGIYTVIDLLQMLNEKKMSWKSYTGHWLARIVALICVPMAVFMICFKLHFDLLWHS 304
            +T VG+  +  L  M+ +   S KS      A++  L+ VP A++++ F +HF  L   
Sbjct: 240 TVTWVGLLCIWRLWFMIGDLTKSSKSIFKVAFAKLAFLLGVPFALYLVFFYIHFQSLTLD 299

Query: 305 GTGDANMPSLFQAGLVGSDVGGG-PRDVAIGSSVSIKNQALSGALLHSHVQTYPEGSNQQ 363
           G G +     F++ L  + +      DV IGS +S+++ +  G  LHSH   YP GS QQ
Sbjct: 300 GDGASFFSPEFRSTLKNNKIPQNVVADVGIGSIISLRHLSTMGGYLHSHSHNYPAGSEQQ 359

Query: 364 QVTAYSYKDANNNWV--FHRVREESLWDINETDIEYVVDGAVYRLVHANTQKNLHTHSIA 421
           Q T Y + DANN+W+   +    ESL     T  + + DG   RL H  T+  LH+H   
Sbjct: 360 QSTLYPHMDANNDWLLELYNAPGESL-----TTFQNLTDGTKVRLFHTVTRCRLHSHDHK 414

Query: 422 APV-DKKNW--EVSGYGNHTI-GDAKDYWVLEIVDQKGSENTTQ--VHPLTTSFRLRNKE 475
            PV +  +W  EVS YG     GDA D WV+EI  +  +    Q  V  L T FRLR+  
Sbjct: 415 PPVSESSDWQKEVSCYGYSGFDGDANDDWVVEIDKKNSAPGVAQERVIALDTKFRLRHAM 474

Query: 476 LDCYLAQTGNHLPEWGFRQHEISCVKDPFRRDKRTWWNVESHENEKLPT-PEEFKYPGSG 534
             CYL      LP WGF Q E++C      R   T W VE++ N  LP   +   Y  + 
Sbjct: 475 TGCYLFSHEVKLPAWGFEQQEVTCASS--GRHDLTLWYVENNSNPLLPEDTKRISYKPAS 532

Query: 535 FLKDFIHLNLAMMATNNALVPESDKFDYLASSAWEWPTLHVGLRLCGWGDNNPKYFLLGT 594
           F+  FI  +  M   N  LV E   ++   +S   WP L  G+    WG+NN   +LLG 
Sbjct: 533 FISKFIESHKKMWHINKNLV-EPHVYESQPTS---WPFLLRGISY--WGENNRNVYLLGN 586

Query: 595 PVTTWASSVAVISFMILFVVLLLRWQRQYNDFSNKDDFNLFLMGGFYPILGWGLHFVPFV 654
            +  WA +  +  F ++ +  L  WQ       +    N  +    Y +LG+ +H+ P  
Sbjct: 587 AIVWWAVTAFIGIFGLIVITELFSWQLGKPILKDSKVVNFHVQVIHY-LLGFAVHYAPSF 645

Query: 655 IMSRVTYVHHYLPALYFALIILTYIIDATTKRWMKSKCGSIMRLVVFAISIASVVGCFWY 714
           +M R  ++HHYLPA YF ++ L + +D       +SK    M   V    +A+ V  F  
Sbjct: 646 LMQRQMFLHHYLPAYYFGILALGHALDIIVSYVFRSK--RQMGYAVVITFLAASVYFFKS 703

Query: 715 FSPISFG 721
           FSPI +G
Sbjct: 704 FSPIIYG 710

>Kwal_23.3623
          Length = 876

 Score =  336 bits (861), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 235/730 (32%), Positives = 360/730 (49%), Gaps = 46/730 (6%)

Query: 8   GSEKSDAELKARKQTSVDDVLIEEKEDTSKLKDAKVSQSPLLQLEAYLMPLVFTGLALFV 67
           GSE    EL A +   V   ++ E   T K      S    + + A     V TG+   +
Sbjct: 56  GSEDPVPEL-AIQNGPVRPYIVTEPPQTLKESRTPTSVKEKVTIAALA---VITGV---I 108

Query: 68  RMYRIGINGNVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSFDFES 127
           R+Y +    +VV+DE HFG F + Y++  F+ DVHPPL KML    G +AG+ G FDFE 
Sbjct: 109 RLYGLSNPNSVVFDEVHFGGFAAKYIKGIFFMDVHPPLAKMLFAAIGSIAGFTGDFDFEK 168

Query: 128 -GHEYPEYVDFVKMRLFNASFSAMCVPLAYFTAKAIGFSLPAVWLFTCMVLFENSYSTLG 186
            G  +PE   +  MRLF A    + V L Y T +  G  +P  ++ +     ENS+ T+ 
Sbjct: 169 IGQHFPESTPYYFMRLFPALLGTLTVLLMYLTLRCSGVRIPIAFIASLCFAIENSFVTIS 228

Query: 187 RFILLDSMLLFFTVASVFSFVMFHNQRSRPFSRKWW---KWLLLTGINLGCTISVKMVGL 243
           R+ILLD+ LLFF  ++V+SF     ++   + +  W   K LL  G+ LG  +S K VGL
Sbjct: 229 RYILLDAPLLFFIASAVYSF-----KKYEIYPQGSWGSLKALLSGGLALGMALSSKWVGL 283

Query: 244 FVITLVGIYTVIDLLQMLNEKKMSWKSYTGHWLARIVALICVPMAVFMICFKLHFDLLWH 303
           F I  VG+  +  L  M+ +      S       +++  + +P+A++ + F +HF+ L  
Sbjct: 284 FTIAWVGVLCIWRLWFMVGDLSKPLSSTLKEASRKLMFFLALPLALYAVFFYVHFETLTI 343

Query: 304 SGTGDANMPSLFQAGLVGSDVGGGPR----DVAIGSSVSIKNQALSGALLHSHVQTYPEG 359
           +  G     S F+  L G+ +   P+    DV IGS++S+++ A  G  LHSH   Y +G
Sbjct: 344 NSDGAGFFSSAFRTTLHGNTI---PKDILADVGIGSTISMRHVATMGGYLHSHNHMYEKG 400

Query: 360 SNQQQVTAYSYKDANNNWVFHRVREESLWDINETDIEYVVDGAVYRLVHANTQKNLHTHS 419
           S QQQVT Y + D NN+WV     +    +   T  E + DG V RL HA TQ+ LH+H 
Sbjct: 401 SQQQQVTLYPHLDGNNDWVIELPDQP---NKAVTSFEGLKDGTVIRLKHAITQRRLHSHD 457

Query: 420 IAAPV-DKKNW--EVSGYGNHTI-GDAKDYWVLEIVDQKGS---ENTTQVHPLTTSFRLR 472
             APV +  +W  EVS YG     GD  D W +EI DQ  S   E   +V  L T FRL+
Sbjct: 458 HKAPVSESADWQKEVSCYGFEDFEGDGNDDWTIEI-DQDASEPGEAQKRVKALDTKFRLK 516

Query: 473 NKELDCYLAQTGNHLPEWGFRQHEISCVKDPFRRDKRTWWNVESHENEKLPTPEE-FKYP 531
           +  ++C+L      LP+WGF Q E++C      +   T W +E + +  L   +E   Y 
Sbjct: 517 HNIMNCHLFSHEVKLPKWGFEQQEVTCASQ--GKPYLTLWYIEGNSHPLLTGDQERVSYK 574

Query: 532 GSGFLKDFIHLNLAMMATNNALVPESDKFDYLASSAWEWPTLHVGLRLCGWGDNNPKYFL 591
              F +  I  +  M   N  LV E   ++   S    WP L  G+    WG+N+ + +L
Sbjct: 575 KPNFFEKLIESHQRMWHINKNLV-EPHIYE---SKPHSWPFLLRGINY--WGENHKQVYL 628

Query: 592 LGTPVTTWASSVAVISFMILFVVLLLRWQRQYNDFSNKDDFNLFLMGGFYPILGWGLHFV 651
           LG  +  W+ +  +  F  + V  L  WQ       +    N  +    Y +LG+GLH++
Sbjct: 629 LGNAIVWWSVTAFIALFATIVVFELFAWQLGKPILQDSKVVNFHVQVIHY-LLGYGLHYI 687

Query: 652 PFVIMSRVTYVHHYLPALYFALIILTYIIDATTKRWMKSKCGSIMRLVVFAISIASVVGC 711
           P  +M R  ++HHYLPA YF ++   + +D T     + +   ++   V  +  ++VV  
Sbjct: 688 PSFLMGRQLFLHHYLPAYYFGILAFAHALDITVTYVFRKR--EVIGYAVIGVFFSAVVYF 745

Query: 712 FWYFSPISFG 721
           F  +  + +G
Sbjct: 746 FVSYRALIYG 755

>ADR279C [2020] [Homologous to ScYDL095W (PMT1) - SH; ScYDL093W
           (PMT5) - SH] (1177907..1180360) [2454 bp, 817 aa]
          Length = 817

 Score =  314 bits (804), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 214/670 (31%), Positives = 329/670 (49%), Gaps = 26/670 (3%)

Query: 62  GLALFVRMYRIGINGNVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNG 121
           G+A  VR+Y +    +VV+DE HFG + S Y++  F+ DVHPPL KML+  +G LAGY G
Sbjct: 57  GVAAAVRLYNLAYPDSVVFDEVHFGGYASKYIQGAFFLDVHPPLAKMLLAGAGKLAGYGG 116

Query: 122 SFDFES-GHEYPEYVDFVKMRLFNASFSAMCVPLAYFTAKAIGFSLPAVWLFTCMVLFEN 180
            F FE  G +YP  V +  MR   A+   + V L + T +A G      +  + +   EN
Sbjct: 117 EFGFEDIGIDYPATVPYQVMRFLPAALGVLTVLLMFLTLRASGVRKWVAFAVSLVFTVEN 176

Query: 181 SYSTLGRFILLDSMLLFFTVASVFSFVMFHNQRSRPFSRKWWKWLLLTGINLGCTISVKM 240
           S+ T+ R+ILLDS LLFF  A+V+SF      ++   S +++K L  TG+ LG  +S K 
Sbjct: 177 SFVTISRYILLDSPLLFFIAAAVYSFKRLELHQTG--SLQYYKCLAATGMALGLAMSSKW 234

Query: 241 VGLFVITLVGIYTVIDLLQMLNEKKMSWKSYTGHWLARIVALICVPMAVFMICFKLHFDL 300
           VG F    VG+ +V+ L   + +      S       +   L  +PM ++++ F++HF  
Sbjct: 235 VGFFTFAWVGVVSVMQLWFQVGDLNKPVPSILKQSAIKASILCVLPMCLYVLFFRIHFQS 294

Query: 301 LWHSGTGDANMPSLFQAGLVGSDVGGGP-RDVAIGSSVSIKNQALSGALLHSHVQTYPEG 359
           L +      N  S F+  L G  +       V IGS+V+I++    G  LHSH   Y  G
Sbjct: 295 LPNVTDAAGNFSSAFRTTLHGHTIPANIYAGVGIGSTVTIRHIGTMGGYLHSHNHMYQGG 354

Query: 360 SNQQQVTAYSYKDANNNWVFHRVREESLWDINETDIEYVVDGAVYRLVHANTQKNLHTHS 419
           S QQQVT Y + D NN+W           +   T  E +  G   RL H  T   LH+H 
Sbjct: 355 SEQQQVTLYPHLDQNNHWYIEHYNAS---NTVPTTFEGLEHGTKIRLKHVLTGHRLHSHD 411

Query: 420 IAAPVD-KKNW--EVSGYGNHTI-GDAKDYWVLEIVDQKGS--ENTTQVHPLTTSFRLRN 473
              PV    +W  EVSGYG     GDA D W++EI  +K +  E   +V  + T FRLR+
Sbjct: 412 HKPPVSVSSDWQKEVSGYGFPEFEGDANDDWIVEIDQEKSTPGEARERVRAIETKFRLRH 471

Query: 474 KELDCYLAQTGNHLPEWGFRQHEISCVKDPFRRDKRTWWNVESHENEKLPT-PEEFKYPG 532
               C L      LP+WGF Q E++C      R   T W +E + N  L    E+  Y  
Sbjct: 472 AMTGCMLFSHQVKLPKWGFEQQEVTCATQ--GRPDLTLWYIEENTNPLLSEDSEKISYKT 529

Query: 533 SGFLKDFIHLNLAMMATNNALVPESDKFDYLASSAWEWPTLHVGLRLCGWGDNNPKYFLL 592
             F +  + ++  M   N +L   +D   Y  S   +WP L  G+    W  ++ + +LL
Sbjct: 530 PNFWEKLVEIHRKMWHINKSL---TDAHMY-QSDPIQWPFLLRGISY--WSKDSRQVYLL 583

Query: 593 GTPVTTWASSVAVISFMILFVVLLLRWQRQYNDFSNKDDFNLFLMGGFYPILGWGLHFVP 652
           G  V  ++ ++ V+ F ++ V  L  WQ      S+    N  +    Y +LG+ +H++P
Sbjct: 584 GNAVVWYSVTLFVVIFGLICVGELFVWQLGKPILSDTKILNFHIQTIHY-LLGYFIHYLP 642

Query: 653 FVIMSRVTYVHHYLPALYFALIILTYIIDATTKRWMKSKCGSIMRLVVFAISIASVVGCF 712
             +M R  ++HHYLPA YF ++ L + +D       + +  +   + +F +     +  F
Sbjct: 643 SFLMGRQMFLHHYLPAYYFGILALAHGLDGLVTFLNRKRPIAYGLVAMFVL---GSIAFF 699

Query: 713 WYFSPISFGM 722
             +SP+ +G+
Sbjct: 700 VTYSPLVYGL 709

>YDL093W (PMT5) [774] chr4 (289909..292140) Member of the PMT
           O-mannosyltransferases family [2232 bp, 743 aa]
          Length = 743

 Score =  296 bits (758), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 208/671 (30%), Positives = 326/671 (48%), Gaps = 37/671 (5%)

Query: 58  LVFTGLALFVRMYRIGINGNVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLA 117
           L+FT +   VR++ I +  +VV+ E   G F S Y+ + F+ DVHPPL  ML      + 
Sbjct: 53  LIFTAI---VRLHNISLPNSVVFGENEVGTFVSQYVNNIFFTDVHPPLVAMLYATVSSVF 109

Query: 118 GYNGSFDFES-GHEYPEYVDFVKMRLFNASFSAMCVPLAYFTAKAIGFSLPAVWLFTCMV 176
           GY G F++ + G EY   V +V MR F+A+   + V + Y T +  G  +    +     
Sbjct: 110 GYKGLFNYGNIGTEYTANVPYVAMRFFSATLGIVSVLVLYLTLRVSGVKIAVAAICAVCF 169

Query: 177 LFENSYSTLGRFILLDSMLLFFTVASVFSFVMFHNQRSR---PFSRKWWKWLLLTGINLG 233
             ENS+ TL RF L++   +FF   +V+ F     +RS    P S K  K LL   I LG
Sbjct: 170 AIENSFVTLSRFTLIEGPFVFFMACAVYFF-----RRSELYLPNSCKANKSLLAASIALG 224

Query: 234 CTISVKMVGLFVITLVGIYTVIDLLQMLNEKKMSWKSYTGHWLARIVALICVPMAVFMIC 293
             +S K  GLF I   GI  +  +  M+ +      S   +   +   L+ +P  ++ + 
Sbjct: 225 FAVSSKWAGLFTIAWAGIIVLWRVWFMIGDLSRPIGSSIKYMAFQFTCLLAIPAFIYFLI 284

Query: 294 FKLHFDLLWHSGTGDANMPSLFQAGLVGSDV-GGGPRDVAIGSSVSIKNQALSGALLHSH 352
           F +H   L  +G   +  P+ F+  L  ++V      +VA+GS+VS+ +   +G  LHSH
Sbjct: 285 FSVHIKTLNVNGISSSFFPAEFRKTLKYNNVIKETVAEVAVGSAVSLNHVGTAGGYLHSH 344

Query: 353 VQTYPEGSNQQQVTAYSYKDANNNWVFHRVREESLWDINETDIEYVVDGAVYRLVHANTQ 412
           +  YP GS QQQVT Y + D NN W+          + N T  + + DG + +L      
Sbjct: 345 LHNYPAGSMQQQVTLYPHIDQNNKWIIELAEHP---NENVTSFQNLTDGTIIKLRQLKNG 401

Query: 413 KNLHTHSIAAPVDKK-NW--EVSGYGNHTI-GDAKDYWVLEIVDQKGSENTTQVH--PLT 466
             LH+H    PV +  +W  EVS YG     GD  D W++EI  ++      Q H   + 
Sbjct: 402 CRLHSHDHKPPVSQNADWQKEVSCYGYEGFEGDINDDWIIEIDKKRSEPGPAQEHIRAIE 461

Query: 467 TSFRLRNKELDCYLAQTGNHLPEWGFRQHEISCVKDPFRRDKRTWWNVESHENE-KLPTP 525
           T FRL++    CYL      LPEWGF Q E++C    F R+  T W +E +ENE  LP P
Sbjct: 462 TKFRLKHYLTGCYLFSHPEKLPEWGFGQQEVTCAY--FAREDLTSWYIEENENEISLPNP 519

Query: 526 EEFKYPGSGFLKDFIHLNLAMMATNNALVPESDKFDYLASSAWEWPTLHVGLRLCGWGDN 585
           E+  Y    F + F+ ++  M   NN +    D     +S    WP +  G+    W +N
Sbjct: 520 EKVSYKKMSFWQKFVAIHKFMFYLNNYM----DTSHAYSSEPKTWPLMLRGIDF--WNEN 573

Query: 586 NPKYFLLGTPVTTWASSVAVISFMILFVVLLLRWQRQYNDFSNKDDFNLFLMGGFYPILG 645
             + + LG  V  W+ +  + +F+I   V LL W+   N   +K   N F    F  +LG
Sbjct: 574 GREVYFLGNAVLWWSVTAFICTFIIGVAVELLAWKLGVNILRDKHIIN-FHYQVFQYLLG 632

Query: 646 WGLHFVPFVIMSRVTYVHHYLPALYFALIILTYIIDATTKRWMKSKCGSIMRLVVFAISI 705
           +  H+ P+  + +  +++ YLPA YF ++   + +D  +  ++ +K  +   +VV   +I
Sbjct: 633 FAAHYFPYFFVGQKLFLYDYLPAYYFGILAFGHALDLIST-YISNKRNNTGYIVV---AI 688

Query: 706 ASVVGCFWYFS 716
             VV CF++FS
Sbjct: 689 FMVV-CFYFFS 698

>KLLA0B03762g 339424..341742 similar to sp|P46971 Saccharomyces
           cerevisiae YJR143c PMT4
           dolichyl-phosphate-mannose--protein O-mannosyl
           transferase, start by similarity
          Length = 772

 Score =  289 bits (739), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 216/709 (30%), Positives = 334/709 (47%), Gaps = 59/709 (8%)

Query: 55  LMPLVFTGLALFVRMYRIGINGNVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSG 114
           +M  + TGLAL +R++RI     VV+DE HFGKF SYYL   ++ DVHPP+ KML+   G
Sbjct: 63  VMNYLVTGLALVLRLWRISEPREVVFDEVHFGKFASYYLERTYFFDVHPPMAKMLIAAIG 122

Query: 115 YLAGYNGSFDFES-GHEYPE-YVDFVKMRLFNASFSAMCVPLAYFTAKAIGFSLPAVWLF 172
           +L GYNGSF F+  G+ Y   Y  FV  R  +A    + V + + T K + F     ++ 
Sbjct: 123 WLTGYNGSFKFDDIGYSYDTYYAPFVAYRSLSAVLGVLTVSVVFQTMKELNFKAVTCFIA 182

Query: 173 TCMVLFENSYSTLGRFILLDSMLLFFTVASVFSFVMFHN-QRSRPFSRKWWKWLLLTGIN 231
             ++  +N++ T  R ILLD+ML+F    S++ +V F+  Q + PFS +W+ WL LTG +
Sbjct: 183 AFLIAVDNAHVTDTRLILLDAMLIFSIALSIYCYVRFYKLQLTSPFSSEWYLWLYLTGFS 242

Query: 232 LGCTISVKMVGLFVITLVGIYTVIDLLQMLNEKK-MSWKSYTGHWLARIVALICVPMAVF 290
           L   +S K VGL     +G+  V++L Q+L+ +  +S +    H L RI  LI  P  V+
Sbjct: 243 LSMVMSTKYVGLLTYCTIGLAVVVNLWQLLDIRSGLSMRKVVKHTLVRINGLIIFPFVVY 302

Query: 291 MICFKLHFDLLWHSGTGDANMPSLFQAGLVGSDVGGGPRDVAIGSSVSIKNQALSGALLH 350
           +  F  HF +L  SG GDA M S FQ  L+ +      + +     ++IK++A + A LH
Sbjct: 303 LFWFWCHFAILNQSGPGDAFMSSDFQDTLLDAPGAVEIKSINYHDIITIKHKA-TDAFLH 361

Query: 351 SHVQTYPE-------GSNQQQVTAYSYKDANNNWVFHRVREESLWDINETDIEYVVDGAV 403
           SH+  YP         SN QQVT YS++D NN W                 ++     A 
Sbjct: 362 SHLAKYPVRYEDGRISSNGQQVTCYSHEDINNQWEILPPSGSKFKKGAPVKLD-----AD 416

Query: 404 YRLVHANTQKNLHTHSIAAPVDKKNWEVSGYGNHTI-GDAKDYWVLEIVDQKGSENTTQV 462
            RL H  T   L  H +A+P    N EV+        G++ D+ +          +    
Sbjct: 417 IRLRHVGTNTYLLAHDVASPYYPTNEEVTTVSEEEANGESYDFTLFRFQPILPKNSGRVA 476

Query: 463 HPLTTSFRLRNKELDCYL-AQTGNHLPEWGFRQHEISC---VKDPFRRDKRTWW-----N 513
               ++FR+ + +    L       LPEWGF Q E++    V+DP    +  W+     N
Sbjct: 477 KTKNSAFRIFHVQTAVALWTHNDKLLPEWGFSQQEVNGNKKVQDP----ENNWFVDSIVN 532

Query: 514 VESHENEKLPTPEEFKYPGS-GFLKDFIHLNLAMMATNNALVPESDKFDYLASSAWEWPT 572
           +  +++ ++ TP   K P S  F + +  L   M   NN L  E       AS+   WP 
Sbjct: 533 MPENDSRRIYTP---KVPTSMPFFQKWYELQFLMFEHNNKLSSEHP----FASNPQSWPL 585

Query: 573 LHVGLRLCGWGDNNPKYFLLGTPVTTWASSVAVISFMILFVVLLLRWQRQYNDFSNKDDF 632
              G+      +   + F  G  V  W   V+V  ++ L V  L+  QR     +     
Sbjct: 586 SLSGVSFWTKEEGRKQIFFTGNIVGWWFEIVSVALYLGLVVADLITRQRAVYALNKMARQ 645

Query: 633 NLFLMGGFYPILGWGLHFVPFVIMSRVTYVHHYLPALYFALIILTYII------------ 680
            L+    F  I GW +H+ PF +M+R  ++HHYLPA +  L + +  +            
Sbjct: 646 KLYGPMAFL-IFGWCIHYFPFFLMARQKFLHHYLPA-HLILAMFSAALWEIVFTDNQSLD 703

Query: 681 ------DATTKRWMKSKCGSIMRLVVFAISIASVVGCFWYFSPISFGMT 723
                 D+      + K  +I   +     I +V GCF YF+P+ +G++
Sbjct: 704 FDLDEEDSKNPHDAEPKVYTIAYYLFCLSVIVNVGGCFIYFAPLVYGLS 752

>Scas_442.1
          Length = 309

 Score =  265 bits (676), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 138/300 (46%), Positives = 183/300 (61%), Gaps = 19/300 (6%)

Query: 440 GDAKDYWVLEIVDQKGS-------ENTTQVHPLTTSFRLRNKELDCYLAQTGNHLPEWGF 492
           GD  D W+LEIVDQ  S       E+   VHP++T FRLR+K L CYLA TG   P WGF
Sbjct: 6   GDVYDDWILEIVDQMDSGNPDFHKEDQNIVHPVSTFFRLRHKVLGCYLASTGLAYPSWGF 65

Query: 493 RQHEISCVKDPFRRDKRTWWNVESHENEKLPTPEEFKYPGSGFLKDFIHLNLAMMATNNA 552
           +Q EI C K    RDK TWWNVE H N++LP  E++  P S F  DFI +N AM ++N+A
Sbjct: 66  QQAEIVCKKSWSHRDKATWWNVEDHWNDQLPIEEDYVPPKSKFWTDFILINFAMASSNSA 125

Query: 553 LVPESDKFDYLASSAWEWPTLHVGLRLCGWGDNNPKYFLLGTPVTTWASSVAVISFMILF 612
           LVP++DKFD LAS  WEWPTLH GLRLC W  +  KY+LLG+P  TW S++++  F+ + 
Sbjct: 126 LVPDADKFDPLASKPWEWPTLHRGLRLCSWSRDVYKYYLLGSPFNTWLSTLSLFLFVFII 185

Query: 613 VVLLLRWQRQYNDFSNKDDFNLFLMGGFYPILGWGLHFVPFVIMSRVTYVHHYLPALYFA 672
             +  +W+RQ+ +      + L + G F P L W  HF PFV+M RVTYVHHYLPALYFA
Sbjct: 186 SKIAYQWRRQHLNLQEDQLWRLGIQGIF-PFLAWITHFFPFVMMGRVTYVHHYLPALYFA 244

Query: 673 LIILTYIIDATTKRWMKSKCGSIMRLVVFAISIASVVGC---FWYFSPISFGMTGPAINY 729
           ++   +++D +         G     + + I +A  VGC   +  F+PI  G+ G    Y
Sbjct: 245 ILTFGFVLDYSI--------GRANPFIKYPIYLALFVGCTYIYVLFAPICQGLHGDVAKY 296

>CAGL0M00220g 28137..30434 similar to sp|P46971 Saccharomyces
           cerevisiae YJR143c PMT4
           dolichyl-phosphate-mannose--protein O-mannosyl
           transferase, hypothetical start
          Length = 765

 Score =  274 bits (701), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 221/758 (29%), Positives = 345/758 (45%), Gaps = 67/758 (8%)

Query: 8   GSEKSDAELKARKQTSVDDVLIE--------EKEDTSKLKDAKVSQSPLLQLEAYLMPLV 59
           G++K  +         VDDV ++        E+   + L + K       +L  YL+   
Sbjct: 9   GTKKFGSSASKESSVDVDDVSLKYNKGVAATEQLAQNWLLNPKPDSDNSYRLGFYLV--- 65

Query: 60  FTGLALFVRMYRIGINGNVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGY 119
            T +A  VR Y+I     VV+DE HFGKF SYYL   F+ DVHPPL KM++   G+L  Y
Sbjct: 66  -TAIAFAVRFYKIYYPREVVFDEVHFGKFASYYLERTFFFDVHPPLAKMMIAFIGWLCNY 124

Query: 120 NGSFDFES-GHEYPEY-VDFVKMRLFNASFSAMCVPLAYFTAKAIGFSLPAVWLFTCMVL 177
           +GSF FE  G  Y ++   F+  R FNA    + V + + + K + F     +L + +V 
Sbjct: 125 DGSFKFEEIGLSYDKHPAPFLAYRSFNALLGTLTVSIMFESMKELNFKAITCFLASMLVA 184

Query: 178 FENSYSTLGRFILLDSMLLFFTVASVFSFVMFHN-QRSRPFSRKWWKWLLLTGINLGCTI 236
            +N++ T  R ILLD++LL    A+V+S++ F+  Q   PFS  W+ WL LTG +L C I
Sbjct: 185 IDNAHVTETRLILLDAILLISVAATVYSYIRFYKLQLKEPFSWNWYIWLYLTGFSLSCVI 244

Query: 237 SVKMVGLFVITLVGIYTVIDLLQMLN-EKKMSWKSYTGHWLARIVALICVPMAVFMICFK 295
           S K +G+     +GI  V++L Q+L+   K+S +    H   R+  LI +P  +++  F 
Sbjct: 245 STKYIGVMTYAAIGIPVVVNLWQLLDINAKLSIRMLIKHIGRRLNGLILIPFIIYLFWFY 304

Query: 296 LHFDLLWHSGTGDANMPSLFQAGLVGSDVGGGPRDVAIGSSVSIKNQALSGALLHSHVQT 355
           +HF +L  SG GD  M S FQ  L  S+     ++V     V+ +NQ  +GA LHSH+  
Sbjct: 305 VHFAILNVSGPGDVFMSSEFQDTLHDSEATKLSKEVQFFDIVTFENQD-TGAFLHSHLAR 363

Query: 356 YP-------EGSNQQQVTAYSYKDANNNWVFHRVREESLWDINETDIEYVVDGAVYRLVH 408
           YP         S  QQVT Y+++D NN W    V +++  D    +I +   G  +RL H
Sbjct: 364 YPLRYEDDRVSSQGQQVTCYTHEDVNNQWEILPVADKAKGD----NIRF---GDEFRLRH 416

Query: 409 ANTQKNLHTHSIAAPVDKKNWEVSG-YGNHTIGDAKDYWVLEIVDQKGSENTTQVHPLTT 467
             T   L  H +A+P+   N E++  + +  +G   +  +         +    +     
Sbjct: 417 VGTDSYLLAHDVASPLYPTNEEITTVHKDDALGARANSTIFRFQPINKKDEGHIIKSKNA 476

Query: 468 SFRLRNKELDCYL-AQTGNHLPEWGFRQHEISCVKDPFRRDKRTWWNVES----HENEKL 522
             R+ +KE    L +     LP+WGF Q E++  K     D    W ++S     E    
Sbjct: 477 VLRIIHKETVVALWSHNDELLPDWGFGQQEVNGNKK--MTDSGNAWTIDSIMNLDEKRSA 534

Query: 523 PTPEEFKYPGSGFLKDFIHLNLAMMATNNALVPESDKFDYLASSAWEWPTLHVGLRLCGW 582
             P+E K     F   ++ L   M   NN L  E       AS    WP    G+     
Sbjct: 535 YAPKEIK--SMPFFNKWLELQKLMFEQNNKLTSEHP----FASQPESWPGSMSGVSFWTK 588

Query: 583 GDNNPKYFLLGTPVTTWASSVAVISFMILF-VVLLLRWQRQYNDFSNKDDFNLFLMGGF- 640
            +   + + +G  +  W     VISF +   +++  +  RQ   F+        L G   
Sbjct: 589 NEERRQIYFIGNIIGFW---FQVISFAVYVGIIIADQITRQRGYFALNKVTREKLYGPLA 645

Query: 641 YPILGWGLHFVPFVIMSRVTYVHHYLPALYFALIILTYIIDATTKR-------------- 686
           Y   GW  H+ PF +M R  ++HHYLPA   A +    + +    R              
Sbjct: 646 YLFCGWACHYFPFFLMGRQKFLHHYLPAHLIAALFAAGLWETVFSRCKSDDPYKDEEKPG 705

Query: 687 --WMKSKCGSIMRLVVFAISI-ASVVGCFWYFSPISFG 721
             + K         + F I++ A++V CF +FSP+ + 
Sbjct: 706 VSFEKYPAIYTAAYITFNITVLAALVWCFVFFSPLIYA 743

>ABL085W [507] [Homologous to ScYJR143C (PMT4) - SH]
           complement(237967..240240) [2274 bp, 757 aa]
          Length = 757

 Score =  272 bits (696), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 202/695 (29%), Positives = 320/695 (46%), Gaps = 49/695 (7%)

Query: 61  TGLALFVRMYRIGINGNVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYN 120
           T +A  VR +++     VV+DE HFGK  SYYL   ++ DVHPP  KML+   G+L GY+
Sbjct: 55  TAIAFAVRFHKLYHPSEVVFDEVHFGKCASYYLERTYFFDVHPPFSKMLIAFVGWLVGYD 114

Query: 121 GSFDFES-GHEYPEY-VDFVKMRLFNASFSAMCVPLAYFTAKAIGFSLPAVWLFTCMVLF 178
           G+F F+  G+ Y  + V ++  R  +A    + VPL +   + + F          +V  
Sbjct: 115 GAFKFDDIGYSYETHQVPYIAYRSLSAILGTLTVPLVFSILRELNFKAITCAFGALLVAV 174

Query: 179 ENSYSTLGRFILLDSMLLFFTVASVFSFVMFHNQRSR-PFSRKWWKWLLLTGINLGCTIS 237
           +N++    R ILLD+ L+     S+++++ F+  + R P S +W+ WL  TG++L   IS
Sbjct: 175 DNAHVIDSRLILLDATLVISVALSIYTYIRFYKAQLRAPLSSEWYFWLYATGLSLSFVIS 234

Query: 238 VKMVGLFVITLVGIYTVIDLLQMLNEKK-MSWKSYTGHWLARIVALICVPMAVFMICFKL 296
            K VG+F   ++G   +++L Q+L+ +  +S + +  H++ R   L+C P AV++  F +
Sbjct: 235 TKYVGVFTFAMIGTAVIVNLWQLLDVRAGLSLRMFFRHFVQRFNGLVCFPFAVYLFWFYV 294

Query: 297 HFDLLWHSGTGDANMPSLFQAGLVGSDVGGGPRDVAIGSSVSIKNQALSGALLHSHVQTY 356
           HF +L  SG GD  M S FQ  L  S +    +DV     V+ +++  +GALLHSH   Y
Sbjct: 295 HFAILTKSGPGDDFMSSAFQETLADSPLAKDSKDVHYYDIVTFQHRD-TGALLHSHNAYY 353

Query: 357 P-------EGSNQQQVTAYSYKDANNNWVFHRVREESLWDINETDIEYVVDGAVYRLVHA 409
           P         S  QQVT YS++D NN W     +E S    + T    ++D  V RL H 
Sbjct: 354 PLRYEDGRVSSQGQQVTGYSHEDINNQWEILPTKELS----SRTGQPVLLDD-VLRLRHI 408

Query: 410 NTQKNLHTHSIAAPVDKKNWEVSGYGNHTI-GDAKDYWVLEIVDQKGSENTTQVHPLTTS 468
            T   L TH +A+P    N EV+        G+     + ++      +    V   T+ 
Sbjct: 409 ATGTYLLTHDVASPYYPTNEEVTTISEELANGERYKQTLFKLQPPNKKDGGHTVKSKTSM 468

Query: 469 FRLRNKELDCYL-AQTGNHLPEWGFRQHEISCVKDPFRRDKRTWWNVES----HENEKLP 523
           FR+ + +    L       LPEWGF+Q E++  K     D    W V S     E  K+ 
Sbjct: 469 FRMFHVDTAVALWTHNDVFLPEWGFKQQEVNGNKK--VTDPANIWTVNSILNLSEERKVY 526

Query: 524 TPEEFKYPGSGFLKDFIHLNLAMMATNNALVPESDKFDYLASSAWEWPTLHVGLRLCGWG 583
            P+  K     F   ++ L  +M   NN L  E       AS    WP    G+      
Sbjct: 527 IPK--KVTKMPFFSKWLELQRSMFEHNNKLSSEHP----FASQPESWPGSLSGVSFWTND 580

Query: 584 DNNPKYFLLGTPVTTWASSVAVISFMILFVVLLLRWQRQYNDFSNKDDFNLFLMGGFYPI 643
               + +  G  +  W   +++  F+ + +   +  QR +          ++    F  I
Sbjct: 581 TERRQIYFTGNIIGWWIELISLALFVGILLADAITRQRSFFVLGKLAREKIYGPLCFLYI 640

Query: 644 LGWGLHFVPFVIMSRVTYVHHYLPALYFALIILTYIID-------ATTKRWMKSKCGS-- 694
            GW +H+ PF +M R  ++HHYLPA   A +    + +       A T R  +S+  +  
Sbjct: 641 -GWAIHYFPFFLMGRQKFLHHYLPAHLIAAMFTAGLWEVIFTDNRALTTRKDESEPAAPH 699

Query: 695 --------IMRLVVFAISIASVVGCFWYFSPISFG 721
                      L    +   +VVG F YFSPI +G
Sbjct: 700 NTNPIVYEYFLLAFLGLLSIAVVGFFIYFSPIVYG 734

>YJR143C (PMT4) [3035] chr10 complement(698241..700529)
           Mannosyltransferase (dolichyl
           phosphate-D-mannose:protein O-D-mannosyltransferase),
           involved in initiation of O-glycosylation [2289 bp, 762
           aa]
          Length = 762

 Score =  260 bits (664), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 206/698 (29%), Positives = 326/698 (46%), Gaps = 51/698 (7%)

Query: 59  VFTGLALFVRMYRIGINGNVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAG 118
           + T LA   R Y+I     VV+DE HFGKF SYYL   ++ DVHPP  KM++   G+L G
Sbjct: 58  IVTLLAFAARFYKIWYPKEVVFDEVHFGKFASYYLERSYFFDVHPPFAKMMIAFIGWLCG 117

Query: 119 YNGSFDF-ESGHEYPEY-VDFVKMRLFNASFSAMCVPLAYFTAKAIGFSLPAVWLFTCMV 176
           Y+GSF F E G+ Y  +   ++  R FNA    + VP+ + T K + F        + +V
Sbjct: 118 YDGSFKFDEIGYSYETHPAPYIAYRSFNAILGTLTVPIMFNTLKELNFRAITCAFASLLV 177

Query: 177 LFENSYSTLGRFILLDSMLLFFTVASVFSFVMFHN-QRSRPFSRKWWKWLLLTGINLGCT 235
             + ++ T  R ILLD++L+    A+++ +V F+  Q  +PF+  W+ WL  TG++L   
Sbjct: 178 AIDTAHVTETRLILLDAILIISIAATMYCYVRFYKCQLRQPFTWSWYIWLHATGLSLSFV 237

Query: 236 ISVKMVGLFVITLVGIYTVIDLLQMLNEKK-MSWKSYTGHWLARIVALICVPMAVFMICF 294
           IS K VG+   + +G   V++L Q+L+ K  +S + +  H+  R+  L+ +P  +++  F
Sbjct: 238 ISTKYVGVMTYSAIGFAAVVNLWQLLDIKAGLSLRQFMRHFSKRLNGLVLIPFVIYLFWF 297

Query: 295 KLHFDLLWHSGTGDANMPSLFQAGLVGSDVGGGPRDVAIGSSVSIKNQALSGALLHSHVQ 354
            +HF +L  SG GDA M + FQ  L  S +    + V     ++IK+Q  + A LHSH+ 
Sbjct: 298 WVHFTVLNTSGPGDAFMSAEFQETLKDSPLSVDSKTVNYFDIITIKHQD-TDAFLHSHLA 356

Query: 355 TYPE-------GSNQQQVTAYSYKDANNNWVFHRVREESLWDINETDIEYVVDGAVYRLV 407
            YP+        S  QQVT Y++ D NN W    V      D+ +   + V+     RL 
Sbjct: 357 RYPQRYEDGRISSAGQQVTGYTHPDFNNQW---EVLPPHGSDVGKG--QAVLLNQHIRLR 411

Query: 408 HANTQKNLHTHSIAAPVDKKNWEVSGYGNHTIGDAKDY--WVLEIVDQKGSENTTQVHPL 465
           H  T   L  H +A+P    N E++       GD + Y   +      K S+    +   
Sbjct: 412 HVATDTYLLAHDVASPFYPTNEEITTVTLEE-GDGELYPETLFAFQPLKKSDEGHVLKSK 470

Query: 466 TTSFRLRNKELDCYL-AQTGNHLPEWGFRQHEISCVKDPFRRDKRTWWNVES----HENE 520
           T SFRL + +    L       LP+WGF+Q EI+  K     D    W V+      E  
Sbjct: 471 TVSFRLFHVDTSVALWTHNDELLPDWGFQQQEINGNKKVI--DPSNNWVVDEIVNLDEVR 528

Query: 521 KLPTPEEFKYPGSGFLKDFIHLNLAMMATNNALVPESDKFDYLASSAWEWPTLHVGLRLC 580
           K+  P+  K     FLK +I    +M   NN L  E       AS  + WP    G+   
Sbjct: 529 KVYIPKVVK--PLPFLKKWIETQKSMFEHNNKLSSEHP----FASEPYSWPGSLSGVSFW 582

Query: 581 GWGDNNPKYFLLGTPVTTWASSVAVISFMILFVVLLLRWQRQYNDFSNKDDFNLFLMGGF 640
             GD   + + +G  +  W   +++  F+ + V  L+   R Y   +      L+    F
Sbjct: 583 TNGDEKKQIYFIGNIIGWWFQVISLAVFVGIIVADLITRHRGYYALNKMTREKLYGPLMF 642

Query: 641 YPILGWGLHFVPFVIMSRVTYVHHYLPALYFALII----------------LTYIIDATT 684
           +  + W  H+ PF +M+R  ++HHYLPA   A +                 L    D + 
Sbjct: 643 F-FVSWCCHYFPFFLMARQKFLHHYLPAHLIACLFSGALWEVIFSDCKSLDLEKDEDISG 701

Query: 685 KRWMKSKCGSIMRLVVFAISIASVVGCFW-YFSPISFG 721
             + ++    +    VF + ++  V  F+ YFSP+ +G
Sbjct: 702 ASYERNPKVYVKPYTVFLVCVSCAVAWFFVYFSPLVYG 739

>Scas_710.1
          Length = 919

 Score =  256 bits (655), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 205/716 (28%), Positives = 333/716 (46%), Gaps = 50/716 (6%)

Query: 16  LKARKQTSVDDVLIEEKEDTSKLKDAKVSQSPLLQLEAYLMPLVFTGLALFVRMYRIGIN 75
           ++ +K   +  +  E  +D  +L+    +   +L L      L FT L   +R++ +G  
Sbjct: 21  IEIKKGRVIPFIDTEPSQDLVQLRTISTTHEIILVLSL----LAFTAL---IRLHDLGWP 73

Query: 76  GNVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSFDFES-GHEYPEY 134
             VV+DEA +G   S YL++  + DVHPPL K+L     +  G+ G F+F   G  +P  
Sbjct: 74  NGVVFDEAVYGNIVSKYLKNILFVDVHPPLIKLLYAGIAHFLGFEGQFEFNDIGVPFPTT 133

Query: 135 VDFVKMRLFNASFSAMCVPLAYFTAKAIGFSLPAVWLFTCMVLFENSYSTLGRFILLDSM 194
             +  MRLF+A+  ++ V L Y T +A G  +      +  ++ ENS+ T+ R I+L+  
Sbjct: 134 TPYYAMRLFSATLGSLTVLLMYLTLRASGVRIWVALAGSICLVIENSFVTVSRHIMLEGP 193

Query: 195 LLFFTVASVFSFVMFHNQRSRPFSRKWWKWLLLTGIN---LGCTISVKMVGLFVITLVGI 251
           L+FF  A+V+       ++S  F        +  GI    LG  IS K VG+  +   G+
Sbjct: 194 LMFFIAAAVY-----FTKKSDLFKADSCNSYINIGIAAVALGLAISSKWVGVATLIWAGL 248

Query: 252 YTVIDLLQMLNEKKMSWKSYTGHWLARIVALICVPMAVFMICFKLHFDLLW-HSGTGDAN 310
             V  L  M+    M         L +   LI +P+ ++++ F  HF     +S      
Sbjct: 249 ICVWRLWFMVGNLSMPVCGSFKVALIKAFTLIFLPIILYILTFYFHFQYTGINSDVSQLF 308

Query: 311 MPSLFQAGLVGSDVGGGPRDVAIGSSVSIKNQALSGALLHSHVQTYPEGSNQQQVTAYSY 370
            P         S V     ++A+GS +++++    G  LHSH   Y +GSNQQQ+T Y Y
Sbjct: 309 TPEFRTTLANNSVVNNVVAEIAVGSMITLRHPGTHGGYLHSHDAFYEKGSNQQQITCYPY 368

Query: 371 KDANNNWVFHRVREESLWDI---NETDIEYVVDGAVYRLVHANTQKNLHTHSIAAPV-DK 426
            D N+NW         L+D+   N T  + + DG   RL+H NT   LH+H    PV + 
Sbjct: 369 VDKNDNWTV------ELYDVPLENITSFQNLTDGTKIRLLH-NTGCRLHSHDHKPPVSEN 421

Query: 427 KNW--EVSGYGNHTI-GDAKDYWVLEIVDQKGS---ENTTQVHPLTTSFRLRNKELDCYL 480
            +W  EVS YG     GDA D W++EI D+  S   E+   V  + T FRL++  + CYL
Sbjct: 422 SDWQKEVSCYGYPGFEGDANDDWIIEI-DKDASIPGESQEHVRAIETKFRLKHAIMGCYL 480

Query: 481 AQTGNHLPEWGFRQHEISCVKDPFRRDKRTWWNVESHENEKLP-TPEEFKYPGSGFLKDF 539
                 LP+ GF Q E++C       D  T W+VE++EN  +    E   Y    F K F
Sbjct: 481 FSHNTMLPKLGFEQQEVTCAYSGI--DSLTLWSVENNENPFVSDDAERVSYEPLSFWKKF 538

Query: 540 IHLNLAMMATNNALVPESDKFDYLASSAWEWPTLHVGLRLCGWGDNNPKYFLLGTPVTTW 599
           +  +  M+   + +    D      S    WP +  G+    W + +   +LLG  V  W
Sbjct: 539 VETHKRMLEIASGM----DNTHMYESKPATWPFMLRGIDF--WSEQHQDIYLLGNAVLWW 592

Query: 600 ASSVAVISFMILFVVLLLRWQRQYNDFSNKDDFNLFLMGGFYPILGWGLHFVPFVIMSRV 659
           + +  ++ F  + V  L+  Q  Y +FS       F +     +LG+ L+F+P +++   
Sbjct: 593 SVTAFIVGFAGIVVWELVSLQLGY-EFSKDPHVINFHIQVIQYLLGFLLNFIPSLLLENQ 651

Query: 660 TYVHHYLPALYFALIILTYIIDATTKRWMKSKCGSIMRLVVFAISIASVVGCFWYF 715
            +++HYLPA YF ++ LT+ +D       + +     R + + I       C ++F
Sbjct: 652 IFLYHYLPAYYFGILALTHGLDILVSYIFRRR-----RSIGYTIVFLFATLCVYFF 702

>Kwal_47.16734
          Length = 792

 Score =  252 bits (643), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 204/703 (29%), Positives = 324/703 (46%), Gaps = 65/703 (9%)

Query: 61  TGLALFVRMYRIGINGNVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYN 120
           T LA  VR  ++     VV+DE HFGKF SYYL   ++ DVHPP  KML+   G+L GYN
Sbjct: 90  TLLAAVVRFRKLSYPREVVFDEVHFGKFASYYLERTYFFDVHPPFAKMLIAFVGWLVGYN 149

Query: 121 GSFDFES-GHEYPEY-VDFVKMRLFNASFSAMCVPLAYFTAKAIGFSLPAVWLFTCMVLF 178
           G+F F+  G  Y      FV  R  +A    + VP+ + T K + F      L   +V  
Sbjct: 150 GTFKFDDIGLSYDSNPAPFVAYRSLSAILGTLTVPIIFNTVKELNFRAVTCALAALLVAI 209

Query: 179 ENSYSTLGRFILLDSMLLFFTVASVFSFVMFHN-QRSRPFSRKWWKWLLLTGINLGCTIS 237
           + ++    R ILLD+ LL     S++ +V F+  Q   PFS  W+ WL LTG +L   +S
Sbjct: 210 DCAHVIDSRLILLDATLLIAVACSLYCYVRFYKIQLKAPFSSSWYLWLYLTGTSLSFVMS 269

Query: 238 VKMVGLFVITLVGIYTVIDLLQMLNEKK-MSWKSYTGHWLARIVALICVPMAVFMICFKL 296
            K +G+     +G    ++L Q+L+ +  ++ + +  H L R+  LI  P  +++  F +
Sbjct: 270 TKYIGVMTYATIGSAVAVNLWQLLDVRAGLTIRQFVKHVLQRLNGLIFAPFVLYLFWFWV 329

Query: 297 HFDLLWHSGTGDANMPSLFQAGLVGSDVGGGPRDVAIGSSVSIKNQALSGALLHSHVQTY 356
           HF +L  SG GD  M S FQ  L  S +    R V     +++K++ ++ A LHSH++ Y
Sbjct: 330 HFAILIRSGPGDDFMSSQFQETLSDSPLAREARQVNYFDIITLKHK-VTDAYLHSHLERY 388

Query: 357 P-------EGSNQQQVTAYSYKDANNNWVFHRVREESLWDINETDIEYVVDGAVYRLVHA 409
           P         SN QQVT Y+ +D NN W     ++    +     ++ VV     R  H 
Sbjct: 389 PIRYEDGRVSSNGQQVTGYTLEDVNNQWEVLPTKQLPAREGQPVHLDDVV-----RFRHV 443

Query: 410 NTQKNLHTHSIAAPVDKKNWEVSGYGNHTIGDA---KDYWVLEIVDQKGSENTTQVHPLT 466
            T   L  H +A+P+   N E++         A   +  + L+ V++  SE+  +     
Sbjct: 444 VTNTFLLAHDVASPLYPTNEEITTVEEEMANGANYPETLFRLQSVNKGDSEDVLKSK--A 501

Query: 467 TSFRLRNKELDCYL-AQTGNHLPEWGFRQHEISCVK---DPFRRDKRTWW-----NVESH 517
           + FR+ + +    L       LPEWGF+Q E++  K   DP    + +W+     N++  
Sbjct: 502 SVFRIVHIDTTVALWTHNDVLLPEWGFKQQEVNGNKKIIDP----ENSWFAETIVNIDEA 557

Query: 518 ENEKLPTPEEFKYPGSGFLKDFIHLNLAMMATNNALVPESDKFDYLASSAWEWPTLHVGL 577
            +  +P   + K P   F   ++ L   M   NN L   S  F   ASS   WP    G+
Sbjct: 558 RSVYVPKTRK-KLP---FFTKWMELQRLMFEHNNKL-SSSHPF---ASSPESWPGSLSGV 609

Query: 578 RLCGWGDNNPKYFLLGTPVTTWASSVAVISFMILFVVLLLRWQRQYNDFSN--KDDFNLF 635
                     + + +G  +  W   V++  F  +    LL  +R     +   K   N  
Sbjct: 610 SFWTKDSERIQIYFIGNIIGWWFQVVSIALFCGVTAADLLVRRRGIFPLNKMAKQKLNAP 669

Query: 636 LMGGFYPILGWGLHFVPFVIMSRVTYVHHYLPA-----LYFALIILTYIIDATTKRWMKS 690
           L   F   +GW  HFVPF +M R  ++HHYLPA     ++ A +  T   D  +    K 
Sbjct: 670 LSFLF---VGWLCHFVPFFLMGRQKFLHHYLPAHLIASMFSAAMWETIFTDNKSLNLEKD 726

Query: 691 KCG-----------SIMRLVVFAISIA-SVVGCFWYFSPISFG 721
           +             + + L++F + ++ +++  F YFSPI +G
Sbjct: 727 EEDPANAHEANPHLNYIPLILFVLVMSGALIWFFVYFSPIVYG 769

>Scas_719.80
          Length = 762

 Score =  246 bits (627), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 214/747 (28%), Positives = 336/747 (44%), Gaps = 65/747 (8%)

Query: 13  DAELKARKQTSVDDVLIEEKEDTSKLKDAKVSQSPLLQLEAYLMPLVFTGLALFVRMYRI 72
           D  LK  K+++     + EK       D+ +  + LL           T +A   R Y I
Sbjct: 20  DEALKYAKRSTTSFEQVAEKWLLRPPPDSALRYNALL--------YTVTLIAFVARFYMI 71

Query: 73  GINGNVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSFDF-ESGHEY 131
                VV+DE HFGKF SYYL   ++ DVHPP  KM +   G+L GYNGSF F E G  Y
Sbjct: 72  WYPKEVVFDEVHFGKFASYYLERTYFFDVHPPFAKMAIAFIGWLVGYNGSFKFDEIGSSY 131

Query: 132 -PEYVDFVKMRLFNASFSAMCVPLAYFTAKAIGFSLPAVWLFTCMVLFENSYSTLGRFIL 190
                 ++  R FNA    + V + + T K + F     +    +V  +N++ T  R IL
Sbjct: 132 QTNPAPYIAYRSFNAMLGTLTVSIMFNTLKELNFKAITCFFGALLVAVDNAHVTETRLIL 191

Query: 191 LDSMLLFFTVASVFSFVMFHNQRSR-PFSRKWWKWLLLTGINLGCTISVKMVGLFVITLV 249
           LD++LL    AS +SFV F+  + R PFS +W+ WL LTG++L   IS K +G+     +
Sbjct: 192 LDAILLISIAASFYSFVRFYKAQLRAPFSPQWYIWLHLTGLSLSFVISTKYIGVMTYAAI 251

Query: 250 GIYTVIDLLQMLN-EKKMSWKSYTGHWLARIVALICVPMAVFMICFKLHFDLLWHSGTGD 308
           G   +++L Q+L+    ++ +++  H++ R+  L+  P  +++  F +HF +L  SG GD
Sbjct: 252 GTGVIVNLWQLLDLRANLTLRAFFRHFVKRLNGLVFAPFCIYLFWFWVHFAILSKSGPGD 311

Query: 309 ANMPSLFQAGLVGSDVGGGPRDVAIGSSVSIKNQALSGALLHSHVQTYPE-------GSN 361
           A M + FQ  L  S +    ++V     +++K++  + A LHSH   YP         S 
Sbjct: 312 AFMSAEFQETLGDSPMSILSKEVHFYDIITLKHKD-TEAFLHSHQAFYPLRYEDGRISSE 370

Query: 362 QQQVTAYSYKDANNNWVFHRVREESLWDINETDIEYVVDGAVYRLVHANTQKNLHTHSIA 421
            QQVT ++  D +N+W     RE      +   +  V++  + RL H  +   L  H +A
Sbjct: 371 GQQVTGFTGTDISNDWEVLPTRELD----SHKGVPVVLNEPI-RLRHVASNTYLLAHDVA 425

Query: 422 APVDKKNWEVSGYGNHTI-GDAKDYWVLEIVDQKGSENTTQVHPLTTSFRLRNKELDCYL 480
           +P    N E++        G++    V      K  +    V      F++ +   D  L
Sbjct: 426 SPFYPTNEEITTVSEEIANGESYQQTVFTFQPLKKGDEGHVVKTKGVQFKIYHPNTDVVL 485

Query: 481 -AQTGNHLPEWGFRQHEISCVKDPFRRDKRTWWNVES----HENEKLPTPEEFKYPGSGF 535
                  LP+WGF Q E++  K+    D    W+V+      E+ K  TP+  K P S F
Sbjct: 486 WTHNDVLLPDWGFEQQEVNGSKN--FGDPTNAWSVDEITNLDEDRKKFTPKVVK-PMS-F 541

Query: 536 LKDFIHLNLAMMATNNALVPESDKFDYLASSAWEWPTLHVGLRLCGWGDNNPKYFLLGTP 595
            + +  L  +M   NN L  E       AS    WP    G+      +   + F     
Sbjct: 542 FRKWSELQKSMFEQNNKLSAEHP----FASQPQSWPAGLCGVSFWTKSEERKQIFFTANI 597

Query: 596 VTTWASSVAVISFMILFVVLLLRWQRQYNDFSNKDDFNLFLMGGFYPILGWGLHFVPFVI 655
           +  W   +++  F+ + +   +  +R Y          L+    F   + WG H+ PF +
Sbjct: 598 IGWWFQVISMSVFIGILLADQISRKRGYFVLGKITREKLYGPLAFL-FISWGCHYAPFFL 656

Query: 656 MSRVTYVHHYLPALYFALIILTYI-------------IDATTKRWMKS-------KCGSI 695
           M R  ++HHYLPA    LII  +              IDA+    ++        K  S 
Sbjct: 657 MHRQKFLHHYLPA---HLIISLFTAGLWEVVFSDCKSIDASRDEEIEGTPYKADPKINST 713

Query: 696 MRLVVF-AISIASVVGCFWYFSPISFG 721
              V F A+SIA +V  F YFSP+ +G
Sbjct: 714 SLTVFFVAVSIA-IVWFFIYFSPLVYG 739

>CAGL0L07172g complement(796354..798687) similar to sp|P33775
           Saccharomyces cerevisiae YDL095w PMT1
           mannosyltransferase or sp|P52867 Saccharomyces
           cerevisiae YDL093w PMT5, start by similarity
          Length = 777

 Score =  189 bits (480), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 167/643 (25%), Positives = 270/643 (41%), Gaps = 31/643 (4%)

Query: 63  LALFVRMYRIGINGNVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGS 122
            A+  R Y IG    +V+DE       S Y    F  DV PPLGKM+    G   G++ S
Sbjct: 70  FAIVTRFYDIGFPKAIVYDEGFVIAEVSKYFNKTFSIDVFPPLGKMIYYFVGKYTGFDTS 129

Query: 123 FDFES-GHEYPEYVDFVKMRLFNASFSAMCVPLAYFTAKAIGFSLPAVWLFTCMVLFENS 181
           + +   G ++     ++  R   A   A  V   + T +A G S P   +F+  +  ENS
Sbjct: 130 YKYHPVGTQFENASVYLPERYLAAGLGACVVVFFFMTLRASGVSRPIAGIFSVALSLENS 189

Query: 182 YSTLGRFILLDSMLLFFTVASVFSFVMFHNQRSRPFSRKWWKWLLLTGINLGCTISVKMV 241
           + T  R++ LD+  LFF  A+++      N R+   S ++          LG  IS K  
Sbjct: 190 FITASRYVHLDAPFLFFVAAAIYFTKKSDNLRAG--SGRYIFTFTHAACLLGLAISTKWA 247

Query: 242 GLFVITLVGIYTVIDLLQMLNEKKMSWKSYTGHWLARIVALICVPMAVFMICFKLHFDLL 301
           GLFV+  V I T+  L  +  +  +        ++  ++ L  VP  ++   F  H    
Sbjct: 248 GLFVLAWVAIVTLWRLWLLAGDLSVPICRTVKVFIFNLLVLSLVPAVIYFSIFSWHIGSR 307

Query: 302 WHSGTGDANMPSLFQAGLVGSDV-GGGPRDVAIGSSVSIKNQALSGALLHSHVQTYPEGS 360
              G     M   F++ L  + V      DV +G +V + N  + G  + +    Y  GS
Sbjct: 308 TVDGNDSILMKPEFRSELYNNTVIKESFADVVVGGTVRLNNIGMDGGFVEAAPAYYEAGS 367

Query: 361 NQQQVTAYSYKDANNNWVFHRVREESLWDINETDIEYVVDGAVYRLVHANTQKNLHTHSI 420
            Q+Q+     +    +WV                 E + +    RL     +  LH+H  
Sbjct: 368 KQRQIDLRKNESVTTDWVVEYYNRSG---STPKSFENLKNHEKIRLYSPKYKCRLHSHDH 424

Query: 421 AAPVDKK-NW--EVSGYGNHT-IGDAKDYWVLEIVDQKGSENTTQ---VHPLTTSFRLRN 473
            AP+ +  +W  EVS YG    +GD  D W++EI DQ  SE       V  + T FRL++
Sbjct: 425 KAPISQHVDWQKEVSCYGYEGFMGDPNDDWIVEI-DQDLSEPGEAREFVKAIDTKFRLKH 483

Query: 474 KELDCYLAQTGNHL--PEWGFRQHEISCVKDPFRRDKRTWWNVES---HENEKLPTPEEF 528
               CYL      +  PE+    +EI+C      + + T WN+E    H N     P+  
Sbjct: 484 AMSGCYLFTHDVRMRTPEF-VMDYEIACAHS--GKYELTLWNIEQDQPHPNSP-KNPKRV 539

Query: 529 KYPGSGFLKDFIHLNLAMMATNNALVPESDKFDYLASSAWEWPTLHVGLRLCGWGDNNPK 588
            Y         + L+  M+        +S     L +    WP L  G+    W     +
Sbjct: 540 SYKPMSLKDKILDLHAKMIEKAKVRTDKSS----LITFPTTWPLLEKGIPF--WNGFARQ 593

Query: 589 YFLLGTPVTTWASSVAVISFMILFVVLLLRWQRQYNDFSNKDDFNLFLMGGFYPILGWGL 648
            + LG P   W+ S  ++ F++ FV  L+ WQ  +   SN    N  +    Y I G+ L
Sbjct: 594 IYFLGNPAMWWSVSAFIVLFVVAFVGELIFWQMGFEISSNPQFINFHIQVLQYGI-GFAL 652

Query: 649 HFVPFVIMSRVTYVHHYLPALYFALIILTYIIDATTKRWMKSK 691
           ++VP+++ +   +++ YLPA YF L+ L ++ +       K+K
Sbjct: 653 NYVPYILTTDRHHLYQYLPAYYFGLLALAHVFELVYSFAFKNK 695

>Scas_30.1
          Length = 128

 Score =  152 bits (385), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 69/105 (65%), Positives = 84/105 (80%)

Query: 625 DFSNKDDFNLFLMGGFYPILGWGLHFVPFVIMSRVTYVHHYLPALYFALIILTYIIDATT 684
           DF+N +D N FLMG FYP+LGWGLH++PFVIMSRVTYVHHYLPALYFAL+IL Y+ D   
Sbjct: 12  DFANPEDLNTFLMGAFYPLLGWGLHYLPFVIMSRVTYVHHYLPALYFALLILAYLFDFFM 71

Query: 685 KRWMKSKCGSIMRLVVFAISIASVVGCFWYFSPISFGMTGPAINY 729
           K+W KSKCGSI +L ++    A ++  F+YFSPISFGM GP+ NY
Sbjct: 72  KKWTKSKCGSITKLAIYFCYYAVIIYGFYYFSPISFGMDGPSQNY 116

>Scas_329.1
          Length = 273

 Score =  144 bits (362), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 89/212 (41%), Positives = 122/212 (57%), Gaps = 6/212 (2%)

Query: 63  LALF---VRMYRIGINGNVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGY 119
           LALF   +R+  +    +VV+DE HFGKF SYY++ EF+ DVHPPL KML      LAG+
Sbjct: 64  LALFTASIRLPNLQKPDSVVFDEVHFGKFASYYIKGEFFMDVHPPLAKMLYAGVAALAGF 123

Query: 120 NGSFDFES-GHEYPEYVDFVKMRLFNASFSAMCVPLAYFTAKAIGFSLPAVWLFTCMVLF 178
            G+F FE+ G  +P  V +V MR F+A   A+ V L Y T ++ G      ++       
Sbjct: 124 RGNFMFENIGDVFPADVPYVLMRFFSAMLGALTVMLLYLTLRSSGVRPWVAFVSGACFAI 183

Query: 179 ENSYSTLGRFILLDSMLLFFTVASVFSFVMFHNQRSRPFSRKWWKWLLLTGINLGCTISV 238
           ENSY T+ R+ILLD+ L+FF  A+V+SF  + N +S  FS    K L + G+ LG   S 
Sbjct: 184 ENSYVTISRYILLDAPLIFFIAAAVYSFKKYENYKS--FSIGSIKSLFVAGVALGMAASA 241

Query: 239 KMVGLFVITLVGIYTVIDLLQMLNEKKMSWKS 270
           K VGLF I  VG+  +  L  M+ +   S KS
Sbjct: 242 KWVGLFTIAWVGLLCIWRLWFMIGDLSKSTKS 273

>Sklu_2215.6 YDR307W, Contig c2215 9395-11356 reverse complement
          Length = 653

 Score =  150 bits (378), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 168/668 (25%), Positives = 298/668 (44%), Gaps = 74/668 (11%)

Query: 58  LVFTGLALFVRMYRI----GINGNVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLS 113
           L+   +ALF  ++++    G  G  V ++   G    +YL HEFY D  PPL   L  L 
Sbjct: 34  LIAVLIALFFVLFQLTKVNGELGTSVQEKEILGSI-DHYLSHEFYLDSRPPLSVQLFSLL 92

Query: 114 GYLAGYNGSFDFESGHEYPEYVDFVKMRLFNASFSAMCVPLAYFTAKAIG----FSLPAV 169
            ++ G       E   E         +R    S   + + L Y   +        S+ AV
Sbjct: 93  TFVYG-------ELSVEL--------LRAATTSCGGIALVLLYLGLRKSSVNRVISVIAV 137

Query: 170 WLFTCMVLFENSYSTLGRFILLDSMLLFFTVASVFSFVMFHNQRSRPFSRKWWKWLLLTG 229
             F+ + +F     TL   +  D   + F   S++S+  F  + ++PFS+ W K+LL   
Sbjct: 138 VSFSYLKVFREE--TLR--VSTDIFQVCFLAMSLYSWKSF--KAAKPFSKTWHKYLLFLS 191

Query: 230 INLGCTISVKMVGLFVITLVGIYTVIDLLQMLNEKKMSWKSYTGHWLARIVALICVPMAV 289
           I+LG +IS K VG    + +   +++ L  ++ + +++ K    H + R +AL+ VP  V
Sbjct: 192 ISLGLSISNKFVGFMTWSWILSLSIVQLWNIIADVRLTGKQVFTHCVLRFMALVLVPAIV 251

Query: 290 FMICFKLHFDLLWHSGTGDAN-MPSLFQAGLVGSDVGG--GPRDVAIGSSVSIKNQALSG 346
           F++ +  H   L    T  +  M   ++  L  + +     P  V  GS+++I+++   G
Sbjct: 252 FLLSYYAHISTLTQDLTDFSTFMSPYYKHTLENNPLNKIVPPGRVYYGSTITIRHKDSLG 311

Query: 347 ALLHSHVQTYPEGSNQQQVTAYSYKDANNNWVFHRVREESLWDINETDIEYVVDGAVYRL 406
             LHSH   Y  GS++QQVT Y + D NN W+    +E    D++   +  V +G   RL
Sbjct: 312 GYLHSHELNYQSGSHEQQVTLYDFPDNNNEWIVEHKKENK--DVSSKAVA-VKNGENIRL 368

Query: 407 VHANTQKNLHTHSIAAPVDKKNWE----VSGYGNHTIGDAKDYWVLEIVDQKGSENTTQV 462
            H  T K L       PV +++++     +G  N+T G + + W +             +
Sbjct: 369 RHRLTGKLLRASGAKPPVSEQDYDREVSCTGDANYT-GQSDELWKIRF----SGRLLEGL 423

Query: 463 HPLTTSFRLRNKELDCYLAQTGNHLPEWGFRQHEISCVKDPFRRDKRTWWNVESHENEKL 522
            PL T+F+L N+   C L      LPEW   Q E+ C+  P +  +RT + VES      
Sbjct: 424 VPLDTTFQLTNQGQGCTLLSHDLRLPEWALFQQEVLCLDPPTK--ERTLFYVESSNRYS- 480

Query: 523 PTPEEFKYPGSGFLKDFIHLNLAMMATNNALVPESDKFDYLASSAWEWPTLHVGLRLCGW 582
              E+  Y    F++D  +  +  +      + +  K+DY   +      + VG     W
Sbjct: 481 ---EDHHYI---FVED--NSVVKFLKLLKEYLYKQFKYDYYIKNYKAEGDVGVG----KW 528

Query: 583 GDNNPKYFLLGTPVTT--WASSV-AVISFMILFVVLLLRWQR-QYNDFSNKDDFNLFLMG 638
                 +++ G  + T  W S+V +++++++L  + L+ W      D      + L++  
Sbjct: 529 -----PWYISGDYLDTAIWFSAVFSILAYLLLQTIRLITWNPWNVADVELPLSYLLYIDN 583

Query: 639 GFYPILGWGLH-FVPFVIMSRVTYVHHYLPALYFALIILTYIIDATTKRWMKSKCGSIMR 697
           G    +GW LH ++ F  M    ++  YLP+L   L+ L ++  +    W ++   +   
Sbjct: 584 GLEFSVGWFLHYYIFFSSMHNRLFLFQYLPSL---LLGLCHVATSAQAAWCQNNL-TRYA 639

Query: 698 LVVFAISI 705
           LVV A++I
Sbjct: 640 LVVSAVTI 647

>AAL050W [137] [Homologous to ScYDR307W - SH]
           complement(256490..258463) [1974 bp, 657 aa]
          Length = 657

 Score =  125 bits (314), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 124/478 (25%), Positives = 206/478 (43%), Gaps = 50/478 (10%)

Query: 106 GKMLVGLSGYLAGYNGSFDFESGHEYPEYVDFVKMRLFNASFSAMCVPLAYFTAKAIGFS 165
             + V  SG+LA   G     +  E  E +D V++  F+        PL       +G  
Sbjct: 60  AALYVLCSGWLAACAGLAASGTETEMLEEIDAVRLGGFHIGVRP---PLGLHVLARLGLG 116

Query: 166 LPAV---WLFTCMVLFENSYSTL----------GRFILLDSMLLFFTVASV--------- 203
           L  +    L    V+ +  Y +L          G  +   ++L  F  A+V         
Sbjct: 117 LIGLRRLALLAACVVLQYLYKSLRCAGIQRLWAGAAVGCIALLEVFRDAAVHASLEMYHA 176

Query: 204 -FSFVMFHNQRS----RPFSRKWWKWLLLTGINLGCTISVKMVGLFVITLVGIYTVIDLL 258
            F  ++ +N +S     PF + WW  L    +  G     K VGL     V +     + 
Sbjct: 177 MFLAIILYNWKSFKLQEPFGQAWWLRLSAVAVCSGLAAGTKFVGLGTWAWVLLLNSAHIF 236

Query: 259 QMLNEKKMSWKSYTGHWLARIVALICVPMAVFMICFKLHFDLLWHSGTGDANMPSLFQAG 318
           Q++ + ++S ++   H L R+  L  VP+++ ++ +  H     +S    + MP+LF+A 
Sbjct: 237 QLIGDLEVSTRTVWKHVLIRLPLLTLVPLSIILLGYHSHLQAPSYSSRDSSYMPTLFKAQ 296

Query: 319 LVGSDVGGGPRDVAIGSSVSIKNQALSGALLHSHVQTYPEGSNQQQVTAYSYKDANNNWV 378
           L G  V   P  V  GS V I++ +  G  LHSH  TYP GS +QQ+T Y ++DANN W 
Sbjct: 297 LDGYQVLQ-PASVYYGSGVVIRHSSSIGGYLHSHELTYPGGSEEQQITLYDFEDANNKWT 355

Query: 379 FHRVREESLWD-INETDIEYVVDGAVYRLVHANTQKNLHTHSIAAPVDKKNW--EVSGYG 435
              V  E++ D IN T  + V +G + +L H  T K L   +   PV ++++  EVS  G
Sbjct: 356 VEPVYNEAMDDIINST--QPVRNGDLIKLRHVQTGKLLRASAAKPPVSQRDYDQEVSCTG 413

Query: 436 NHTI-GDAKDYWVLEIVDQKGSENTTQVHPLTTSFRL-RNKELDCYLAQTGNHLPEWGFR 493
           +    GD+ + W ++I D +  E+      +  S R+ +   L   L+  G         
Sbjct: 414 DSGYSGDSDETWRVDIQDAEYHEDPKAWFCIHFSPRVNKGPVLPPLLSHDGQAAEVGPCT 473

Query: 494 QHEISCVKDP------FRRDKRTWWNVESHENEKLPTPEEF------KYPGSGFLKDF 539
           + E+ C+  P      F  D     + E+ +  +L  P +F      +Y    F+K+F
Sbjct: 474 RQEVICLASPVHKYSLFYVDSSEMMHNETMQLPRLSFPAKFWAYIHAQYKYDYFVKNF 531

>Scas_588.7
          Length = 726

 Score =  109 bits (273), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 130/548 (23%), Positives = 238/548 (43%), Gaps = 70/548 (12%)

Query: 189 ILLDSMLLFFTVASVFSFVMFHNQRSRPFSRKWWKWLLLTGINLGCTISVKMVGLFVITL 248
           I LD++  F+   S++S+     +    FS KW    L+  +++GC+++ K +G      
Sbjct: 221 ISLDTLQWFWLSISIYSWASL--KCFSHFSIKWTIHSLIFAMSIGCSMATKYIGFATWGW 278

Query: 249 VGIYTVIDLLQMLNEKKMSWKSYTGHWLARIVALICVPMAVFMICFKLHFDLLWHSGTGD 308
             + + I   QM+ + ++S      H   +I  L+ +PM +F     L  +   HS    
Sbjct: 279 AILISSIYFWQMIGDVRLSTSHIVKHTTFQIFCLLVIPMTIFATTLYLQIN---HSRIDS 335

Query: 309 AN----MPSLFQAGLVGSDVGGGPRDVAIGSSVSIKN-QALSGALLHSHVQTYPEGSNQQ 363
                 M S ++  L        P ++  GS ++I++  +L G L     ++YPEGS +Q
Sbjct: 336 PEYSQYMSSYYKIFLRSKSPILQPMEITNGSIITIRHLNSLGGYLTSPANESYPEGSAEQ 395

Query: 364 QVTAYSYK-DANNNWVFHRVREESLWDINETDIEYVVDGAVYRLVHANTQKNLHTHSIAA 422
            V+    + + +N W+   V      D N+  +   +D    +L H  T K L   S   
Sbjct: 396 IVSLTDMESNVDNQWILEYVD-----DYNKGPL---IDSQRIKLRHRTTGKLLRASSAKP 447

Query: 423 PVDKK--NWEVSGYGNHTI-GDAKDYWVLEIVDQKGSENTTQVHPLTTSFRLRNKELDCY 479
           PV ++  N EVS  G+    GD+ ++W +++V+  GS     + P      L N    C 
Sbjct: 448 PVSEQEYNSEVSCTGDWDYHGDSDEFWKIDLVE--GS-----LIPCWNIMELDNVGQMCT 500

Query: 480 LAQTGNHLPEWGFRQHEISCVKDPFRRDKRTWWNVESHENEKLPTPEEFK-YPGSG-FLK 537
           L      LP+WG  + E+ C++ P    +R  + +E  +N+++  P      PG G + +
Sbjct: 501 LISHDTRLPDWGEFEQEVFCIQSP--DPQRAKFQIEFVDNDEIKNPITLAGLPGYGNYSR 558

Query: 538 DFIHLNLAMMATNNALVPESDKFDYLASSAWEWPTLHVGLRLCGWGDNNPKY-------- 589
            + ++ LA       L+    K+DY+             ++L    D N K         
Sbjct: 559 CYQYIKLAA-----ELIQREFKYDYM-------------VKLQNDNDENDKVHINKEKWP 600

Query: 590 -FLLGTPVT--TW-ASSVAVISFMILFVVLLLR---WQRQYNDFSNKDDFNLFLMGGFYP 642
            ++ G   T   W  SS+AV+     F + ++    W+    D S+  +  ++       
Sbjct: 601 IYITGNDTTDLIWLTSSIAVVIVACRFGLQVMNWNPWKIDNGDSSSHLNMKIYHEFAIES 660

Query: 643 ILGWGLHFVPFVIMSRV-TYVHHYLPALYFALIILTYIIDATTKRWMKSKCGSIMRLVVF 701
           +LGW +H+  F+  S     +  YLP+  FA ++ T  + A   +W + KC  I  L+V+
Sbjct: 661 LLGWFVHYYIFLKSSNDHLEIVLYLPSFVFAHLLATETVTA-IGQWSQWKCAII--LLVY 717

Query: 702 AISIASVV 709
            ++I   +
Sbjct: 718 IVTIKCTI 725

>Kwal_33.14357
          Length = 657

 Score =  100 bits (249), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 108/422 (25%), Positives = 179/422 (42%), Gaps = 39/422 (9%)

Query: 90  SYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSFDFESGHEYPEYVDFVKMRLFNASFSA 149
           S Y++ EF+    PP    +V +   ++   GS   E             +R  N + +A
Sbjct: 69  SEYMKKEFFLMSSPPF---MVQILALVSRIMGSLSIEV------------LRKINLTTTA 113

Query: 150 MCVPLAYFTAKAIGFSLPAVWLFTCMVLFENSYSTL----GRFILLDSMLLFFTVASVFS 205
             V   Y      G     V++ + +     SY +L     + + L +  + F    + S
Sbjct: 114 FVVSSFYLALSRSG----VVFVVSAVTAGSLSYLSLFAENSQHLSLINFQVLFLSCCLLS 169

Query: 206 FVMFHNQRSRPFSRKWWKWLLLTGINLGCTISVKMVGLFVITLVGIYTVIDLLQMLNEKK 265
           +  F  + S  F+R+W+  L    + L  ++S   +G    +   I  +  +  ++ +  
Sbjct: 170 WNSF--KHSTSFTRRWYVALTSLSLFLSLSLSTTFLGAITWSWFLILMIKQMWSIVGDVD 227

Query: 266 MSWKSYTGHWLARIVALICVPMAVFMICFKLHFDLLWHSGTGDANMPSLFQAGLVGSDVG 325
           +S      H   R++ +ICVP  + +  +   F  L +S     N  SL         + 
Sbjct: 228 VSMWKILKHTFWRVLMIICVPFGLMLSSY---FVFLLNSRGAGMNHSSLVSPYFKTWFLP 284

Query: 326 GG---PRDVAIGSSVSIKNQALSGALLHSHVQTYPEGSNQQQVTAYSY-KDANNNWVFHR 381
            G   P  V  GS++ I++    G  LHSH  TY  GS +QQVT   +  DA+N W+   
Sbjct: 285 QGLPQPDAVYYGSNLLIRHAESLGGYLHSHNYTYESGSLEQQVTLVDFSNDADNEWIIEA 344

Query: 382 VREESLWDINETDIEYVVDGAVYRLVHANTQKNLHTHSIAAPVDKKNW--EVSGYGNHT- 438
             E    D     ++ V +G   +L H  + K L   S  APV ++++  EVS  G+H  
Sbjct: 345 QNENLKLD---KTLQPVRNGDFVKLRHRTSGKLLRASSAKAPVSEQDYDHEVSCTGDHDY 401

Query: 439 IGDAKDYWVLEIVDQKGSENTTQVHPLTTSFRLRNKELDCYLAQTGNHLPEWGFRQHEIS 498
            GD+ + W +   ++  + N   + P T  F L NK  DC L      LP+WGF Q E+ 
Sbjct: 402 TGDSDETWRIRF-ERGNTPNEGILCPFTMYFSLENKGHDCKLLSHDLRLPDWGFGQQEVL 460

Query: 499 CV 500
           CV
Sbjct: 461 CV 462

>YDR307W (YDR307W) [1135] chr4 (1075857..1077845) Protein containing
           three MIR (protein mannosyltransferase, IP3R and RyR)
           domains, which may have a ligand transferase function,
           has weak similarity to mannosyltransferase (dolichyl
           phosphate-D-mannose:protein O-D-mannosyltransferase, S.
           cerevisiae Pmt1p) [1989 bp, 662 aa]
          Length = 662

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 75/341 (21%), Positives = 153/341 (44%), Gaps = 25/341 (7%)

Query: 180 NSYSTLGRFILLDSMLLFFTVASVFSFVMFHNQRSRPFSRKWWKWLLLTGINLGCTISVK 239
            ++   G  I  DS+        ++SF+      ++  +  W+  ++   I+LG  IS K
Sbjct: 144 ETFRNEGTIISFDSLEWCLFSVVIYSFISI--SIAKLGTTNWFANVITLSISLGLAISSK 201

Query: 240 MVGLFVITLVGIYTVIDLLQMLNEKKMSWKSYTGHWLARIVALICVPMAVFMICFKLHFD 299
            +G+     V +  V    +++++ K++        +  ++ ++ +P ++F+I +    +
Sbjct: 202 FIGIVTWAFVILSFVRQFDRLISDVKVTTIQIIKFVILCLLFVLIIPGSIFIISYS---N 258

Query: 300 LLWHSGTGDAN----MPSLFQAGLVGSDVGGGPRDVAIGSSVSIKNQALSGALLHSHVQT 355
           LL +  T        M + F++ L G  V   P  +  GS++++++       L SH  +
Sbjct: 259 LLSNFKTDTPQFSKYMSTYFKSYLRGPQVQ--PSRLYYGSTITLRHLDSMVGYLASHDIS 316

Query: 356 YPEGSNQQQVTAYSYKD--ANNNWVF-HRVREESLWDINETDIEYVVD-GAVYRLVHANT 411
           YP   ++Q V A S+++  A+N W+  H     S  ++   D    V+ G   +L H +T
Sbjct: 317 YPSDVDEQLV-ALSFEEFAADNEWLIEHPTLNLSFSEVYHADQLIPVEFGQSIKLRHKST 375

Query: 412 QKNLHTHSIAAPVDKKNWE----VSGYGNHTIGDAKDYWVLEIVDQ-----KGSENTTQV 462
            K L   +   P+ +++++     +   N+  G  + + VL I D+     K + +   +
Sbjct: 376 GKLLRASTAKPPISEQDYDFQISCTKDSNYEGGMDERWDVLLIKDEINNDKKDNADDKYI 435

Query: 463 HPLTTSFRLRNKELDCYLAQTGNHLPEWGFRQHEISCVKDP 503
            PL +  R  N    C L      LPEWG  + E+ C++ P
Sbjct: 436 KPLQSEIRFYNNGQRCGLLGHDLRLPEWGRFEQEVLCMEYP 476

>KLLA0C14828g complement(1292713..1294602) weakly similar to
           sp|Q06644 Saccharomyces cerevisiae YDR307w, start by
           similarity
          Length = 629

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 109/487 (22%), Positives = 188/487 (38%), Gaps = 58/487 (11%)

Query: 212 QRSRPFSRKWWKWLLLTGINLGCTISVKMVGL------FVITLVGIYTVIDLLQMLNEKK 265
           Q S+ FS  W+  + L  ++L   IS K +GL       +++L  ++ V+  L + N + 
Sbjct: 175 QASKDFSVDWYMNITLVSMSLIFVISGKFIGLVSWIWLIIVSLKSLWIVVGDLDVKNRQL 234

Query: 266 MSWKSYTGHWLARIVALICVPMAVFMICFKLHFDLLWHSGTGDANMPSLFQAGLVGSDVG 325
            +          R++  + +P+      +         S    A M S FQ   + S   
Sbjct: 235 FAIM------FCRLLFFVVIPLMSLWYSYSSLIGGFTTSSNSIAYMSSSFQHYSM-SQHN 287

Query: 326 GGPRDVAIGSSVSIKNQALSGALLHSHVQTYPEGSNQQQVTAYSYKDANNNWVFHRVREE 385
             P  +  GSS+ +++    G  L +    YP+ ++     +    D  N W+    +  
Sbjct: 288 DIPSSIIYGSSIRLRHVNSLGGYLSALEIPYPKSNDTLVTVSDDPDDEANFWIIESNKGR 347

Query: 386 SLWDINETDIEYVVDGAVYRLVHANTQKNLHTHSIAAPVDKKNWE----VSGYGNHTIGD 441
           +        +    D    +L +  T + L       P+  K ++    V+G  ++  GD
Sbjct: 348 NTEQTGSNALVKQTDKV--KLRNKKTGQLLRASEEKPPISDKEYDKRISVTGDSDYQ-GD 404

Query: 442 AKDYWVLEIVDQKGSENTTQVHPLTTSFRLRNKELDCYLAQTGNHLPEWGFRQHEISCVK 501
             + W +EI  Q  +     + P      L+N    C L      +P WG R+ E+ CV 
Sbjct: 405 QDELWKIEI--QGKASFREVLRPFKQFIVLKNPARRCSLLSHEIKIPHWGDRRQEVLCV- 461

Query: 502 DPFRRDKRTWWNVESHENEKLPTPEEFK----YPGSGFLKDFI----HLNLAMMATNNAL 553
           DP R + R  + ++   + +    E++K    YP      +++     LN      N ++
Sbjct: 462 DPARVN-RALFYIDFVSSPEAGVVEKYKWAPEYPFYKLAFEYVVGQFRLNKRQNIDNTSM 520

Query: 554 VPESDKFDYLASSAWEWPTLHVGLRLCGWGDNNPKYFLLGTPV-TTWASSVAVISFMILF 612
            P     D L+     WP L          DNN +   +G  +  T   SV V +FM  +
Sbjct: 521 SPP----DCLS-----WPILF---------DNNNQ---IGKILWITSTVSVGVYTFMEAY 559

Query: 613 VVLLLRWQRQYNDFSNKDDFNLFLMG-GFYPILGWGLHFVPFVI-MSRVTYVHHYLPALY 670
               L W    +   N     L          LGW LH   F   + R   V+ Y+P+L 
Sbjct: 560 S--WLSWNIFEDTLLNTTANQLMKREVTLEAFLGWILHLYIFTYSLHRNLSVNQYMPSLL 617

Query: 671 FALIILT 677
           FA+IIL+
Sbjct: 618 FAVIILS 624

>Scas_710.0d
          Length = 271

 Score = 61.2 bits (147), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 73/151 (48%), Gaps = 13/151 (8%)

Query: 576 GLRLCGWGDNNPKYFLLGTPVTTWASSVAVISFMILFVVLLLRWQRQYNDFSNKDDFNLF 635
           G+   G  D +   +LLG  V  W+ +  +  F++L +  L+ WQ       +KD  N  
Sbjct: 2   GISYWGEHDQHLGIYLLGNAVVWWSVTAFIGIFVVLCLSELIAWQVGKPVLQDKDVINFH 61

Query: 636 LMGGFYPILGWGLHFVPFVIMSRVTYVHHYLPALYFALIILTYIIDATTKRWMKSKCGSI 695
           +    Y +LG+ +H  P  +M R  ++HHYLPA YF ++   + +D T    ++ K    
Sbjct: 62  IQVIHY-LLGFAVHIGPSFLMGRQMFLHHYLPAYYFGILAFGHALDITATYVLRRKKNFA 120

Query: 696 MRL--VVFAISIASVVGCFWYF---SPISFG 721
             L  V FA+S       +++F   SPI +G
Sbjct: 121 YTLLAVFFALS-------YYFFKDHSPIIYG 144

>CAGL0J11044g complement(1073988..1076198) weakly similar to
           sp|Q06644 Saccharomyces cerevisiae YDR307w PMT7,
           hypothetical start
          Length = 736

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 99/416 (23%), Positives = 155/416 (37%), Gaps = 86/416 (20%)

Query: 335 SSVSIKN-QALSGALLHSHVQTYPEGSNQQQVTAYSYKDAN-NNWVFHRVREESLWDINE 392
           S+V I++ ++L G L       Y  GS +Q      ++D+  NNW+     E      N 
Sbjct: 325 STVRIRHVESLGGYLSTLPNVNYMSGSFEQIAFLSQFEDSELNNWIIEPSTEAQ----NN 380

Query: 393 TDIEYVVDGAVYRLVHANTQKNLHTHSIAAPVDKK--NWEVSGYGNHTI-GDAKDYWVLE 449
            ++     G+  RL +  T K L   S   P+  +  N EVS  G+    GDA + W   
Sbjct: 381 KEVR---SGSRIRLRNVVTGKLLRASSSRPPMSDQEYNSEVSLTGSANFSGDADETW--- 434

Query: 450 IVDQK---------------GSENTTQVHPLTTSFRLRNKELDCYLAQTGNHLP-EWG-- 491
           ++DQK                SEN   +    + F LRN    C L      LP +W   
Sbjct: 435 LIDQKYVIGKAIPFNKMGLPPSENINALINTNSVFTLRNDGHGCMLLSHDTDLPDDWDSM 494

Query: 492 ------FRQHEISCVKDPFRRDKRTWWNVESHENEKLPTPEEFKYPGSGFLKDFIHLNLA 545
                 F + E++C   P +  K T++  ES  ++   T           LK+   L  +
Sbjct: 495 SSFKPEFHRQELTCNTTPTK--KLTYFMFESVVDQTNDTASRAPLTIHDKLKEVFKLIPS 552

Query: 546 MMATNNALVPESDKFDYLASSAWEWPTLHVGLRLC---------GWGDNNPKYFLLGTPV 596
           M+ TN           +L     E   + +   L           W    P   +   P 
Sbjct: 553 MLKTNYKFNYYIRNSQFLKGRREEDDEIDMQYNLQKFQNRVPPEKWATWRPVSLITKKPS 612

Query: 597 TTWASSVAVISFMILFVV--LLLRW-------------QRQYNDFSNK--------DDFN 633
           + +  S+ V+   +LF +  LL+ W             +R     S++        DD  
Sbjct: 613 SVYIVSIIVLVLYVLFEITNLLISWNPLSFDTPSLMVHKRLLGKISDEWMLQRMMSDD-- 670

Query: 634 LFLMGGFYPILGWGLHFVPFVIMSRVTY----VHHYLPALYFALIILTYIIDATTK 685
            FL+  F   LGW  H   + I +R  +    +  YLP+L F L+ +  I D  TK
Sbjct: 671 -FLLECF---LGWITH---YYIFTRTPHQNLDIVLYLPSLLFNLLFVITIFDTLTK 719

>CAGL0B01705g 157245..159263 highly similar to sp|P46944
           Saccharomyces cerevisiae YDR108w GSG1, start by
           similarity
          Length = 672

 Score = 34.7 bits (78), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 38/68 (55%), Gaps = 6/68 (8%)

Query: 503 PFRRDKRTWWNVESHENEKLPTPEEFKYPGSGFLKDFIHLNLAMMATNNALVPESDKFDY 562
           PF + K T+W       E + TP +  + G+ F K F++ +   ++  N+L+ E+   +Y
Sbjct: 348 PFMKRKMTFWE------ETILTPRKSLFHGAKFFKKFMNKSTQALSQPNSLLKENHGSNY 401

Query: 563 LASSAWEW 570
           L+S++ E+
Sbjct: 402 LSSTSPEF 409

>YGL255W (ZRT1) [1745] chr7 (20978..22108) High-affinity zinc
           transport protein, member of ZIP family of metal ion
           transporters [1131 bp, 376 aa]
          Length = 376

 Score = 34.3 bits (77), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 66/161 (40%), Gaps = 23/161 (14%)

Query: 120 NGSFDFESGHEYPEYVDFVKMRL---FNASFSAMCVPL--AYFTAKAIGFSLPAVWLFTC 174
           NGS D ++G EY E  D   M +   F A F A  +      F +  IG +L +V     
Sbjct: 189 NGSHDTKNGVEYYEDSDATSMDVVQSFQAQFYAFLILEFGVIFHSVMIGLNLGSV----- 243

Query: 175 MVLFENSYSTLGRFILLDSMLLFFTVASVFSFVMFHNQRSRPFSRKWWKWLLLTGINLGC 234
                + +S+L   ++         + +  S + F      P S++WW W L     L  
Sbjct: 244 ----GDEFSSLYPVLVFHQSFEGLGIGARLSAIEF------PRSKRWWPWALCVAYGLTT 293

Query: 235 TISVKMVGLFVIT--LVGIYTVIDLLQMLNEKKMSWKSYTG 273
            I V  +GL V T  + G YT + +  +L+        YTG
Sbjct: 294 PICVA-IGLGVRTRYVSGSYTALVISGVLDAISAGILLYTG 333

>YMR014W (BUD22) [3978] chr13 (298867..300426) Protein with possible
           role in bud site polarity, has possible coiled-coil
           domain [1560 bp, 519 aa]
          Length = 519

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 28/42 (66%), Gaps = 1/42 (2%)

Query: 32  KEDTSKLKDAKVSQSPLLQLEAYL-MPLVFTGLALFVRMYRI 72
           K+++SK+KDA+ ++SP + +E  L   L    LALF+  +R+
Sbjct: 99  KKNSSKVKDAQKNKSPSIDIEKMLATQLSLDDLALFMTRFRL 140

>Scas_715.51
          Length = 341

 Score = 30.0 bits (66), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 4/58 (6%)

Query: 1   MSSTGFQGSEKSDAELKARKQTSVDDVLIEEKEDTSKL----KDAKVSQSPLLQLEAY 54
           M ST  +   KS+ EL+ R +TS++D   ++  D SKL    K  +    P ++LE Y
Sbjct: 140 MISTILEKLIKSNDELRERNETSLNDRTDDDNSDESKLVRSIKSFRGKHIPPIKLEQY 197

>Kwal_47.18077
          Length = 809

 Score = 30.4 bits (67), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 36/77 (46%), Gaps = 2/77 (2%)

Query: 11  KSDAELKARKQTSVDDVLIEEKEDTSKLKDAKVSQSPLLQLEAYLMPLVFTGLALFVRMY 70
           + + E  ARK+  + D   +E +   ++ +  + Q P L     L P    G+   + +Y
Sbjct: 137 QKEEEGPARKRKKITDFFKKETK-KEEIPEPVLHQQPSLLKNCQLKPYQLEGVNWLITLY 195

Query: 71  RIGINGNVVWDEAHFGK 87
             G+NG ++ DE   GK
Sbjct: 196 ENGLNG-ILADEMGLGK 211

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.138    0.444 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 25,163,019
Number of extensions: 1148408
Number of successful extensions: 3816
Number of sequences better than 10.0: 49
Number of HSP's gapped: 3724
Number of HSP's successfully gapped: 50
Length of query: 730
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 621
Effective length of database: 12,822,747
Effective search space: 7962925887
Effective search space used: 7962925887
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 65 (29.6 bits)