Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0J06688g82881638080.0
Scas_650.229931644613e-47
Kwal_27.103189251104275e-43
AAL185W1018984213e-42
KLLA0D01683g944974204e-42
YMR273C (ZDS1)915994185e-42
YML109W (ZDS2)9421634161e-41
CAGL0F03421g817934016e-40
KLLA0A06776g80059703.2
Scas_714.251047669.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J06688g
         (816 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J06688g complement(637917..640403) similar to sp|P54786 Sac...  1471   0.0  
Scas_650.22                                                           182   3e-47
Kwal_27.10318                                                         169   5e-43
AAL185W [2] [Homologous to ScYML109W (ZDS2) - SH; ScYMR273C (ZDS...   166   3e-42
KLLA0D01683g complement(148855..151689) some similarities with s...   166   4e-42
YMR273C (ZDS1) [4227] chr13 complement(811232..813979) Protein t...   165   5e-42
YML109W (ZDS2) [3862] chr13 (51640..54468) Protein involved in r...   164   1e-41
CAGL0F03421g complement(336157..338610) similar to sp|P50111 Sac...   159   6e-40
KLLA0A06776g 612115..614517 some similarities with sp|P36003 Sac...    32   3.2  
Scas_714.2                                                             30   9.6  

>CAGL0J06688g complement(637917..640403) similar to sp|P54786
           Saccharomyces cerevisiae YML109w ZDS2 or sp|P50111
           Saccharomyces cerevisiae YMR273c ZDS1, hypothetical
           start
          Length = 828

 Score = 1471 bits (3808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 738/816 (90%), Positives = 738/816 (90%)

Query: 1   MSRLEVPKRRSRVQKTDGVSSEYLRAAQSLDQEVQNVKNLKRLSIGSIDLITDPELNVTV 60
           MSRLEVPKRRSRVQKTDGVSSEYLRAAQSLDQEVQNVKNLKRLSIGSIDLITDPELNVTV
Sbjct: 1   MSRLEVPKRRSRVQKTDGVSSEYLRAAQSLDQEVQNVKNLKRLSIGSIDLITDPELNVTV 60

Query: 61  TGTEREDTSYDADLSNGSFXXXXXXXXXXXGSDADETSASIDRTRVEYLTSYDNTQESSN 120
           TGTEREDTSYDADLSNGSF           GSDADETSASIDRTRVEYLTSYDNTQESSN
Sbjct: 61  TGTEREDTSYDADLSNGSFTEEDDTTTEIDGSDADETSASIDRTRVEYLTSYDNTQESSN 120

Query: 121 ESPKGVARTRSLNLNYHANSNSDISIKERTLRGSRSLSNLKKPKNEEQSVSDKLFWVPAN 180
           ESPKGVARTRSLNLNYHANSNSDISIKERTLRGSRSLSNLKKPKNEEQSVSDKLFWVPAN
Sbjct: 121 ESPKGVARTRSLNLNYHANSNSDISIKERTLRGSRSLSNLKKPKNEEQSVSDKLFWVPAN 180

Query: 181 QHPNVKPENYLELVKETLNKIRDINTDGXXXXXXXXXXXXXXXXXXXXXGRLRGSIVRRP 240
           QHPNVKPENYLELVKETLNKIRDINTDG                     GRLRGSIVRRP
Sbjct: 181 QHPNVKPENYLELVKETLNKIRDINTDGKEKSENNSEEEVSNKENINENGRLRGSIVRRP 240

Query: 241 SKLRKSYTEFSSEDLELLDKALXXXXXXXXXXXXXXKRLSLKEITNELVKHSNKAGLTDD 300
           SKLRKSYTEFSSEDLELLDKAL              KRLSLKEITNELVKHSNKAGLTDD
Sbjct: 241 SKLRKSYTEFSSEDLELLDKALSNNRIISTRNTTNSKRLSLKEITNELVKHSNKAGLTDD 300

Query: 301 NAVTLARTLSIASSVTNQNETGRNDQSNTEQQKQSEXXXXXXXXXXVVGNSHSLASNTSS 360
           NAVTLARTLSIASSVTNQNETGRNDQSNTEQQKQSE          VVGNSHSLASNTSS
Sbjct: 301 NAVTLARTLSIASSVTNQNETGRNDQSNTEQQKQSEDADDDTFATAVVGNSHSLASNTSS 360

Query: 361 LRRSKFNTYRVKAGQQRGISRSNYIDSTNRTDNLIARHTWETPLKDSYDEHSTSYHNKQH 420
           LRRSKFNTYRVKAGQQRGISRSNYIDSTNRTDNLIARHTWETPLKDSYDEHSTSYHNKQH
Sbjct: 361 LRRSKFNTYRVKAGQQRGISRSNYIDSTNRTDNLIARHTWETPLKDSYDEHSTSYHNKQH 420

Query: 421 SILDSNIPVVTTVSDDNHXXXXXXXXXXXXXXXXXXXXXXILNRPEHSYSYVSEKLDREI 480
           SILDSNIPVVTTVSDDNH                      ILNRPEHSYSYVSEKLDREI
Sbjct: 421 SILDSNIPVVTTVSDDNHDISGSSFSQDSSMVSSDSTSNSILNRPEHSYSYVSEKLDREI 480

Query: 481 EKTDQFSNLGSSENKIDEPTVDTKRPSLEHRITGATEIKDKNLEQSAISNHQTIQKNTFI 540
           EKTDQFSNLGSSENKIDEPTVDTKRPSLEHRITGATEIKDKNLEQSAISNHQTIQKNTFI
Sbjct: 481 EKTDQFSNLGSSENKIDEPTVDTKRPSLEHRITGATEIKDKNLEQSAISNHQTIQKNTFI 540

Query: 541 EKKERLDKKISNLFKRKKGKKTDNVLEADVPLEKDNCYDIISSESQEEIGNVIPRTTSPE 600
           EKKERLDKKISNLFKRKKGKKTDNVLEADVPLEKDNCYDIISSESQEEIGNVIPRTTSPE
Sbjct: 541 EKKERLDKKISNLFKRKKGKKTDNVLEADVPLEKDNCYDIISSESQEEIGNVIPRTTSPE 600

Query: 601 SIRGGSLISFTNSADDIDVKSYQSDNQQRRLSDEVVEYVQELEEDSRELSGSDIFNDLND 660
           SIRGGSLISFTNSADDIDVKSYQSDNQQRRLSDEVVEYVQELEEDSRELSGSDIFNDLND
Sbjct: 601 SIRGGSLISFTNSADDIDVKSYQSDNQQRRLSDEVVEYVQELEEDSRELSGSDIFNDLND 660

Query: 661 EYNRHLEYSIDNSNESVSINQSYSLHTDEPNKVGKPKKLTFDDVKKPERANAPMEFTDSA 720
           EYNRHLEYSIDNSNESVSINQSYSLHTDEPNKVGKPKKLTFDDVKKPERANAPMEFTDSA
Sbjct: 661 EYNRHLEYSIDNSNESVSINQSYSLHTDEPNKVGKPKKLTFDDVKKPERANAPMEFTDSA 720

Query: 721 FGFPLPPLTISTVIMCDHRLGINVERAIYRLSHLKLSETNRELRQQVLLSNFMYAYLNLV 780
           FGFPLPPLTISTVIMCDHRLGINVERAIYRLSHLKLSETNRELRQQVLLSNFMYAYLNLV
Sbjct: 721 FGFPLPPLTISTVIMCDHRLGINVERAIYRLSHLKLSETNRELRQQVLLSNFMYAYLNLV 780

Query: 781 EHTLSVEEAEQDKQSTSSPDNKVVELEGSNYNTAHN 816
           EHTLSVEEAEQDKQSTSSPDNKVVELEGSNYNTAHN
Sbjct: 781 EHTLSVEEAEQDKQSTSSPDNKVVELEGSNYNTAHN 816

>Scas_650.22
          Length = 993

 Score =  182 bits (461), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 98/164 (59%), Positives = 126/164 (76%), Gaps = 5/164 (3%)

Query: 631 LSDEVVEYVQEL-EEDSRELSGSDIFNDLNDEYNRHLEYSIDNSNESVSI-NQSYSLHT- 687
           LS  +VE V+EL E+DS+++SG D+  ++++      E ++ NS++  SI N S  ++T 
Sbjct: 786 LSASIVETVRELGEDDSQDISGGDLSTEVDNSM--LAERNVMNSSDLQSIENSSDDINTG 843

Query: 688 DEPNKVGKPKKLTFDDVKKPERANAPMEFTDSAFGFPLPPLTISTVIMCDHRLGINVERA 747
           +    V   +KLTF DVK+P+R NAP++FTDSAFGFPLP LT+STVIM DHRLGINVERA
Sbjct: 844 NTIEHVLPARKLTFADVKRPDRPNAPIQFTDSAFGFPLPMLTVSTVIMFDHRLGINVERA 903

Query: 748 IYRLSHLKLSETNRELRQQVLLSNFMYAYLNLVEHTLSVEEAEQ 791
           IYRLSHLKLS++ RELRQQVLLSNFMYAYLNLV HTL +E+  Q
Sbjct: 904 IYRLSHLKLSDSKRELRQQVLLSNFMYAYLNLVNHTLYMEQVAQ 947

 Score =  108 bits (270), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 82/239 (34%), Positives = 107/239 (44%), Gaps = 46/239 (19%)

Query: 174 LFWVPANQHPNVKPENYLELVKETLNKIR----------------------DINTDGXXX 211
           L WVPANQHPNVKPENYLELV++TL  I                       DI+      
Sbjct: 200 LLWVPANQHPNVKPENYLELVQDTLQNIHLEEPASSLQHENEKSNNNKENIDISKSNMSE 259

Query: 212 XXXXXXXXXXXXXXXXXXGRLRGSIVRRPSKLRKSYTEFSSEDLELLDKA---------- 261
                                  S+VRRPS+LR SYTEF  +D    +++          
Sbjct: 260 EEPIDRHPQSLDKTFLEITNRNRSLVRRPSRLRTSYTEFEEDDYSNSEESEAKTNESQLS 319

Query: 262 --------LXXXXXXXXXXXXXXKRLSLKEITNELVKHSNKAGLTDDNAVTLARTLSIAS 313
                                  + +SLK+IT EL   SNKAGLTD +A+TLARTLS+AS
Sbjct: 320 SREEKPFLFNDRNGLNQLRNFSQRSVSLKDITEELTNISNKAGLTDSDAITLARTLSMAS 379

Query: 314 SVTNQNETGRNDQSNTEQQKQSEXXXXXXXXXXVVGNSHSLASNTSSLRRSKFNTYRVK 372
           S ++ N      +   E  ++SE           + N  ++    SSLRRSKFNTYR++
Sbjct: 380 SFSDGNVNLGKSKLQNESNEESE-----FASNMFMKNGLTIPER-SSLRRSKFNTYRIR 432

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 34/44 (77%)

Query: 17 DGVSSEYLRAAQSLDQEVQNVKNLKRLSIGSIDLITDPELNVTV 60
          D   SE L AAQSLD EVQ+VKNLKRLSIGS+DL+ DPEL   V
Sbjct: 22 DKRKSEVLIAAQSLDNEVQSVKNLKRLSIGSMDLLIDPELEFRV 65

>Kwal_27.10318
          Length = 925

 Score =  169 bits (427), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 94/110 (85%), Gaps = 1/110 (0%)

Query: 696 PKKLTFDDVKKPERANAPMEFTDSAFGFPLPPLTISTVIMCDHRLGINVERAIYRLSHLK 755
           P+KLTF DV KPER N+PM+F+DS+FGFPLPPLTISTV+M DHRL INVERAIYRLSHLK
Sbjct: 813 PRKLTFSDVVKPERPNSPMKFSDSSFGFPLPPLTISTVVMIDHRLTINVERAIYRLSHLK 872

Query: 756 LSETNRELRQQVLLSNFMYAYLNLVEHTLSVEEAEQDKQS-TSSPDNKVV 804
           L +  RELRQQV+LSNFMYAYLNLV H+L +++ E+D  + ++S DN+ V
Sbjct: 873 LGDPKRELRQQVVLSNFMYAYLNLVNHSLYLQQLEEDNPADSASNDNQGV 922

 Score =  154 bits (389), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 138/385 (35%), Positives = 187/385 (48%), Gaps = 55/385 (14%)

Query: 12  RVQKTDGVSSEYLRAAQSLDQEVQNVKNLKRLSIGSIDLITDPELNVTVTGTEREDTSYD 71
           R  +++   SE L AAQSLD E+Q+VKNLKR+S GS+DL  DPE+   ++ +  + +S  
Sbjct: 26  RSARSEKRKSEVLIAAQSLDSELQHVKNLKRMSFGSMDLPLDPEMEFRMSPSHSQRSSSS 85

Query: 72  ADLSNGSFXXXXXXXXXXXGSDADETSA----SIDRTRVEYLTSYDNTQESSNESPKGVA 127
             +S                 D+D+  +    SI+ T  EYL           E P+   
Sbjct: 86  DAVS-----LESQAEEPNQDDDSDDNLSYLNDSIELTAHEYL-----------EEPRDFL 129

Query: 128 RTRSLNLNYHANSNSDISIKERTLRGSRSLSNLKKPK----NEEQSVSDKLFWVPANQHP 183
             RS      + S S+ S   R L G R     KKP+      + +V+  LFWVPANQHP
Sbjct: 130 VERS------SVSKSEDSHNGRNLSGVRRGGMSKKPRELSNGGDDNVTQNLFWVPANQHP 183

Query: 184 NVKPENYLELVKETLNKIR---DINTDGXXXXXXXXXXXXXXXXXXXXXGRLRG---SIV 237
           NVKPENYLELV++TL+ +    ++                          +LR    S+V
Sbjct: 184 NVKPENYLELVQDTLHTLSIDSEVEPPTDKTVEGNNPYLASANTKASPSSQLRSGQNSLV 243

Query: 238 RRPSKLRKSYTEFSSEDL---ELLDKALXXXXXXXXXXXXXXKRL-------SLKEITNE 287
           RRPS LRKSYTE   EDL   E+ D                  R        SLK+IT E
Sbjct: 244 RRPSGLRKSYTEL--EDLLQHEIQDSDENNENAQSELNNIIKNRPRATSSGSSLKDITEE 301

Query: 288 LVKHSNKAGLTDDNAVTLARTLSIASSVTNQNETGRNDQSNTEQQKQSEXXXXXXXXXXV 347
           L + SNKAG TD +AV LARTLS+ASS   + ++  N  +NT+    SE          +
Sbjct: 302 LTRISNKAGFTDGDAVCLARTLSMASSYDGE-QSQANQSANTDHTPDSE-----YASTIL 355

Query: 348 VGNSHSLASNTSSLRRSKFNTYRVK 372
             N  ++ +  SSLRRSKFNTYR++
Sbjct: 356 TKNGLAIPAR-SSLRRSKFNTYRIR 379

>AAL185W [2] [Homologous to ScYML109W (ZDS2) - SH; ScYMR273C (ZDS1)
           - SH] complement(9537..12593) [3057 bp, 1018 aa]
          Length = 1018

 Score =  166 bits (421), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 86/98 (87%)

Query: 696 PKKLTFDDVKKPERANAPMEFTDSAFGFPLPPLTISTVIMCDHRLGINVERAIYRLSHLK 755
           P+KL FDDV +PE+ N+PM+FT SAFGFPLPPLT+STVIM DHRL I VERAIYRLSHLK
Sbjct: 898 PRKLRFDDVLRPEKPNSPMKFTPSAFGFPLPPLTVSTVIMFDHRLPIYVERAIYRLSHLK 957

Query: 756 LSETNRELRQQVLLSNFMYAYLNLVEHTLSVEEAEQDK 793
           LS+  RELRQQVLLSNFMY+YLNLV H+L +++ E+DK
Sbjct: 958 LSDPKRELRQQVLLSNFMYSYLNLVNHSLYLQQIEEDK 995

 Score =  143 bits (361), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 123/366 (33%), Positives = 176/366 (48%), Gaps = 33/366 (9%)

Query: 21  SEYLRAAQSLDQEVQNVKNLKRLSIGSIDLITDPELNVTVTGTEREDTSYDAD-LSNGSF 79
           SE L AAQSLD E+QNVKNLKR+SIGS+DL+ DPE+   + G     ++   + L+  S 
Sbjct: 75  SEVLIAAQSLDYELQNVKNLKRISIGSMDLLMDPEMEFRMNGAAVSPSASPRNSLTEESL 134

Query: 80  XXXXXXXXXXXGS---------DADETS-ASIDRTRVEYLTSYDNTQESSNESPKGVART 129
                      G          DA  ++  S D  R E LTS  +   S       ++ +
Sbjct: 135 EWFQLSAEQEQGGELPLHAESIDAHSSAGGSSDTARDELLTSASSVVPSEE-----LSCS 189

Query: 130 RSLNLNYHANSNSDISIKERTLRGSRSLSNLKKPKNEEQSVSDKLFWVPANQHPNVKPEN 189
             L+    A  ++ +S + +  R     ++ K+   E    S  L WV A+QHPNVKPEN
Sbjct: 190 HPLSPPAAAKKSTLMSSRSKLGRQHTDTTHTKQATGEP--FSSNLLWVRADQHPNVKPEN 247

Query: 190 YLELVKETLNKIRDINTDGXXXXXXXXXXXXXXXXXXXXXGRLRGSIVRRPSKLRKSYTE 249
           YLELV +TLN +R I                            R S+VR+ S+LRKS+TE
Sbjct: 248 YLELVHDTLNNLR-IGARHGRGDSPVQQSNTPVANGESSTASAR-SLVRKQSRLRKSFTE 305

Query: 250 FSSEDLELLDKALXXXXXXXXXXXXXXKRL-SLKEITNELVKHSNKAGLTDDNAVTLART 308
                +E ++++                R+ SLKEIT EL + SN AGLTD +A+TLART
Sbjct: 306 -----VEAIEESQFTDSIGSEIPVGKRMRVSSLKEITEELTRISNNAGLTDSDAITLART 360

Query: 309 LSIASSVTNQNETGRNDQSNTEQQKQSEXXXXXXXXXXVVGNSHSLASNTSSLRRSKFNT 368
           L I S   +++ T       +E    +E          +  N  ++ +  SSLRRSKF T
Sbjct: 361 LGIGSQSADEHAT------FSECVPSAEAEENEYASSILAKNGLAIPAR-SSLRRSKFTT 413

Query: 369 YRVKAG 374
           YR+++ 
Sbjct: 414 YRIRSA 419

>KLLA0D01683g complement(148855..151689) some similarities with
           sp|P54786 Saccharomyces cerevisiae YML109w ZDS2
           multicopy suppressor of SIN4, hypothetical start
          Length = 944

 Score =  166 bits (420), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 86/97 (88%)

Query: 696 PKKLTFDDVKKPERANAPMEFTDSAFGFPLPPLTISTVIMCDHRLGINVERAIYRLSHLK 755
           P+KLTF DV KP+R N+PM+FTDSAFGFPLPPLTISTVIM DHRL I+VERAIYRLSHLK
Sbjct: 826 PRKLTFADVLKPDRPNSPMKFTDSAFGFPLPPLTISTVIMFDHRLPIHVERAIYRLSHLK 885

Query: 756 LSETNRELRQQVLLSNFMYAYLNLVEHTLSVEEAEQD 792
           LS+  R LRQQVLLSNFMYAYLNLV H+L +++ E++
Sbjct: 886 LSDPKRVLRQQVLLSNFMYAYLNLVNHSLYLQQIEEE 922

 Score =  117 bits (293), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 80/209 (38%), Positives = 107/209 (51%), Gaps = 17/209 (8%)

Query: 168 QSVSDKLFWVPANQHPNVKPENYLELVKETLNKIRDINTDGXXXXXXXXXXXXXXXXXXX 227
           +S+   L WV A+QHPNVKPENYLELV+ TL    ++N  G                   
Sbjct: 186 ESLGQNLLWVRADQHPNVKPENYLELVQNTL---ENMNLGGRSPTANETQAQSLSGLKTL 242

Query: 228 XXGRLRG--SIVRRPSKLRKSYTEFSSEDLELLDKALXXXXXXXXXXXXXXKR-LSLKEI 284
               ++   S+ RRPS+LR SYTE S +D    DK +              +R +SLK+I
Sbjct: 243 RKRSMQSGNSLARRPSRLRTSYTELSEDD---EDKGMTDQPLAAAAPTMSSRRTVSLKDI 299

Query: 285 TNELVKHSNKAGLTDDNAVTLARTLSIASSVTNQNETGRNDQSNTEQQKQSEXXXXXXXX 344
           T EL K SN+AGLTD +AVTLARTL +A   T  + TG+   +N   +++          
Sbjct: 300 TEELTKLSNQAGLTDTDAVTLARTLWVADESTT-DSTGQGLSNNLADEEEEFASTMFTKS 358

Query: 345 XXVVGNSHSLASNTSSLRRSKFNTYRVKA 373
              V   H       SLRRSKFNTYR+++
Sbjct: 359 GFTVPARH-------SLRRSKFNTYRIQS 380

>YMR273C (ZDS1) [4227] chr13 complement(811232..813979) Protein that
           regulates SWE1 and CLN2 transcription, Sir3p
           phosphorylation, rDNA recombination and silencing, and
           life span, involved in high calcium tolerance and
           regulation of beta-1,3 glucan biosynthesis [2748 bp, 915
           aa]
          Length = 915

 Score =  165 bits (418), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 74/99 (74%), Positives = 86/99 (86%)

Query: 696 PKKLTFDDVKKPERANAPMEFTDSAFGFPLPPLTISTVIMCDHRLGINVERAIYRLSHLK 755
           P+KLTF DVKKP++ N+P++FTDSAFGFPLP LT+STVIM DHRL INVERAIYRLSHLK
Sbjct: 808 PRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSHLK 867

Query: 756 LSETNRELRQQVLLSNFMYAYLNLVEHTLSVEEAEQDKQ 794
           LS + R LR+QVLLSNFMYAYLNLV HTL +E+   DK+
Sbjct: 868 LSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVAHDKE 906

 Score =  147 bits (370), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 132/398 (33%), Positives = 189/398 (47%), Gaps = 81/398 (20%)

Query: 17  DGVSSEYLRAAQSLDQEVQNVKNLKRLSIGSIDLITDPELNVTVTGTEREDTSYDADLSN 76
           D   SE L AAQSLD E+++VKNLKRLSIGS+DL+ DPEL++   G      S+    S+
Sbjct: 24  DKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKFGGESSGRRSWSGTTSS 83

Query: 77  GSFXXXXXXXXXXXGSDADETSASIDRTRVEYLTSYDNTQ-ESSNESPKGVARTRSLNLN 135
            +             +  + T  S D T +E L    N+  ESSN++ +G         N
Sbjct: 84  SA-------SMPSDTTTVNNTRYS-DPTPLENLHGRGNSGIESSNKTKQG---------N 126

Query: 136 YHANSNSDISIKERTLRGSRSLSN--LKKPKNEEQSVSDKLFWVPANQHPNVKPENYLEL 193
           Y       + IK+     SR L+   LKK           L WVPANQHPNVKP+N+LEL
Sbjct: 127 Y-------LGIKKGVHSPSRKLNANVLKK----------NLLWVPANQHPNVKPDNFLEL 169

Query: 194 VKETLNKIR----------------DINTDGXXXXXXXXXXXXXXXXXXXXXGRLRG--S 235
           V++TL  I+                DI  +G                         G  S
Sbjct: 170 VQDTLQNIQLSDNGEDNDGNSNENNDIEDNGEDKESQSYENKENNTINLNRGLSRHGNAS 229

Query: 236 IVRRPSKLRKSYTEF------------SSEDLELLDKALXXXXXXXXXXXXXXKRLSLKE 283
           ++RRPS LR+SYTEF            +SE +  +++ +              + +SL++
Sbjct: 230 LIRRPSTLRRSYTEFDDNEDDDNKGDSASETVNKVEERISKIKE---------RPVSLRD 280

Query: 284 ITNELVKHSNKAGLTDDNAVTLARTLSIASSVTNQNET----GRNDQSNTE-QQKQSEXX 338
           IT EL K SN AGLTD++A+TLARTLS+A S +++ +     G  D+ +      Q+   
Sbjct: 281 ITEELTKISNSAGLTDNDAITLARTLSMAGSYSDKKDQPQPEGHYDEGDIGFSTSQANTL 340

Query: 339 XXXXXXXXVVGNSHSLASNTSSLRRSKFNTYRVKAGQQ 376
                   +  N+       SSLRRS+FNTYR+++ +Q
Sbjct: 341 DDGEFASNMPINNTMTWPERSSLRRSRFNTYRIRSQEQ 378

>YML109W (ZDS2) [3862] chr13 (51640..54468) Protein involved in
           regulation of transcriptional silencing and life span,
           multicopy suppressor of sin4 [2829 bp, 942 aa]
          Length = 942

 Score =  164 bits (416), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 113/163 (69%), Gaps = 9/163 (5%)

Query: 632 SDEVVEYVQELE-EDSRELSGSDIFNDLNDEYNRHLEYSIDNS---NESVSINQSYSLHT 687
           S+ VVE + EL+ +DS ++SG D+    N +   H   S D +    E +   +  +   
Sbjct: 754 SEFVVETISELDGDDSFDISGGDV----NYDVEVHSSISRDTTAGLEEDIGAEREDNTSP 809

Query: 688 DEPN-KVGKPKKLTFDDVKKPERANAPMEFTDSAFGFPLPPLTISTVIMCDHRLGINVER 746
             P      P+KLTF+DV KP+ +NAP++FTDSAFGFPLP +T STVIM DHRLGINVER
Sbjct: 810 TAPQISTLPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVER 869

Query: 747 AIYRLSHLKLSETNRELRQQVLLSNFMYAYLNLVEHTLSVEEA 789
           AIYRLSHLKLS+  RELRQQVLLSNFMY+YLNLV HTL +E+ 
Sbjct: 870 AIYRLSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQV 912

 Score =  149 bits (376), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 132/375 (35%), Positives = 188/375 (50%), Gaps = 50/375 (13%)

Query: 21  SEYLRAAQSLDQEVQNVKNLKRLSIGSIDLITDPELNVTVTGTEREDTSYDADLSNGSFX 80
           S+ L AA+SLD E+QNVKNLKRLSIGS+DL+ DPEL   V       +    +    S  
Sbjct: 50  SDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFKVNSRNSYSSDSSKESLQESLH 109

Query: 81  XXX---XXXXXXXGS---------DADETSASIDRTRVEYLTSYDNTQESSNESPKGVAR 128
                        GS         DA     SID T+ EYL  +D   E + E  K +  
Sbjct: 110 EENIIRSEQKEEQGSEDNDAYEEGDATNVDDSIDITQTEYL--HD---EETLEKEKIIR- 163

Query: 129 TRSLNLNYHANSNSDISIKERTLRGSRSLSN--LKKPKNEEQS----VSDKLFWVPANQH 182
               N +   +S++ ++ + R L G ++L++  +   +N+  S    ++  L WVPA+QH
Sbjct: 164 ----NASSSTSSSARVTSRNRRLSGVKTLAHDVVLDVENDHDSKMVDLTQNLLWVPADQH 219

Query: 183 PNVKPENYLELVKETLNKIRDINTDGXXXXXXXXXXXXXXXXXXXXXGRLR-GSIVRRPS 241
           PNVKPENYLEL+++TL  I+ I+T+                       R R GS+VRRPS
Sbjct: 220 PNVKPENYLELIQDTLQNIQ-ISTN-----QDIDENKLELGNNHVISNRKRTGSVVRRPS 273

Query: 242 KLRKSYTEFSSEDLELLDKA----LXXXXXXXXXXXXXXKRLSLKEITNELVKHSNKAGL 297
           +L+ SYT+F  E   L DK     +              + +SLKEIT EL K SN AGL
Sbjct: 274 RLKTSYTKFDDEP-PLADKPQEGEIQVDKRISSSDIKTIRSVSLKEITEELTKISNNAGL 332

Query: 298 TDDNAVTLARTLSIASSVTNQNETGRNDQSNTEQQKQSEXXXXXXXXXXVVGNSHSLASN 357
           TD +AVTLAR+LS++ S TN++     + +  + +  S           +   +      
Sbjct: 333 TDSDAVTLARSLSMSGSFTNESLHLNGNHTENDNEFAS----------NMFNETGLTIPE 382

Query: 358 TSSLRRSKFNTYRVK 372
            SSLRRSKFNTY+++
Sbjct: 383 RSSLRRSKFNTYKIR 397

>CAGL0F03421g complement(336157..338610) similar to sp|P50111
           Saccharomyces cerevisiae YMR273c ZDS1, hypothetical
           start
          Length = 817

 Score =  159 bits (401), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 82/93 (88%)

Query: 696 PKKLTFDDVKKPERANAPMEFTDSAFGFPLPPLTISTVIMCDHRLGINVERAIYRLSHLK 755
           P+KLTF DVKK ++ANAP+EFTDSAFGFPLP LT STVIM DHRL I+VERAIYRLSHLK
Sbjct: 723 PRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVIMFDHRLPIHVERAIYRLSHLK 782

Query: 756 LSETNRELRQQVLLSNFMYAYLNLVEHTLSVEE 788
           LS + R LR+QVLLSNFMY+YLNLV HTL +E+
Sbjct: 783 LSNSKRALREQVLLSNFMYSYLNLVNHTLYMEQ 815

 Score =  129 bits (325), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 118/373 (31%), Positives = 180/373 (48%), Gaps = 37/373 (9%)

Query: 21  SEYLRAAQSLDQEVQNVKNLKRLSIGSIDLITDPELNVTVTGTEREDTSYDADLSNGSFX 80
           SE   AAQSLD+E+++VKNLKRLSIGS+DL+ DPE+++        + S+   L  G   
Sbjct: 6   SEVYIAAQSLDKELRSVKNLKRLSIGSMDLLMDPEMDMLPYNNGYRN-SWSTQLEQGD-- 62

Query: 81  XXXXXXXXXXGSDADETSASIDRT-RVEY-----------LTSYDNTQESSNESPKGVAR 128
                      SD    ++ I R  R+ +            T  +NT++    SPK + R
Sbjct: 63  ---KPLKSTRYSDPTHYNSKIVRQERLPFKQNQPQKSDKEQTQVENTKKQPG-SPKSLTR 118

Query: 129 TRSLNLNYHANSNSDISIKERTLRGSRSLSNLKKPKNEEQSVSDKLFWVPANQHPNVKPE 188
             ++N           S +    R + S ++ K        V+  L WV A+QHPNVKPE
Sbjct: 119 RGAVNF----------SSRRPVDRSNHSKNSSKINDTLPDEVAQNLLWVRADQHPNVKPE 168

Query: 189 NYLELVKETLNKIR-DINTDGXXXXXXXXXXXXXXXXXXXXXGRLRGSIVRRPSKLRKSY 247
           NY+ELV++ L+ I+ D   +                            +VRRPS LRKSY
Sbjct: 169 NYIELVQDALHNIQIDKTEEHDKENSDTLDKVSRYYNSNNKRSPNNTGLVRRPSLLRKSY 228

Query: 248 TEFSSEDLELLDKALXXXXXXXXXXXXXXKRLSLKEITNELVKHSNKAGLTDDNAVTLAR 307
           TEF  ++++  D                 K+ +LK+IT EL + SNKAGLT+++AVTLAR
Sbjct: 229 TEF--DEVKDSDIKEQSSTNNNVDSTPHNKKFTLKDITEELTRISNKAGLTNNDAVTLAR 286

Query: 308 TLSIASSVTNQNETG---RNDQSNTEQQKQSEXXXXXXXXXXVVGNSHSLASNTSSLRRS 364
           TLS+A SV  ++ET       ++  +  +QS           ++     + S  S+L+RS
Sbjct: 287 TLSMA-SVAEEDETDDLQERPEAEDDYARQSRNNDDNYASTMLLPTDSLIKSEHSTLKRS 345

Query: 365 KFNTYRVKAGQQR 377
           K+ TY ++  + +
Sbjct: 346 KY-TYHIRTQEDK 357

>KLLA0A06776g 612115..614517 some similarities with sp|P36003
           Saccharomyces cerevisiae YKL171w singleton, hypothetical
           start
          Length = 800

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 5/59 (8%)

Query: 651 GSDIFNDLNDEYNRHLEY--SIDNSNESVSINQSYSLHTDEPNKVGKPKK---LTFDDV 704
           G  +FND+ DEY    ++  ++     S   N     +T EP+ +GKP+K   L  DD+
Sbjct: 215 GLPLFNDMQDEYIPDFDFAEAVSQWQSSDDTNMLSRFNTWEPDYLGKPQKESVLKLDDL 273

>Scas_714.2
          Length = 510

 Score = 30.0 bits (66), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 28/47 (59%)

Query: 639 VQELEEDSRELSGSDIFNDLNDEYNRHLEYSIDNSNESVSINQSYSL 685
           + E+  DS E   +  +N +N+E+ R+L+  ++N N S  IN++  L
Sbjct: 70  IMEIMADSSEYPANVDWNTVNEEFKRYLKLFLNNPNMSDQINETIIL 116

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.307    0.125    0.334 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 25,200,410
Number of extensions: 1111395
Number of successful extensions: 4988
Number of sequences better than 10.0: 178
Number of HSP's gapped: 5112
Number of HSP's successfully gapped: 193
Length of query: 816
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 706
Effective length of database: 12,788,129
Effective search space: 9028419074
Effective search space used: 9028419074
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 66 (30.0 bits)