Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0J06666g1121045274e-71
KLLA0D01661g1121003401e-42
AAL184W1121023166e-39
YML108W1051053114e-38
Kwal_27.103281271043002e-36
Sklu_767.199962801e-33
Scas_650.23*1151062769e-33
Sklu_2430.3626101611.6
Scas_650.1165643602.4
Sklu_2172.143247592.8
Scas_665.30143956583.7
KLLA0B14080g32241566.0
KLLA0A06039g65750566.3
YPR078C37249566.6
YOL072W (THP1)45544559.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J06666g
         (111 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J06666g complement(636953..637291) similar to sp|Q03759 Sac...   207   4e-71
KLLA0D01661g complement(148193..148531) similar to sp|Q03759 Sac...   135   1e-42
AAL184W [3] [Homologous to ScYML108W - SH] complement(12906..132...   126   6e-39
YML108W (YML108W) [3863] chr13 (54793..55110) Protein of unknown...   124   4e-38
Kwal_27.10328                                                         120   2e-36
Sklu_767.1 YML108W, Contig c767 652-951 reverse complement            112   1e-33
Scas_650.23*                                                          110   9e-33
Sklu_2430.3 YMR106C, Contig c2430 3786-5666                            28   1.6  
Scas_650.11                                                            28   2.4  
Sklu_2172.1 YDR148C, Contig c2172 307-1605                             27   2.8  
Scas_665.30                                                            27   3.7  
KLLA0B14080g complement(1238559..1239527) similar to sp|P47120 S...    26   6.0  
KLLA0A06039g 557368..559341 weakly similar to sp|P36023 Saccharo...    26   6.3  
YPR078C (YPR078C) [5504] chr16 complement(697142..698260) Protei...    26   6.6  
YOL072W (THP1) [4747] chr15 (194969..196336) Protein involved in...    26   9.8  

>CAGL0J06666g complement(636953..637291) similar to sp|Q03759
           Saccharomyces cerevisiae YML108w, start by similarity
          Length = 112

 Score =  207 bits (527), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 104/104 (100%), Positives = 104/104 (100%)

Query: 1   MSNLYRMMVLLEEPMEEDITISDSKEEKKVMHEFMDELTLPFQIDEIDLLNKWFDKFDDE 60
           MSNLYRMMVLLEEPMEEDITISDSKEEKKVMHEFMDELTLPFQIDEIDLLNKWFDKFDDE
Sbjct: 1   MSNLYRMMVLLEEPMEEDITISDSKEEKKVMHEFMDELTLPFQIDEIDLLNKWFDKFDDE 60

Query: 61  ICIPNEGHIKYEITSDGLIVLILDKELGEEFVGKVKTFVEQNNV 104
           ICIPNEGHIKYEITSDGLIVLILDKELGEEFVGKVKTFVEQNNV
Sbjct: 61  ICIPNEGHIKYEITSDGLIVLILDKELGEEFVGKVKTFVEQNNV 104

>KLLA0D01661g complement(148193..148531) similar to sp|Q03759
           Saccharomyces cerevisiae YML108w hypothetical protein
           singleton, start by similarity
          Length = 112

 Score =  135 bits (340), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 83/100 (83%), Gaps = 3/100 (3%)

Query: 3   NLYRMMVLLEEPMEEDITISDSKEEKKVMHEFMDELTLPFQIDEIDLLNKWFDKFDDEIC 62
           N+YRM++LLEEP+ E  +  D+K+++   HEF+DEL LP Q+DE+DLLN WFDKFD++IC
Sbjct: 6   NVYRMLILLEEPISE--SAGDTKKKQNATHEFVDELPLPIQVDEMDLLNSWFDKFDEKIC 63

Query: 63  IPNEGHIKYEITSDGLIVLILDKELGEEFVGKVKTFVEQN 102
           IPNEGHIKYEI+SDGLIVLILDK + E  V +V +FVEQN
Sbjct: 64  IPNEGHIKYEISSDGLIVLILDKSI-EHIVQEVTSFVEQN 102

>AAL184W [3] [Homologous to ScYML108W - SH] complement(12906..13244)
           [339 bp, 112 aa]
          Length = 112

 Score =  126 bits (316), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 61/102 (59%), Positives = 80/102 (78%), Gaps = 3/102 (2%)

Query: 3   NLYRMMVLLEEPMEEDITISDSKEEKKVMHEFMDELTLPFQIDEIDLLNKWFDKFDDEIC 62
           N YRMM+LLEEP ++  T  D ++ +   H+F+DEL LP Q+D++++LN WFDKFD+EIC
Sbjct: 5   NFYRMMILLEEPHKQHST--DGRKIENASHDFVDELLLPIQVDDLEVLNTWFDKFDEEIC 62

Query: 63  IPNEGHIKYEITSDGLIVLILDKELGEEFVGKVKTFVEQNNV 104
           IPNEGHIKYEI+SDGLIVLILDKE+  E +G V+ FV  N +
Sbjct: 63  IPNEGHIKYEISSDGLIVLILDKEIS-EVIGLVRDFVAANQL 103

>YML108W (YML108W) [3863] chr13 (54793..55110) Protein of unknown
           function [318 bp, 105 aa]
          Length = 105

 Score =  124 bits (311), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 70/105 (66%), Positives = 80/105 (76%), Gaps = 6/105 (5%)

Query: 2   SNLYRMMVLLEEPME---EDITISDSKEEKKVMHEFMDELTLPFQIDEIDLLNKWFDKFD 58
           SN YRM+VLLE+  +   ED      K  K  MHEF+DEL LPF +DE+D LN WFDKFD
Sbjct: 4   SNTYRMLVLLEDDTKINKEDEKFLKGKPGK--MHEFVDELILPFNVDELDELNTWFDKFD 61

Query: 59  DEICIPNEGHIKYEITSDGLIVLILDKELGEEFVGKVKTFVEQNN 103
            EICIPNEGHIKYEI+SDGLIVL+LDKE+ EE V KVK FVE+NN
Sbjct: 62  AEICIPNEGHIKYEISSDGLIVLMLDKEI-EEVVEKVKKFVEENN 105

>Kwal_27.10328
          Length = 127

 Score =  120 bits (300), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 59/104 (56%), Positives = 78/104 (75%), Gaps = 5/104 (4%)

Query: 5   YRMMVLLEEPMEEDITISDSKEEK----KVMHEFMDELTLPFQIDEIDLLNKWFDKFDDE 60
           YRM+VL+E+P++ + T+   KEE     K  HEF+DEL LPF+ID++D LN+WFDKFD E
Sbjct: 21  YRMLVLVEDPVKSEGTVDGEKEENTDAPKATHEFVDELILPFEIDDMDTLNEWFDKFDAE 80

Query: 61  ICIPNEGHIKYEITSDGLIVLILDKELGEEFVGKVKTFVEQNNV 104
           ICIPNEG IKYEI+SDGL+VL+LD+   EE V +V+ FV+    
Sbjct: 81  ICIPNEGFIKYEISSDGLVVLLLDRSR-EEVVAEVRKFVQSERA 123

>Sklu_767.1 YML108W, Contig c767 652-951 reverse complement
          Length = 99

 Score =  112 bits (280), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 76/96 (79%), Gaps = 2/96 (2%)

Query: 9   VLLEEPMEEDITISDSKEEKKVMHEFMDELTLPFQIDEIDLLNKWFDKFDDEICIPNEGH 68
           +LLEE +  D +  +++   K  HEF+DEL LP Q+DE+DLLN WFDKFD++ICIPNEG+
Sbjct: 1   MLLEEAIP-DSSQENNENTTKTSHEFVDELVLPIQVDEMDLLNDWFDKFDEQICIPNEGY 59

Query: 69  IKYEITSDGLIVLILDKELGEEFVGKVKTFVEQNNV 104
           IKYEI+SDGLIVLIL+KE  EE V KV+ FVE++ V
Sbjct: 60  IKYEISSDGLIVLILNKE-REEVVDKVRRFVEEHQV 94

>Scas_650.23*
          Length = 115

 Score =  110 bits (276), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 81/106 (76%), Gaps = 8/106 (7%)

Query: 3   NLYRMMVLLEEP------MEEDITISDSKEEKKVMHEFMDELTLPFQIDEIDLLNKWFDK 56
           N+YRM+VLLEE        + D T S + E KK  HEF++EL LPF++ E+D LNKWFDK
Sbjct: 5   NMYRMLVLLEEEMEEPELFDNDTTDSKATEPKKT-HEFIEELLLPFEVSELDALNKWFDK 63

Query: 57  FDDEICIPNEGHIKYEITSDGLIVLILDKELGEEFVGKVKTFVEQN 102
           FD+EICIPNEGHIKYEI+SDGLIVL+LDKE+ E  + +VK F++ N
Sbjct: 64  FDEEICIPNEGHIKYEISSDGLIVLLLDKEI-ENVISEVKKFIDDN 108

>Sklu_2430.3 YMR106C, Contig c2430 3786-5666
          Length = 626

 Score = 28.1 bits (61), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 45/101 (44%), Gaps = 14/101 (13%)

Query: 3   NLYRMMVLLEEPMEEDITISDSKEEK-----KVMHEFMDELTLPFQIDEIDLLNKWFDKF 57
           + +R    L E M +   +   K++K       M + +   T P ++ EI+L N+  +  
Sbjct: 526 SAHRQQQALLEYMHQKYVMETKKDDKFEFQVPSMPDLLLSKTRPPKLPEIELSNRLVEML 585

Query: 58  DDEICIPNEGHIKYEITSDGLIVLILDKELGEEFVGKVKTF 98
           D +   PNE   ++    +      LD+E+G E VG + T 
Sbjct: 586 DIK---PNENRKRFARDEE------LDREVGSEAVGNIPTL 617

>Scas_650.11
          Length = 656

 Score = 27.7 bits (60), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 3/43 (6%)

Query: 37 ELTLP-FQIDEIDLLNK--WFDKFDDEICIPNEGHIKYEITSD 76
          +L +P FQ    D L++  W+ K +D I +P  GH    +TS+
Sbjct: 46 KLIIPTFQTSAFDPLSESDWYTKNNDGILLPTSGHFVSLLTSN 88

>Sklu_2172.1 YDR148C, Contig c2172 307-1605
          Length = 432

 Score = 27.3 bits (59), Expect = 2.8,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 5  YRMMVLLEEPMEEDITISDSKEEKKVMHEFM--DELTLPFQIDEIDL 49
          Y+  V+   PM E +T    KE  K + EF+  DEL    + D+ID+
Sbjct: 51 YQSTVVKVPPMAESLTEGSLKEFTKQVGEFIEQDELLATIETDKIDV 97

>Scas_665.30
          Length = 1439

 Score = 26.9 bits (58), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 1   MSNLYRMMVLLEEPMEEDITISDSKEEKKVMHEFMDELTLPFQIDEIDLLNKWFDK 56
           +S L RM V+++ P  ED+  + +K   +V+ +  ++ TLP   +E  +LN +  K
Sbjct: 711 LSELRRMSVIVK-PSNEDVYWAFTKGAPEVITQICNKATLPANFEE--MLNYYTHK 763

>KLLA0B14080g complement(1238559..1239527) similar to sp|P47120
           Saccharomyces cerevisiae YJR070c singleton, start by
           similarity
          Length = 322

 Score = 26.2 bits (56), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 14  PMEEDITISDSKEEKKVMHEFMDELTLPFQIDEIDLLNKWF 54
           P+  D+ ++D K++  V HE  + L     +D +D+L K+F
Sbjct: 94  PLLRDV-LADDKQQCMVRHEAAEALGALNDVDSLDILEKYF 133

>KLLA0A06039g 557368..559341 weakly similar to sp|P36023
           Saccharomyces cerevisiae YKR064w singleton, start by
           similarity
          Length = 657

 Score = 26.2 bits (56), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 8/50 (16%)

Query: 22  SDSKEEKKVMHEFMDELTLPFQID----EIDLLNK----WFDKFDDEICI 63
           +D    KKV +E+MD+L LP  I+     + LL+K    WF+    +I I
Sbjct: 54  TDENASKKVRYEYMDDLGLPEFINMAPKGLHLLSKRSASWFNGLFSDIAI 103

>YPR078C (YPR078C) [5504] chr16 complement(697142..698260) Protein
           of unknown function [1119 bp, 372 aa]
          Length = 372

 Score = 26.2 bits (56), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 12/49 (24%), Positives = 24/49 (48%)

Query: 21  ISDSKEEKKVMHEFMDELTLPFQIDEIDLLNKWFDKFDDEICIPNEGHI 69
            SDS+       + + +L   +  D    LNKWF K   ++ +P++ ++
Sbjct: 98  FSDSESSSNTQLKSLSQLHGRYDRDWRQRLNKWFRKNKSKLALPSDNNL 146

>YOL072W (THP1) [4747] chr15 (194969..196336) Protein involved in
           mRNA export from the nucleus to the cytoplasm and in
           connecting transcription elongation with mitotic
           recombination [1368 bp, 455 aa]
          Length = 455

 Score = 25.8 bits (55), Expect = 9.8,   Method: Composition-based stats.
 Identities = 14/44 (31%), Positives = 25/44 (56%)

Query: 59  DEICIPNEGHIKYEITSDGLIVLILDKELGEEFVGKVKTFVEQN 102
           DE+   N  H+   ++ +G  + IL K+L      +++TFVEQ+
Sbjct: 9   DELAHGNFSHLTLNLSQNGREIAILQKQLTGFDDKQLETFVEQH 52

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.139    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,844,373
Number of extensions: 177317
Number of successful extensions: 569
Number of sequences better than 10.0: 30
Number of HSP's gapped: 562
Number of HSP's successfully gapped: 30
Length of query: 111
Length of database: 16,596,109
Length adjustment: 81
Effective length of query: 30
Effective length of database: 13,792,051
Effective search space: 413761530
Effective search space used: 413761530
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 54 (25.4 bits)