Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0J05830g60759825960.0
Kwal_33.146297192413074e-29
KLLA0E23056g8182432693e-24
Scas_697.176942392621e-23
YNL144C7402382594e-23
YHR131C8402382551e-22
Scas_654.225802392317e-20
AFR049W7172402265e-19
CAGL0G06182g6812492211e-18
KLLA0A08206g23068750.30
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J05830g
         (598 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J05830g complement(552107..553930) some similarities with s...  1004   0.0  
Kwal_33.14629                                                         122   4e-29
KLLA0E23056g complement(2044323..2046779) weakly similar to sp|P...   108   3e-24
Scas_697.17                                                           105   1e-23
YNL144C (YNL144C) [4452] chr14 complement(352820..355042) Protei...   104   4e-23
YHR131C (YHR131C) [2417] chr8 complement(365342..367864) Protein...   102   1e-22
Scas_654.22                                                            94   7e-20
AFR049W [3241] [Homologous to ScYNL144C - SH; ScYHR131C - SH] co...    92   5e-19
CAGL0G06182g 589050..591095 similar to sp|P38835 Saccharomyces c...    90   1e-18
KLLA0A08206g 730940..731632 no similarity, hypothetical start          33   0.30 

>CAGL0J05830g complement(552107..553930) some similarities with
           sp|P53907 Saccharomyces cerevisiae YNL144c or sp|P38835
           Saccharomyces cerevisiae YHR131c, hypothetical start
          Length = 607

 Score = 1004 bits (2596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/598 (83%), Positives = 497/598 (83%)

Query: 1   MDTEMDMGIELPAYXXXXXXXXXXXXXXXXXXXLECAEELPGYSPAVEKFVRAKFKLEWE 60
           MDTEMDMGIELPAY                   LECAEELPGYSPAVEKFVRAKFKLEWE
Sbjct: 1   MDTEMDMGIELPAYSVHSVDSVHSVHSVDSADSLECAEELPGYSPAVEKFVRAKFKLEWE 60

Query: 61  SPTQVSRDPCWYDVVLHINSTQLNLYLPRCPKSRPASKSLSYVSAKPSVSGVRRLSERFT 120
           SPTQVSRDPCWYDVVLHINSTQLNLYLPRCPKSRPASKSLSYVSAKPSVSGVRRLSERFT
Sbjct: 61  SPTQVSRDPCWYDVVLHINSTQLNLYLPRCPKSRPASKSLSYVSAKPSVSGVRRLSERFT 120

Query: 121 RFKKNYLPAFEPLDFHPTPAGFTNSYQNMPQDALGARKKRSNQYDFIYDTNYEEYCSETC 180
           RFKKNYLPAFEPLDFHPTPAGFTNSYQNMPQDALGARKKRSNQYDFIYDTNYEEYCSETC
Sbjct: 121 RFKKNYLPAFEPLDFHPTPAGFTNSYQNMPQDALGARKKRSNQYDFIYDTNYEEYCSETC 180

Query: 181 DSMDVSTGFVPFKSYSLQGAKVGMPTSESRKKVYIDEENVYKDAYLVCLRLRMEDQQFLV 240
           DSMDVSTGFVPFKSYSLQGAKVGMPTSESRKKVYIDEENVYKDAYLVCLRLRMEDQQFLV
Sbjct: 181 DSMDVSTGFVPFKSYSLQGAKVGMPTSESRKKVYIDEENVYKDAYLVCLRLRMEDQQFLV 240

Query: 241 QFEHIDDMIMWSMYLSMGINVSKDLYDREYPNYRIVPXXXXXXXXXXXXXXXXXXXXXXX 300
           QFEHIDDMIMWSMYLSMGINVSKDLYDREYPNYRIVP                       
Sbjct: 241 QFEHIDDMIMWSMYLSMGINVSKDLYDREYPNYRIVPRRRRRRHSGHSRRRFSSRRRHSS 300

Query: 301 XXTPVRNTEGPSSSTRRRANSFLKHFTGAKSASEPLQIDFKNPFTSEQQPDAALVRQKSH 360
             TPVRNTEGPSSSTRRRANSFLKHFTGAKSASEPLQIDFKNPFTSEQQPDAALVRQKSH
Sbjct: 301 GRTPVRNTEGPSSSTRRRANSFLKHFTGAKSASEPLQIDFKNPFTSEQQPDAALVRQKSH 360

Query: 361 HEPPERTPASDQSRSESSAHGDITPNNSISRSTTTSLHDNESDVMDGLNNLTRSPSECLS 420
           HEPPERTPASDQSRSESSAHGDITPNNSISRSTTTSLHDNESDVMDGLNNLTRSPSECLS
Sbjct: 361 HEPPERTPASDQSRSESSAHGDITPNNSISRSTTTSLHDNESDVMDGLNNLTRSPSECLS 420

Query: 421 LYETLTANSSFCEYDLDKPHAKLARINYNFDYWXXXXXXXXXXXXXXXXXXXXMDCSFDS 480
           LYETLTANSSFCEYDLDKPHAKLARINYNFDYW                    MDCSFDS
Sbjct: 421 LYETLTANSSFCEYDLDKPHAKLARINYNFDYWSPLQFGSSLSSTSSLGLSNSMDCSFDS 480

Query: 481 NESTYPDGMIPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTDDMNDCDTKWN 540
           NESTYPDGMIP                                     TDDMNDCDTKWN
Sbjct: 481 NESTYPDGMIPELIELEEEIEEDDEDDIDIEDYGLEEFEIFEEGEELETDDMNDCDTKWN 540

Query: 541 PVKKEQTRKRYIRHSLRCIRPLAPDAKWEGETIYVKAGLRNKMYNPSLLKDIKPYLME 598
           PVKKEQTRKRYIRHSLRCIRPLAPDAKWEGETIYVKAGLRNKMYNPSLLKDIKPYLME
Sbjct: 541 PVKKEQTRKRYIRHSLRCIRPLAPDAKWEGETIYVKAGLRNKMYNPSLLKDIKPYLME 598

>Kwal_33.14629
          Length = 719

 Score =  122 bits (307), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 87/241 (36%), Positives = 111/241 (46%), Gaps = 51/241 (21%)

Query: 40  LPGYSPAVEKFVRAKFKLEWESPTQVSRDPCWYDVVLHINSTQLNLYLPRCPKSRPASKS 99
           LPGYSPAVE       KLEW  P   S    W + V+ INSTQLN YL     +R     
Sbjct: 110 LPGYSPAVEAITVVSMKLEWLDPYTCSPSRSWKNFVMEINSTQLNFYLIDPALTR----- 164

Query: 100 LSYVSAKPSVSGVRRLSERFTRFKKNYL-PAFEPLDFHPTPAGFT--NSYQNMPQDALGA 156
                      G++      + F   +L P+ E    H   +  +  N+YQ    D    
Sbjct: 165 -----------GIKNYCNGKSHFGGEHLDPSLEYESHHSIFSSLSSKNTYQFNKADQECI 213

Query: 157 RKKRSNQYDFIYDTNYEEYCSETCDSMDVSTGFVPFKSYSLQGAKVGMPTSESRKKVYID 216
            KK SN        N  +Y ++             F+SYSLQ AK G+PT  +RK     
Sbjct: 214 SKKISN--------NKSKYLTDN----------KLFRSYSLQFAKYGIPTDYNRKTF--- 252

Query: 217 EENVYKDAYLVCLRLRMEDQQFLVQFEHIDDMIMWSMYLSMGINVSKDLYDREYPNYRIV 276
                       LR+R E +QF++ F H+DDMIMW+MYLS+GI VS DL  RE P YR V
Sbjct: 253 -----------VLRVRCETEQFMLSFSHVDDMIMWNMYLSIGIGVSLDLDFRELPTYRTV 301

Query: 277 P 277
           P
Sbjct: 302 P 302

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 29/38 (76%)

Query: 536 DTKWNPVKKEQTRKRYIRHSLRCIRPLAPDAKWEGETI 573
           D KW+P +KE +R+RYIR SLRCI+PL  + +W G+ +
Sbjct: 612 DVKWHPPRKEMSRRRYIRDSLRCIKPLPDNEEWLGKVL 649

>KLLA0E23056g complement(2044323..2046779) weakly similar to
           sp|P38835 Saccharomyces cerevisiae YHR131c, start by
           similarity
          Length = 818

 Score =  108 bits (269), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 78/243 (32%), Positives = 111/243 (45%), Gaps = 59/243 (24%)

Query: 40  LPGYSPAVEKFVRAKFKLEWESPTQVSRDPCWYDVVLHINSTQLNLYLPRCPKSRPASKS 99
           LPGYSPAV+       K EW +P ++S    W + ++ INSTQLN Y             
Sbjct: 161 LPGYSPAVKAITVISLKQEWLNPYELSSSRAWKNFIMEINSTQLNFY------------- 207

Query: 100 LSYVSAKPSVSGVRRLSERFTRFKKNYLPAFEPLDFHPTPAGFTNSYQNMPQDA--LGAR 157
                          + E  T   KNY         +  P  F N   +  Q    L + 
Sbjct: 208 --------------HIHESLTSNIKNY---------YGGPTNFPNDLNSSKQSTRFLPSL 244

Query: 158 KKRSNQYDFIYDTNYEEYCSETCDSMD---VSTGFVPFKSYSLQGAKVGMPTSESRKKVY 214
             +S    + ++ + +++ ++   S +   +S   + FKS+SLQ  K G+PT  ++K   
Sbjct: 245 HSKST---YQFNRSDQQWITKMIQSNEKKYLSNDML-FKSFSLQYGKFGIPTDYTKKTF- 299

Query: 215 IDEENVYKDAYLVCLRLRMEDQQFLVQFEHIDDMIMWSMYLSMGINVSKDLYDREYPNYR 274
                         LRLR E QQFL+ F H+DDMI WS+ LS+GI+VS DL  RE P YR
Sbjct: 300 -------------VLRLRCELQQFLINFAHVDDMIDWSVSLSIGIDVSLDLAYREMPTYR 346

Query: 275 IVP 277
            VP
Sbjct: 347 TVP 349

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/33 (63%), Positives = 25/33 (75%)

Query: 536 DTKWNPVKKEQTRKRYIRHSLRCIRPLAPDAKW 568
           + KWNP +KE TR+RYIR SLRCI+PL  D  W
Sbjct: 711 EMKWNPPRKEITRRRYIRDSLRCIKPLGFDESW 743

>Scas_697.17
          Length = 694

 Score =  105 bits (262), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 105/239 (43%), Gaps = 67/239 (28%)

Query: 41  PGYSPAVEKFVRAKFKLEWESPTQVSRDPCWYDVVLHINSTQLNLYLPRCPKSRPASKSL 100
           P Y PAVE+      KLEW SP  VS    W ++++ INSTQLN Y              
Sbjct: 129 PSYKPAVEELTIVSMKLEWLSPYDVSPLRTWKNLIMEINSTQLNFY-------------- 174

Query: 101 SYVSAKPSVSGVRRLSERFTRFKKNYLPAFEPLDFHPTPAGF------TNSYQNMPQDAL 154
                         + E  T   +NY             + F      T  +    Q+ +
Sbjct: 175 -------------HIDESLTSHIRNYSNDSSSSSPSKQRSTFSFGNRTTYEFNKNDQEQI 221

Query: 155 GARKKRSNQYDFIYDTNYEEYCSETCDSMDVSTGFVPFKSYSLQGAKVGMPTSESRKKVY 214
             R KR+ +   +Y +N + Y                 KSYSLQ AK G+P  + +KK Y
Sbjct: 222 AFRIKRNKK---LYLSNDKLY-----------------KSYSLQFAKFGLPI-DYKKKTY 260

Query: 215 IDEENVYKDAYLVCLRLRMEDQQFLVQFEHIDDMIMWSMYLSMGINVSKDLYDREYPNY 273
           +             LRLR E +QFL+ F H+DDMIMW+MYL+MGI+V+ DL  R  P+Y
Sbjct: 261 V-------------LRLRCESEQFLLNFAHVDDMIMWTMYLNMGISVALDLELRALPDY 306

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 536 DTKWNPVKKEQTRKRYIRHSLRCIRPLAPDAKWEGETIYVK--AGLRNKMYN 585
           + KW P  K   R++YIR+SLRCI P   +  W  + I VK  AG + K  N
Sbjct: 578 EIKWTPPLKITPRRKYIRNSLRCIVPFIEETNW-IDNIVVKPTAGPKFKTNN 628

>YNL144C (YNL144C) [4452] chr14 complement(352820..355042) Protein
           of unknown function, has low similarity to
           uncharacterized S. cerevisiae Yhr131p [2223 bp, 740 aa]
          Length = 740

 Score =  104 bits (259), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 79/238 (33%), Positives = 108/238 (45%), Gaps = 48/238 (20%)

Query: 41  PGYSPAVEKFVRAKFKLEWESPTQVSRDPCWYDVVLHINSTQLNLYLPRCPKSRPASKSL 100
           P Y+P+VE +     K+E  SP + +    W + +L INSTQ+N Y              
Sbjct: 129 PSYTPSVEHYTVVSMKMEKLSPFENASSRLWNNFILQINSTQINFY-------------- 174

Query: 101 SYVSAKPSVSGVRRLSERFTRFKKNYLPAFEPLDFHPTPAGFTNSYQNMPQDALGARKKR 160
                         + +  TR  KNY    +  D H   +   +   +  +  L A   +
Sbjct: 175 -------------SIDDSLTRHIKNYRGG-DMFD-HSHHSKTASDRHHSARSLLNAFTTK 219

Query: 161 SN-QYDFIYDTNYEEYCSETC-DSMDVSTGFVPFKSYSLQGAKVGMPTSESRKKVYIDEE 218
           S  Q+D  YD   E  C E   D     +    FKSYSLQ AKVG+P   S +       
Sbjct: 220 STYQFD-KYDK--ERICGEIARDEHKFLSDERLFKSYSLQCAKVGLPIDYSSRDF----- 271

Query: 219 NVYKDAYLVCLRLRMEDQQFLVQFEHIDDMIMWSMYLSMGINVSKDLYDREYPNYRIV 276
                     LR+R E QQFLVQF H+D++I W+MYL+MGI++S DL  RE P YR V
Sbjct: 272 ---------VLRMRCEGQQFLVQFSHVDELIYWAMYLNMGISLSLDLELREMPTYRSV 320

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 28/42 (66%)

Query: 536 DTKWNPVKKEQTRKRYIRHSLRCIRPLAPDAKWEGETIYVKA 577
           D+KW P  +  +RKRYI+ SLRCI+PL  D  W G+ I+  A
Sbjct: 638 DSKWAPATQLVSRKRYIKDSLRCIKPLTEDHPWVGKIIFKPA 679

>YHR131C (YHR131C) [2417] chr8 complement(365342..367864) Protein
           containing a pleckstrin homology (PH) domain, which
           mediate protein-protein and protein-lipid interactions,
           has low similarity to uncharacterized S. cerevisiae
           Ynl144p [2523 bp, 840 aa]
          Length = 840

 Score =  102 bits (255), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 110/238 (46%), Gaps = 41/238 (17%)

Query: 41  PGYSPAVEKFVRAKFKLEWESPTQVSRDPCWYDVVLHINSTQLNLYLPRCPKSRPASKSL 100
           P Y+PAV +      KLE  SP ++S +  W + ++ INSTQLN Y          +K +
Sbjct: 114 PLYAPAVYELTLISLKLERLSPYEISSNRSWRNFIIEINSTQLNFY----HIDESLTKHI 169

Query: 101 -SYVSAKPSVSGVRRLSERFTRFKKNYLPAFEPLDFHPTPAGFTNSYQNMPQDALGARKK 159
            +Y S +       R+                 L   PT +   + ++   Q+ +  R K
Sbjct: 170 RNYSSGETKSEKEDRIHSDLVHRSDQSQHLHHRLFTLPTRSA--SEFKKADQERISYRVK 227

Query: 160 RSNQYDFIYDTNYEEYCSETCDSMDVSTGFVPFKSYSLQGAKVGMPTSESRKKVYIDEEN 219
           R       Y T+   Y                 KS++LQ A+ G+PT  ++K        
Sbjct: 228 RDRSR---YLTDEALY-----------------KSFTLQNARFGIPTDYTKKS------- 260

Query: 220 VYKDAYLVCLRLRMEDQQFLVQFEHIDDMIMWSMYLSMGINVSKDLYDREYPNYRIVP 277
                    LR+  E +QFL++F HIDDMI WSMYLS+GI+VS DL  REYP+YRIVP
Sbjct: 261 -------FVLRMSCESEQFLLRFSHIDDMIDWSMYLSIGISVSLDLEVREYPDYRIVP 311

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 25/40 (62%)

Query: 536 DTKWNPVKKEQTRKRYIRHSLRCIRPLAPDAKWEGETIYV 575
           D KW P  KE +R+RY+R SL+CI+P        G+ IY+
Sbjct: 691 DIKWKPAIKEISRRRYLRDSLKCIKPFLDSNDCLGKVIYI 730

>Scas_654.22
          Length = 580

 Score = 93.6 bits (231), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 105/239 (43%), Gaps = 50/239 (20%)

Query: 41  PGYSPAVEKFVRAKFKLEWESPTQVSRDPC--WYDVVLHINSTQLNLYLPRCPKSRPASK 98
           P YSPAV++      KLEWESP    R     W  V++ +NSTQLN Y           K
Sbjct: 131 PSYSPAVDEITLVSMKLEWESPMAPIRYAAQRWKIVLMEVNSTQLNFYDVDALLQSQLKK 190

Query: 99  SLSYVSAKPSVSGVRRLSERFTRFKKNYLPAFEPLDFHPTPAGFTNSYQNMPQDALGARK 158
           ++          G R+ S  F           E + F         SY     + +  + 
Sbjct: 191 TI----------GPRKNSTLFGMNNNRN----EDITFQ--------SYTKSDNEKI-CQL 227

Query: 159 KRSNQYDFIYDTNYEEYCSETCDSMDVSTGFVPFKSYSLQGAKVGMPTSESRKKVYIDEE 218
            R N+  +++D N                     KSYSLQ  +VG PT  S K       
Sbjct: 228 IRRNKSKYLHDANL-------------------VKSYSLQFGRVGFPTDLSSK------N 262

Query: 219 NVYKDAYLVCLRLRMEDQQFLVQFEHIDDMIMWSMYLSMGINVSKDLYDREYPNYRIVP 277
              + +  + LRLR E QQFL+QF  +D +IM ++++ MGI+VS DL  RE P YRIVP
Sbjct: 263 KGKRTSDPIALRLRCEAQQFLLQFTDMDSLIMSAVHIDMGISVSLDLQIRELPTYRIVP 321

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 32/46 (69%)

Query: 529 TDDMNDCDTKWNPVKKEQTRKRYIRHSLRCIRPLAPDAKWEGETIY 574
           +D  +D D KW+P  K+ +R+RY+R SLRCI+ +  + KW G+ ++
Sbjct: 474 SDIDSDDDYKWSPTSKQTSRRRYVRDSLRCIKSMTENHKWVGKVVF 519

>AFR049W [3241] [Homologous to ScYNL144C - SH; ScYHR131C - SH]
           complement(517312..519465) [2154 bp, 717 aa]
          Length = 717

 Score = 91.7 bits (226), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 75/240 (31%), Positives = 104/240 (43%), Gaps = 54/240 (22%)

Query: 39  ELPGYSPAVEKFVRAKFKLEWESPTQVSRDPCWYDVVLHINSTQLNLY-----LPRCPKS 93
           ELP Y+PAV +      K EW SP + +    W  +++ +NSTQLN Y     L R  + 
Sbjct: 98  ELPAYAPAVHELALVSVKQEWASPYEPAVSRSWRTLLMELNSTQLNFYHVDEGLLRGLRG 157

Query: 94  RPASKSLSYVSAKPSVSGVRRLSERFTRFKKNYLPAFEPLDFHPTPAGFTNSYQNMPQDA 153
           R A  +L    A+     V  LS  F + K   L A    +   +PA          Q  
Sbjct: 158 RAADSTLGVACAQ----AVSSLS--FGQVKAGTLLALGRDERQLSPA---------HQQH 202

Query: 154 LGARKKRSNQYDFIYDTNYEEYCSETCDSMDVSTGFVPFKSYSLQGAKVGMPTSESRKKV 213
           + AR +R  +            C+E             +KSYSLQ A  G+P   +++  
Sbjct: 203 VCARAQRDPE---------RHLCAERL-----------YKSYSLQYATFGVPMDYTKRS- 241

Query: 214 YIDEENVYKDAYLVCLRLRMEDQQFLVQFEHIDDMIMWSMYLSMGINVSKDLYDREYPNY 273
                          LRLR E +QFLV F  +D +I WS+ LS+GI VS DL  R+ P Y
Sbjct: 242 -------------FVLRLRCETEQFLVCFGTVDMLISWSVSLSVGIGVSLDLDHRKMPAY 288

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 24/36 (66%)

Query: 538 KWNPVKKEQTRKRYIRHSLRCIRPLAPDAKWEGETI 573
           KW P  KE TR+R++R S+RCIRPL  D  W G  +
Sbjct: 615 KWVPPVKESTRRRFVRDSIRCIRPLCDDDTWLGALV 650

>CAGL0G06182g 589050..591095 similar to sp|P38835 Saccharomyces
           cerevisiae YHR131c, start by similarity
          Length = 681

 Score = 89.7 bits (221), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 70/249 (28%), Positives = 105/249 (42%), Gaps = 75/249 (30%)

Query: 38  EELPGYSPAVEKFVRAKFKLEWESPTQVSRDPCWYDVVLHINSTQLNLYLPRCPKSRPAS 97
           E+ P Y P V        KLEW SP + S +  W   ++ INSTQ+N Y           
Sbjct: 89  EKPPAYHPTVYNVAIVSVKLEWLSPFEPSPNRSWRTFIMEINSTQINFYA---------- 138

Query: 98  KSLSYVSAKPSVSGVRRLSERFTRFKKNYLPAFEPLDFHPTPAGFTNSYQNMPQDALGAR 157
                            L   F R  KNY               + +  +++ +  L   
Sbjct: 139 -----------------LEPEFHRLVKNYYNL-----------KYDDGAKSLAKGILSLG 170

Query: 158 KKRSNQYDFIYDT-------------NYEEYCSETCDSMDVSTGFVPFKSYSLQGAKVGM 204
             +    + I DT             NY +Y S+             ++S++LQ A++G+
Sbjct: 171 NSKKKNDNKIVDTEPHWKRLNAKLERNYSKYLSDA----------RLYRSFTLQYARMGI 220

Query: 205 PTSESRKKVYIDEENVYKDAYLVCLRLRMEDQQFLVQFEHIDDMIMWSMYLSMGINVSKD 264
           PT + RK  +              LRLR E +QFLV F+++DD+I WSMY++MGI+V+ D
Sbjct: 221 PT-DYRKSAH-------------ALRLRCEAEQFLVAFDNVDDLINWSMYINMGISVALD 266

Query: 265 LYDREYPNY 273
           L  R+ PNY
Sbjct: 267 LDCRQLPNY 275

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 24/43 (55%)

Query: 536 DTKWNPVKKEQTRKRYIRHSLRCIRPLAPDAKWEGETIYVKAG 578
           D KW P +K  +R+RY++ SLRCI+     + W G  +    G
Sbjct: 562 DVKWMPPQKILSRRRYVKDSLRCIKGFVEHSSWMGRVVCCPTG 604

>KLLA0A08206g 730940..731632 no similarity, hypothetical start
          Length = 230

 Score = 33.5 bits (75), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 19/68 (27%)

Query: 191 PFKSYSLQGAKVGMPTSESRKKVYIDEENVYKDAYLVCLRLRMEDQQFLVQFEHIDDMIM 250
           P K YSLQ  ++G+ T  SR                 CLR+R E +QFL++    DD  +
Sbjct: 154 PIKKYSLQDCRIGLNTDMSR-----------------CLRIRCEREQFLLRVP--DDASV 194

Query: 251 WSMYLSMG 258
            S++  + 
Sbjct: 195 TSLFAKIA 202

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.131    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,733,797
Number of extensions: 725661
Number of successful extensions: 2707
Number of sequences better than 10.0: 36
Number of HSP's gapped: 2766
Number of HSP's successfully gapped: 52
Length of query: 598
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 491
Effective length of database: 12,891,983
Effective search space: 6329963653
Effective search space used: 6329963653
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)