Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0J04136g34433918210.0
YOR221C (MCT1)38435711141e-152
Scas_650.133433310191e-139
Kwal_26.86643143385625e-70
KLLA0D07051g3233304443e-52
ACR108C2963264205e-49
Scas_660.2659289720.51
KLLA0E21835g32343691.0
Kwal_33.1353053479681.8
Kwal_23.51681073101654.0
YLR071C (RGR1)108233645.1
Scas_713.2087634629.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J04136g
         (339 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J04136g 385772..386806 similar to tr|Q12283 Saccharomyces c...   706   0.0  
YOR221C (MCT1) [5013] chr15 complement(756476..757536,757738..75...   433   e-152
Scas_650.1                                                            397   e-139
Kwal_26.8664                                                          221   5e-70
KLLA0D07051g complement(604505..605476) weakly similar to sgd|S0...   175   3e-52
ACR108C [1155] [Homologous to ScYOR221C (MCT1) - SH] (545576..54...   166   5e-49
Scas_660.26                                                            32   0.51 
KLLA0E21835g join(1942567..1942679,1942793..1943651) similar to ...    31   1.0  
Kwal_33.13530                                                          31   1.8  
Kwal_23.5168                                                           30   4.0  
YLR071C (RGR1) [3487] chr12 complement(275379..278627) Component...    29   5.1  
Scas_713.20                                                            28   9.4  

>CAGL0J04136g 385772..386806 similar to tr|Q12283 Saccharomyces
           cerevisiae YOR221c MCT1 malonyl-CoA:ACP transferase,
           hypothetical start
          Length = 344

 Score =  706 bits (1821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/339 (100%), Positives = 339/339 (100%)

Query: 1   MKLVTFPGQGTPIPVAVLKALIRNKDAQFNTILNRGLHRRDLLEYIFRNPSSPGSIAVCS 60
           MKLVTFPGQGTPIPVAVLKALIRNKDAQFNTILNRGLHRRDLLEYIFRNPSSPGSIAVCS
Sbjct: 1   MKLVTFPGQGTPIPVAVLKALIRNKDAQFNTILNRGLHRRDLLEYIFRNPSSPGSIAVCS 60

Query: 61  NFLYEMYGLISEDLRPHHRDSLILLGHSLGELTCLKVNELFTTKELFEIANYRNDLMVKY 120
           NFLYEMYGLISEDLRPHHRDSLILLGHSLGELTCLKVNELFTTKELFEIANYRNDLMVKY
Sbjct: 61  NFLYEMYGLISEDLRPHHRDSLILLGHSLGELTCLKVNELFTTKELFEIANYRNDLMVKY 120

Query: 121 TEQYLRAYNRRGSKFEMWALSSPKATDLPYEIHKLLTESPTFPGSHTISVANANSVKQCV 180
           TEQYLRAYNRRGSKFEMWALSSPKATDLPYEIHKLLTESPTFPGSHTISVANANSVKQCV
Sbjct: 121 TEQYLRAYNRRGSKFEMWALSSPKATDLPYEIHKLLTESPTFPGSHTISVANANSVKQCV 180

Query: 181 VTGLVEDLEALRTELHLNIPRLRISELTNPHNLPFHNNTVLRPIQEPLYDFIWKIMKNNG 240
           VTGLVEDLEALRTELHLNIPRLRISELTNPHNLPFHNNTVLRPIQEPLYDFIWKIMKNNG
Sbjct: 181 VTGLVEDLEALRTELHLNIPRLRISELTNPHNLPFHNNTVLRPIQEPLYDFIWKIMKNNG 240

Query: 241 THTWTTLNHPIVSNLDGKETKFIHHALDKFVKCSSTTVQFTKCYDTINRIAEATKDQEDP 300
           THTWTTLNHPIVSNLDGKETKFIHHALDKFVKCSSTTVQFTKCYDTINRIAEATKDQEDP
Sbjct: 241 THTWTTLNHPIVSNLDGKETKFIHHALDKFVKCSSTTVQFTKCYDTINRIAEATKDQEDP 300

Query: 301 LDAAICIGPGNVIYNLIRRNVPSLKCVEYSSMATIDSYH 339
           LDAAICIGPGNVIYNLIRRNVPSLKCVEYSSMATIDSYH
Sbjct: 301 LDAAICIGPGNVIYNLIRRNVPSLKCVEYSSMATIDSYH 339

>YOR221C (MCT1) [5013] chr15
           complement(756476..757536,757738..757831) Malonyl
           CoA:acyl carrier protein transferase [1155 bp, 384 aa]
          Length = 384

 Score =  433 bits (1114), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 217/357 (60%), Positives = 265/357 (74%), Gaps = 27/357 (7%)

Query: 3   LVTFPGQGTPIPVAVLKALIRNKDAQFNTILNR-GLHRRDLLEYIFRNPSSPGSIAVCSN 61
           +  F  QGT I +++LKA+IRNK  +F TIL++ G    DLL+YIF+NPSSPGSIAVCSN
Sbjct: 27  MAFFGRQGTSISISILKAIIRNKSREFQTILSQNGKESNDLLQYIFQNPSSPGSIAVCSN 86

Query: 62  FLYEMYGLISEDLRPHHR----------------DSLILLGHSLGELTCLKVNELFTTKE 105
             Y++Y ++S    P  +                +   LLGHSLGELTCL VN LF+ K+
Sbjct: 87  LFYQLYQILSNPSDPQDQAPKNMTKIDSPDKKDNEQCYLLGHSLGELTCLSVNSLFSLKD 146

Query: 106 LFEIANYRNDLMVKYTEQYLRAYN-RRGSKFEMWALSSPKATDLPYEIHKLLTESPTFPG 164
           LF+IAN+RN LMV  TE+YL A+N  R +KFEMWALSSP+ATDLP E+ KLL  SP    
Sbjct: 147 LFDIANFRNKLMVTSTEKYLVAHNINRSNKFEMWALSSPRATDLPQEVQKLLN-SPNLLS 205

Query: 165 S--HTISVANANSVKQCVVTGLVEDLEALRTELHLNIPRLRISELTNPHNLPFHNNTVLR 222
           S  +TISVANANSVKQCVVTGLV+DLE+LRTEL+L  PRLRI+ELTNP+N+PFHN+TVLR
Sbjct: 206 SSQNTISVANANSVKQCVVTGLVDDLESLRTELNLRFPRLRITELTNPYNIPFHNSTVLR 265

Query: 223 PIQEPLYDFIWKIMKNNGTHTWTTLNHPIVSNLDGKETKFIHHALDKFVKCSSTTVQFTK 282
           P+QEPLYD+IW I+K NGTHT   LNHPI++NLDG  + +IHHALD+FVKCSS TVQFT 
Sbjct: 266 PVQEPLYDYIWDILKKNGTHTLMELNHPIIANLDGNISYYIHHALDRFVKCSSRTVQFTM 325

Query: 283 CYDTINRIAEATKDQEDPLDAAICIGPGNVIYNLIRRNVPSLKCVEYSSMATIDSYH 339
           CYDTIN            +D +IC GPGNVIYNLIRRN P +  +EY+S+ATID+YH
Sbjct: 326 CYDTINSGTPVE------IDKSICFGPGNVIYNLIRRNCPQVDTIEYTSLATIDAYH 376

>Scas_650.1
          Length = 334

 Score =  397 bits (1019), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 198/333 (59%), Positives = 249/333 (74%), Gaps = 12/333 (3%)

Query: 9   QGTPIPVAVLKALIRNKDAQFNTILNR-GLHRRDLLEYIFRNPSSPGSIAVCSNFLYEMY 67
           +GT I + VLKALIRNK  QF  ILN    +  DLL +IFRNPS+PGSIAVCS+ LY++Y
Sbjct: 1   RGTSISIPVLKALIRNKSKQFQLILNNNSTNANDLLNFIFRNPSNPGSIAVCSSLLYQLY 60

Query: 68  GLISEDLRPHHRDSLILLGHSLGELTCLKVNELFTTKELFEIANYRNDLMVKYTEQYLRA 127
            + S    P     L LLGHSLGELTCL +N LFT  +LF+I+NYRNDLM+KYTE+YL A
Sbjct: 61  KISSLTPTPADEPPL-LLGHSLGELTCLSINNLFTLNDLFKISNYRNDLMIKYTEKYLIA 119

Query: 128 YN-RRGSKFEMWALSSPKATDLPYEIHKLLTESPTFPGSHTISVANANSVKQCVVTGLVE 186
           +     SKFEMWALSSP A+DLP ++++LLT  P   G  T+S+ANANS KQCV T LVE
Sbjct: 120 HKINHSSKFEMWALSSPNASDLPEQVYQLLTSLPIPNG--TVSIANANSPKQCVATELVE 177

Query: 187 DLEALRTELHLNIPRLRISELTNPHNLPFHNNTVLRPIQEPLYDFIWKIMKNNGTHTWTT 246
           DLE+LRTELH++ P+LRI+ELTNP N+PFHN+ +LRPIQEPLYD+IW I+K N T T T 
Sbjct: 178 DLESLRTELHISFPKLRITELTNPSNIPFHNDRILRPIQEPLYDYIWSILKQNNTQTMTE 237

Query: 247 LNHPIVSNLDGKETKFIHHALDKFVKCSSTTVQFTKCYDTINRIAEATKDQEDPLDAAIC 306
           L   I++NLDG  ++F+HHAL+KF+KCSS TV+FTKCY+TIN  A    D       ++C
Sbjct: 238 LPMGIIANLDGGVSRFVHHALEKFIKCSSNTVEFTKCYETINNKAFNVTD-------SVC 290

Query: 307 IGPGNVIYNLIRRNVPSLKCVEYSSMATIDSYH 339
           IGPGNVI+NL+RRN P +   EYSS+ T++ +H
Sbjct: 291 IGPGNVIFNLVRRNCPDVVPFEYSSLTTVNLFH 323

>Kwal_26.8664
          Length = 314

 Score =  221 bits (562), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 126/338 (37%), Positives = 187/338 (55%), Gaps = 32/338 (9%)

Query: 1   MKLVTFPGQGTPIPVAVLKALIRNKDAQFNTILNRGLHRRDLLEYIFRNPSSPGSIAVCS 60
           MK VTFPGQGT + ++V +  +     +F ++  R   R  +L  I R P+ P SIA CS
Sbjct: 1   MKAVTFPGQGTAVGLSVFRCYLAETSRRFQSVFGRP-GRASVLASIERKPAEPASIAACS 59

Query: 61  NFLYEMYGLISEDLRPHHRDSLILLGHSLGELTCLKV-NELFTTKELFEIANYRNDLMVK 119
             L+++Y   S        + L+ LGHSLGEL CL   N LF   E  E+A YRN LMV+
Sbjct: 60  YLLFDLYRQFSRS-----DEQLVFLGHSLGELGCLGAGNGLFGLTETMEVAAYRNRLMVE 114

Query: 120 YTEQYLRAYNRRGSKFEMWALSSPKATDLPYEIHKLLTESPTFPGSHTISVANANSVKQC 179
                       G+++ MWA+S+P++ +L  E+  LL+       +  I++AN N+  QC
Sbjct: 115 AVH---------GTQYGMWAVSAPRSRNLALELRPLLS-------NLGIALANVNTNTQC 158

Query: 180 VVTGLVEDLEALRTELHLNIPRLRISELTNPHNLPFHNNTVLRPIQEPLYDFIWKIMKNN 239
           VVTGL  D E    EL  +IPR RI +L NP+++PFHN  +L  IQEPL DF+WK +K +
Sbjct: 159 VVTGLELDGEHWTRELSQHIPRCRIQKLENPYHIPFHNRDILGSIQEPLLDFMWKKLKRD 218

Query: 240 GTHTWTTLNHPIVSNLDGKETKFIHHALDKFVKCSSTTVQFTKCYDTINRIAEATKDQED 299
           G  T T+L + ++SN  G+    +  AL+ F   S   V+F  C +T+N++         
Sbjct: 219 GGLTPTSLRYLMISNATGELITNVDRALESFAASSCNVVEFVSCCNTLNKLG-------- 270

Query: 300 PLDAAICIGPGNVIYNLIRRNVPSLKCVEYSSMATIDS 337
            +  A+ +GPG V+  L+RRN       E++++  I S
Sbjct: 271 -VHEAMHLGPGTVVSKLVRRNCDLQASYEWNTVEDILS 307

>KLLA0D07051g complement(604505..605476) weakly similar to
           sgd|S0005747 Saccharomyces cerevisiae YOR221c MCT1
           malonyl-CoA:ACP transferase, start by similarity
          Length = 323

 Score =  175 bits (444), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 111/330 (33%), Positives = 171/330 (51%), Gaps = 27/330 (8%)

Query: 2   KLVTFPGQGTPIPVAVLKALIRNKDAQFNTILNRGLHRRDLLEYIFRNPSSPGSIAVCSN 61
           +L++FPGQG+ + +  L+    N           G     L++        P +IA CSN
Sbjct: 4   RLLSFPGQGSKVLLDRLQRWAANV---------SGFKDVSLIDRFTGTLEQPETIAACSN 54

Query: 62  FLYEMYGLISEDLRPHHRDSLILLGHSLGELTCL--KVNEL-FTTKELFEIANYRNDLMV 118
            LY  +  ++++   +      ++GHSLGEL  L   VN L F  K++ EIA++RN LMV
Sbjct: 55  LLYSNW--LTDNANQNSNGKTYVIGHSLGELNALNASVNGLAFGCKDIIEIASFRNQLMV 112

Query: 119 KYTEQYLRAYNRRGSKFEMWALSSPKATDLPYEIHKLLTESPTFPGSH---TISVANANS 175
           + T++YL         FE+WA+++ ++ +L  ++  +L  + T        +I +AN N+
Sbjct: 113 EATQRYLEKCRITDDSFELWAVTNVRSKNLRKDLSAVLDSNITNSSVDKPCSIKLANDNA 172

Query: 176 VKQCVVTGLVEDLEALRTELHLNIPRLRISELTNPHNLPFHNNTVLRPIQEPLYDFIWKI 235
           V QCV+TGL  D++ L     +   R + ++L +P ++PFHN  VLR IQEPLYDFIW  
Sbjct: 173 VNQCVITGLSNDIQKLVETCKMENLRHKFTKLDSPFSIPFHNINVLRSIQEPLYDFIWDT 232

Query: 236 MKNNGTHTWTT--LNHPIVSNLDGKETKFIHHALDKFVKCSSTTVQFTKCYDTINRIAEA 293
           +K NG H +    + + I SN+DGK T     AL+ FV  S   V F      I+ ++  
Sbjct: 233 LKENGKHHFINEKVENGIFSNIDGKLTYQFDTALENFVAGSCNIVNFVDSCKNISSLSSV 292

Query: 294 TKDQEDPLDAAICIGPGNVIYNLIRRNVPS 323
            K        A   GPG  I  LI RN+ +
Sbjct: 293 EK--------AYHFGPGTSIGKLIERNLKT 314

>ACR108C [1155] [Homologous to ScYOR221C (MCT1) - SH]
           (545576..546466) [891 bp, 296 aa]
          Length = 296

 Score =  166 bits (420), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 107/326 (32%), Positives = 170/326 (52%), Gaps = 46/326 (14%)

Query: 1   MKLVTFPGQGTPIPVAVLKALIRNKDA-QFNTILNRGLHRRDLLEYIFRNPSSPGSIAVC 59
           M+LVTFPGQG+ +  + L     ++   Q +++        D++ Y+ R P++PG+IA C
Sbjct: 1   MRLVTFPGQGSAVLASSLARWCESRAGFQHSSVA-------DVVAYVERQPAAPGAIAAC 53

Query: 60  SNFLYEMYGLISEDLRPHHRDSLILLGHSLGELTCLKV---NELFTTKELFEIANYRNDL 116
           S  LY+ +     +  P   +++ +LGHSLGEL+ L     N L    ++ E+A  R+ L
Sbjct: 54  STLLYQCW----LERGPEQGEAM-MLGHSLGELSALNASGSNALLGVHDVLEVAQRRHAL 108

Query: 117 MVKYTEQYLRAYNRRGSKFEMWALSSPKATDLPYEIHKLLTESPTFPGSHTISVANANSV 176
           M +    + RA+  RG  F    ++  +A DL  ++              T+ +AN NS+
Sbjct: 109 MREAAAAHARAHGVRG--FVARVVTLRRAGDLRAQLEL----------RGTLRLANHNSL 156

Query: 177 KQCVVTGLVEDLEALRTELHLNIPR-LRISELTNPHNLPFHNNTVLRPIQEPLYDFIWKI 235
           +QC+VTG  +D           +P   R+  L NP  +PFHN+ VLRPIQ PLYD +W+ 
Sbjct: 157 RQCIVTGAADD------PAWAALPAGARVDALLNPDGIPFHNDAVLRPIQGPLYDLLWER 210

Query: 236 MKNNGTHTWTTLNHPIVSNLDGKETKFIHHALDKFVKCSSTTVQF-TKCYDTINRIAEAT 294
           +  NG     +L+ P++S LDG  T  +  A++KFV+ S+  V+F   C   +   A AT
Sbjct: 211 LARNGVSRARSLDRPLLSCLDGAATDRLDVAVEKFVRSSTNVVEFVAACRTAVQ--AGAT 268

Query: 295 KDQEDPLDAAICIGPGNVIYNLIRRN 320
                   AA+ +GPG  +  L+ RN
Sbjct: 269 --------AALHVGPGRAVGALVDRN 286

>Scas_660.26
          Length = 592

 Score = 32.3 bits (72), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 44/89 (49%), Gaps = 9/89 (10%)

Query: 189 EALRTELHLNIPRLRISELTNPHNLPFHNNTVLRPIQEPLYDFIWKIMKNNGTHT----- 243
           +A  T LH    RL+I  L+N + L  +        +E  + ++++I K    H      
Sbjct: 315 DAFLTGLHSEETRLKILTLSNKYELMINEYLKFVEAREHKFVYVYEIQKYREKHKEWHPV 374

Query: 244 -WTTLNHPIVSNLDGKETK---FIHHALD 268
            +TT ++ ++SNL  KE+K   FI  ALD
Sbjct: 375 GYTTDDYSLLSNLRVKESKIENFIEKALD 403

>KLLA0E21835g join(1942567..1942679,1942793..1943651) similar to
           sp|P38813 Saccharomyces cerevisiae YHR101c BIG1 big
           cells phenotype singleton, hypothetical start
          Length = 323

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 24/43 (55%)

Query: 241 THTWTTLNHPIVSNLDGKETKFIHHALDKFVKCSSTTVQFTKC 283
           + T+  +N P +S  D K+ K   H L  +V  SSTTV+F K 
Sbjct: 72  SETYVFVNQPGLSRSDFKQHKQSMHKLYNYVLTSSTTVKFEKI 114

>Kwal_33.13530
          Length = 534

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/79 (22%), Positives = 40/79 (50%)

Query: 70  ISEDLRPHHRDSLILLGHSLGELTCLKVNELFTTKELFEIANYRNDLMVKYTEQYLRAYN 129
           + EDLRP +  +++    S     C  +N+L   ++ +   ++  ++ V     +L++ +
Sbjct: 99  VYEDLRPLNDQNVVFWMDSNAIEECSNINDLAINEKAYFGGSFIPEMGVPKLASFLKSCS 158

Query: 130 RRGSKFEMWALSSPKATDL 148
           +  S FE++ L +  A DL
Sbjct: 159 KNNSDFEVFDLHTYVAYDL 177

>Kwal_23.5168
          Length = 1073

 Score = 29.6 bits (65), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 40/101 (39%), Gaps = 13/101 (12%)

Query: 121 TEQYLRAYNRRGSKFEMWALSSPKATDLPYEIHKLLTESPTFPGSHTISVANANSVKQ-- 178
           T+ YLR+ N  G   +  AL SP   DL      L T  PT      ++   A+ +    
Sbjct: 484 TQSYLRS-NDHGFAADKNALQSPFTNDLVSSAQNLETLDPTIIHPDVVAQPPADYMPSSF 542

Query: 179 ------CVVTGLVEDLEALRTELHLNIPRLRISELTNPHNL 213
                 C VT   ED + LRT L      L  ++  N H L
Sbjct: 543 PLIHTVCFVTCYSEDEQGLRTTLD----SLSTTDYPNSHKL 579

>YLR071C (RGR1) [3487] chr12 complement(275379..278627) Component of
           RNA polymerase II holoenzyme and Kornberg's mediator
           (SRB) complex, has positive and negative effects on
           transcription [3249 bp, 1082 aa]
          Length = 1082

 Score = 29.3 bits (64), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 10/33 (30%), Positives = 21/33 (63%)

Query: 27  AQFNTILNRGLHRRDLLEYIFRNPSSPGSIAVC 59
           +Q++T++N GLH  +  + ++ NP +   I +C
Sbjct: 951 SQYSTMVNIGLHNLNEYQIVYYNPQAGTKITIC 983

>Scas_713.20
          Length = 876

 Score = 28.5 bits (62), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 2/34 (5%)

Query: 200 PRLRISELTNPHN--LPFHNNTVLRPIQEPLYDF 231
           P+  ++EL NP N   P HN   +R + EPLY +
Sbjct: 478 PQGDVTELRNPINNEAPSHNTIKIRTVPEPLYHY 511

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.136    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,848,335
Number of extensions: 526911
Number of successful extensions: 1457
Number of sequences better than 10.0: 22
Number of HSP's gapped: 1453
Number of HSP's successfully gapped: 22
Length of query: 339
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 237
Effective length of database: 13,065,073
Effective search space: 3096422301
Effective search space used: 3096422301
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)