Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0J04114g30329915830.0
Kwal_26.866929629610281e-141
KLLA0D07073g29729610271e-141
YOR222W (ODC2)30730310191e-140
Scas_640.253062999951e-136
ACR109W2992989591e-131
YPL134C (ODC1)3103119131e-123
Scas_589.103163027185e-94
YPR021C (AGC1)9023033146e-32
YJR095W (SFC1)3222982982e-31
Sklu_2334.23193022931e-30
Sklu_2359.69023062986e-30
Scas_691.43343202843e-29
ADL049W9122982908e-29
KLLA0F03212g3052952808e-29
CAGL0M09020g3483232741e-27
AGL311C3622942741e-27
KLLA0E13453g9063032695e-26
Scas_602.88852932678e-26
Kwal_47.182163333242572e-25
CAGL0K02365g9192972599e-25
Kwal_47.173218813062599e-25
Sklu_2398.43093032502e-24
Kwal_33.154463052872403e-23
CAGL0B03883g3062982342e-22
Scas_718.53243132326e-22
Kwal_23.43543433392311e-21
Sklu_2075.33452822258e-21
Sklu_1926.23052962211e-20
Scas_489.42973082183e-20
CAGL0K12210g3113112184e-20
Scas_667.223062972167e-20
KLLA0E09680g3072822141e-19
KLLA0F17864g3072972097e-19
KLLA0B12826g3192862071e-18
KLLA0A09383g3662712082e-18
Kwal_55.213353172842062e-18
ACR260W3112842053e-18
CAGL0L02079g2973032025e-18
AFR146W2812992009e-18
Sklu_1275.13113071973e-17
YPR058W (YMC1)3072991973e-17
YDL198C (YHM1)3002821955e-17
YBR291C (CTP1)2993011956e-17
YBR104W (YMC2)3293121966e-17
CAGL0D01606g3053001931e-16
Scas_632.92922891912e-16
AFR131C3443331922e-16
Kwal_33.140503142921903e-16
Scas_562.123002891884e-16
KLLA0B08503g3032851861e-15
Scas_645.93912621862e-15
Kwal_26.79672973031814e-15
Kwal_27.125993043021824e-15
Scas_558.22893161805e-15
Sklu_1149.22962951806e-15
YNL003C (PET8)2843031796e-15
CAGL0K08250g2972821799e-15
CAGL0J09790g3003031781e-14
KLLA0E02772g2842951771e-14
AER184W3053011781e-14
YBR085W (AAC3)3072991771e-14
Scas_709.93653191738e-14
YOR130C (ORT1)2923011718e-14
CAGL0F04213g3063041719e-14
Scas_379.23012911692e-13
Sklu_2442.82753001682e-13
AAL014C2712991672e-13
KLLA0E18810g3773131692e-13
Scas_721.273743251693e-13
CAGL0H03839g2822911673e-13
CAGL0F08305g3742631684e-13
Sklu_1119.13072001674e-13
YJL133W (MRS3)3142961665e-13
ADL009W3792911675e-13
YBL030C (PET9)3182941657e-13
YKL120W (OAC1)3242841657e-13
CAGL0J01661g3273031648e-13
KLLA0D09889g3642881659e-13
Sklu_2127.52782861639e-13
Sklu_2363.23232971631e-12
Kwal_26.76533252101631e-12
Kwal_33.155973051581603e-12
Scas_718.243373031613e-12
Kwal_56.230113032941593e-12
Kwal_33.129883032921593e-12
CAGL0K10362g3013011594e-12
CAGL0L05742g3052871594e-12
YKR052C (MRS4)3042931585e-12
YGR257C (MTM1)3663461587e-12
KLLA0E23705g3683191587e-12
Sklu_2431.53703241578e-12
Kwal_23.35293952851589e-12
Kwal_27.124813042991569e-12
CAGL0J02002g3612991552e-11
YPR011C3263041542e-11
YMR166C3683181542e-11
AER450C3081701523e-11
YIL006W3732881533e-11
Sklu_2430.103242841524e-11
Kwal_27.120813691851524e-11
CAGL0K11616g3202841514e-11
Sklu_2117.22982751514e-11
YEL006W3353101515e-11
Kwal_0.2322742991505e-11
Kwal_55.208683803001525e-11
Sklu_2037.23103051515e-11
YJR077C (MIR1)3112271505e-11
AEL253W3653051516e-11
KLLA0D14036g4313291508e-11
CAGL0G01166g2953071488e-11
Scas_582.73292911499e-11
YMR056C (AAC1)3092751471e-10
CAGL0F00231g3072691472e-10
KLLA0E15532g3262941462e-10
AFL196W3612861472e-10
CAGL0F07711g3683101472e-10
KLLA0D15015g3172941453e-10
KLLA0E12353g3053031453e-10
KLLA0F13464g3002751434e-10
ADL264C3292791434e-10
KLLA0B14454g3051571434e-10
Kwal_27.116262992821425e-10
AGR191W2982841426e-10
KLLA0D04950g2743041416e-10
CAGL0B04543g3173071382e-09
KLLA0A00979g3433441382e-09
YBR192W (RIM2)3771641373e-09
KLLA0D04290g1881811324e-09
Scas_721.1293232061364e-09
Sklu_2432.52882911354e-09
YLR348C (DIC1)2983011355e-09
Kwal_23.39653071701355e-09
Scas_667.43082991355e-09
CAGL0D04774g3223031331e-08
Scas_662.123083031283e-08
Scas_714.183052311284e-08
Kwal_14.22103153021284e-08
Scas_669.63732981285e-08
Kwal_23.47313143191266e-08
YOR100C (CRC1)3272441267e-08
Kwal_23.29133202881267e-08
Scas_673.173141571268e-08
Scas_702.103022921241e-07
CAGL0M05225g3813301242e-07
Scas_715.453052811232e-07
AGR383W2931951222e-07
Kwal_27.114192982481212e-07
CAGL0C02013g3293231223e-07
Kwal_55.213383231501213e-07
Scas_328.1227681193e-07
KLLA0F04697g3071841204e-07
CAGL0G08910g2893091204e-07
YIL134W (FLX1)3111961195e-07
Scas_687.15*3283321195e-07
CAGL0K02915g3422101171e-06
AER366W2931801161e-06
CAGL0J05522g5191841171e-06
AGL047C3161631161e-06
YPR128C (ANT1)3282991152e-06
AGL064W2962971142e-06
KLLA0C13431g3281771133e-06
Scas_716.293161821134e-06
Sklu_2374.7513861134e-06
ABL023W3092651124e-06
YER053C3002821115e-06
KLLA0C11363g517861126e-06
YHR002W (LEU5)3572251116e-06
Scas_697.473282431108e-06
AAR036W3171291099e-06
Kwal_23.30425421691101e-05
AGL065C3351901081e-05
CAGL0G03135g3072261072e-05
Scas_578.3*5243221082e-05
YGR096W (TPC1)3142121072e-05
Kwal_23.57573072821062e-05
YNL083W545831063e-05
Sklu_2115.42993081053e-05
AFR147C3151441044e-05
CAGL0H10538g2973051035e-05
AER419W4931731045e-05
Kwal_47.19228281771027e-05
Kwal_26.79723582101029e-05
Sklu_2433.8420771002e-04
Scas_705.9323307974e-04
KLLA0E18788g381184974e-04
KLLA0E08877g294187947e-04
YDL119C30773947e-04
AFR253W34464910.002
YMR241W (YHM2)314314890.003
CAGL0K07436g307305870.006
Scas_717.20356146860.007
Sklu_2260.5302168860.008
Kwal_55.21106328180850.009
YFR045W285205850.009
Scas_613.24177171830.009
Sklu_2435.234496810.028
Sklu_2127.4323148790.059
Sklu_2194.3312175760.15
YHR206W (SKN7)62244730.36
KLLA0E02750g304114710.49
YMR247C1562110701.00
Scas_671.1*12362651.3
YGR088W (CTT1)57373681.6
ADR036C340311671.6
AFR542W310290671.8
KLLA0F08547g308306653.0
Scas_696.9312122643.6
Scas_705.36*16342624.2
Scas_701.2255032644.4
Scas_648.18*70420627.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J04114g
         (299 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...   614   0.0  
Kwal_26.8669                                                          400   e-141
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...   400   e-141
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...   397   e-140
Scas_640.25                                                           387   e-136
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...   374   e-131
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...   356   e-123
Scas_589.10                                                           281   5e-94
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...   125   6e-32
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...   119   2e-31
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement        117   1e-30
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                         119   6e-30
Scas_691.4                                                            114   3e-29
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....   116   8e-29
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...   112   8e-29
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...   110   1e-27
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...   110   1e-27
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...   108   5e-26
Scas_602.8                                                            107   8e-26
Kwal_47.18216                                                         103   2e-25
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...   104   9e-25
Kwal_47.17321                                                         104   9e-25
Sklu_2398.4 , Contig c2398 9476-10405                                 100   2e-24
Kwal_33.15446                                                          97   3e-23
CAGL0B03883g 383602..384522 weakly similar to sp|P32331 Saccharo...    95   2e-22
Scas_718.5                                                             94   6e-22
Kwal_23.4354                                                           94   1e-21
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement                91   8e-21
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement          90   1e-20
Scas_489.4                                                             89   3e-20
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...    89   4e-20
Scas_667.22                                                            88   7e-20
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...    87   1e-19
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...    85   7e-19
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...    84   1e-18
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    85   2e-18
Kwal_55.21335                                                          84   2e-18
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    84   3e-18
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...    82   5e-18
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...    82   9e-18
Sklu_1275.1 , Contig c1275 314-1249                                    80   3e-17
YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...    80   3e-17
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    80   5e-17
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...    80   6e-17
YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...    80   6e-17
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...    79   1e-16
Scas_632.9                                                             78   2e-16
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    79   2e-16
Kwal_33.14050                                                          78   3e-16
Scas_562.12                                                            77   4e-16
KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...    76   1e-15
Scas_645.9                                                             76   2e-15
Kwal_26.7967                                                           74   4e-15
Kwal_27.12599                                                          75   4e-15
Scas_558.2                                                             74   5e-15
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         74   6e-15
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    74   6e-15
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...    74   9e-15
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    73   1e-14
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...    73   1e-14
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...    73   1e-14
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...    73   1e-14
Scas_709.9                                                             71   8e-14
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...    70   8e-14
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...    70   9e-14
Scas_379.2                                                             70   2e-13
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                          69   2e-13
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    69   2e-13
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...    70   2e-13
Scas_721.27                                                            70   3e-13
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    69   3e-13
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    69   4e-13
Sklu_1119.1 YJR077C, Contig c1119 366-1289                             69   4e-13
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    69   5e-13
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...    69   5e-13
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...    68   7e-13
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...    68   7e-13
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...    68   8e-13
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    68   9e-13
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement         67   9e-13
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                          67   1e-12
Kwal_26.7653                                                           67   1e-12
Kwal_33.15597                                                          66   3e-12
Scas_718.24                                                            67   3e-12
Kwal_56.23011                                                          66   3e-12
Kwal_33.12988                                                          66   3e-12
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...    66   4e-12
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    66   4e-12
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    65   5e-12
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    65   7e-12
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    65   7e-12
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                            65   8e-12
Kwal_23.3529                                                           65   9e-12
Kwal_27.12481                                                          65   9e-12
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...    64   2e-11
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...    64   2e-11
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    64   2e-11
AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH] (1500683..1...    63   3e-11
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...    64   3e-11
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                         63   4e-11
Kwal_27.12081                                                          63   4e-11
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...    63   4e-11
Sklu_2117.2 YDL198C, Contig c2117 3737-4633                            63   4e-11
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...    63   5e-11
Kwal_0.232                                                             62   5e-11
Kwal_55.20868                                                          63   5e-11
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement         63   5e-11
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...    62   5e-11
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    63   6e-11
KLLA0D14036g complement(1203522..1204817) some similarities with...    62   8e-11
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...    62   8e-11
Scas_582.7                                                             62   9e-11
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...    61   1e-10
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...    61   2e-10
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    61   2e-10
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    61   2e-10
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    61   2e-10
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...    60   3e-10
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...    60   3e-10
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    60   4e-10
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...    60   4e-10
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...    60   4e-10
Kwal_27.11626                                                          59   5e-10
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    59   6e-10
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    59   6e-10
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...    58   2e-09
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    58   2e-09
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    57   3e-09
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...    55   4e-09
Scas_721.129                                                           57   4e-09
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement       57   4e-09
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...    57   5e-09
Kwal_23.3965                                                           57   5e-09
Scas_667.4                                                             57   5e-09
CAGL0D04774g complement(467712..468680) similar to tr|Q06497 Sac...    56   1e-08
Scas_662.12                                                            54   3e-08
Scas_714.18                                                            54   4e-08
Kwal_14.2210                                                           54   4e-08
Scas_669.6                                                             54   5e-08
Kwal_23.4731                                                           53   6e-08
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...    53   7e-08
Kwal_23.2913                                                           53   7e-08
Scas_673.17                                                            53   8e-08
Scas_702.10                                                            52   1e-07
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    52   2e-07
Scas_715.45                                                            52   2e-07
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    52   2e-07
Kwal_27.11419                                                          51   2e-07
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    52   3e-07
Kwal_55.21338                                                          51   3e-07
Scas_328.1                                                             50   3e-07
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    51   4e-07
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    51   4e-07
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    50   5e-07
Scas_687.15*                                                           50   5e-07
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...    50   1e-06
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    49   1e-06
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...    50   1e-06
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...    49   1e-06
YPR128C (ANT1) [5547] chr16 complement(791212..792198) Peroxisom...    49   2e-06
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...    49   2e-06
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...    48   3e-06
Scas_716.29                                                            48   4e-06
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement       48   4e-06
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...    48   4e-06
YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of ...    47   5e-06
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...    48   6e-06
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...    47   6e-06
Scas_697.47                                                            47   8e-06
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....    47   9e-06
Kwal_23.3042                                                           47   1e-05
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...    46   1e-05
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...    46   2e-05
Scas_578.3*                                                            46   2e-05
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...    46   2e-05
Kwal_23.5757                                                           45   2e-05
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...    45   3e-05
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            45   3e-05
AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 3...    45   4e-05
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    44   5e-05
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...    45   5e-05
Kwal_47.19228                                                          44   7e-05
Kwal_26.7972                                                           44   9e-05
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       43   2e-04
Scas_705.9                                                             42   4e-04
KLLA0E18788g complement(1661093..1662238) similar to sp|P38702 S...    42   4e-04
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    41   7e-04
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    41   7e-04
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    40   0.002
YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1 ...    39   0.003
CAGL0K07436g complement(734496..735419) highly similar to sp|Q04...    38   0.006
Scas_717.20                                                            38   0.007
Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement         38   0.008
Kwal_55.21106                                                          37   0.009
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    37   0.009
Scas_613.24                                                            37   0.009
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         36   0.028
Sklu_2127.4 , Contig c2127 6322-7293                                   35   0.059
Sklu_2194.3 YMR241W, Contig c2194 5245-6183                            34   0.15 
YHR206W (SKN7) [2491] chr8 (512730..514598) Transcription factor...    33   0.36 
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    32   0.49 
YMR247C (YMR247C) [4203] chr13 complement(763350..768038) Protei...    32   1.00 
Scas_671.1*                                                            30   1.3  
YGR088W (CTT1) [2048] chr7 (654603..656324) Catalase T (cytosoli...    31   1.6  
ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH] (771097..77...    30   1.6  
AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH] complement(...    30   1.8  
KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces c...    30   3.0  
Scas_696.9                                                             29   3.6  
Scas_705.36*                                                           28   4.2  
Scas_701.22                                                            29   4.4  
Scas_648.18*                                                           28   7.4  

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score =  614 bits (1583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/299 (100%), Positives = 299/299 (100%)

Query: 1   MSEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQI 60
           MSEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQI
Sbjct: 1   MSEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQI 60

Query: 61  VKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAG 120
           VKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAG
Sbjct: 61  VKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAG 120

Query: 121 VTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGG 180
           VTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGG
Sbjct: 121 VTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGG 180

Query: 181 YFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLA 240
           YFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLA
Sbjct: 181 YFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLA 240

Query: 241 DGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFFQEM 299
           DGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFFQEM
Sbjct: 241 DGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFFQEM 299

>Kwal_26.8669
          Length = 296

 Score =  400 bits (1028), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 194/296 (65%), Positives = 237/296 (80%), Gaps = 7/296 (2%)

Query: 4   KPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKR 63
           +PLPF YQF +GA AG+SE+LVMYPLDVVKTRMQLQV  G G    Y GV+DC+ QIV +
Sbjct: 5   RPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGP--QYKGVVDCIKQIVAK 62

Query: 64  EGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTE 123
           EG SRLYKGISSP+LMEAPKRATKFACND +QK++K  +GV+KLTQ +SILSG+ AG  E
Sbjct: 63  EGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCE 122

Query: 124 ACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFG 183
           A V+VPFELVKIRLQDV+S + GP++VV K I + G+L++YNGLEST+WR+  WN GYFG
Sbjct: 123 AFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFG 182

Query: 184 VIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGT 243
           +IFQ+RALLP+AK+ +++T NDLIAG+IGG    S   T   VVKSRIQ+  T  +A G 
Sbjct: 183 IIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIG-SLMSTPFDVVKSRIQN--TAVVAGGA 239

Query: 244 VVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFFQEM 299
              KYNW+WPS+F IY EEGF ALYKGF+PK+LRLGPGGGI+LVVF G M FF+ +
Sbjct: 240 --RKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFRTL 293

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score =  400 bits (1027), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 194/296 (65%), Positives = 234/296 (79%), Gaps = 7/296 (2%)

Query: 2   SEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIV 61
            +KPLPF+YQF++GA AGVSE+LVMYPLD+VKT MQLQV  G  SG  Y GV DCL QI 
Sbjct: 3   DQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGG--SGPQYKGVFDCLKQIA 60

Query: 62  KREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGV 121
            +EG SRLYKGISSP+LMEAPKRATKFACND +QK++KDL+G +KLTQ +SILSG+ AG+
Sbjct: 61  AKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGI 120

Query: 122 TEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGY 181
            E+ V+VPFELVKIRLQDV+SKF  P+ VV   + + GIL++YNGLESTMWR+  WN GY
Sbjct: 121 CESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGY 180

Query: 182 FGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLAD 241
           FG+IFQ+RALLPKA T +E+T NDL+AGT+GG    S   T   VVKSR+Q+ A      
Sbjct: 181 FGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLS-SLLSTPFDVVKSRVQNTAVIP--- 236

Query: 242 GTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFFQ 297
             V  KYNW+WP+L  IY EEGF ALYKGF+PK+LRLGPGGGI+LVVF G+M FF+
Sbjct: 237 -GVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFR 291

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score =  397 bits (1019), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 195/303 (64%), Positives = 234/303 (77%), Gaps = 10/303 (3%)

Query: 2   SEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVA-----YNGVIDC 56
           + KPLPFIYQF+SGA AG+SEL VMYPLDVVKTR QL+V + T + V      YNGVIDC
Sbjct: 6   NAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDC 65

Query: 57  LGQIVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSG 116
           L +IVK+EGFSRLY+GISSPMLMEAPKRATKFACND YQK+FK+L+  ++ TQ+ISI +G
Sbjct: 66  LKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIAAG 125

Query: 117 SLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAF 176
           + AG+TEA VIVPFEL+KIR+QDV S + GPM+ + KTI+  GI+ LY G+ESTMWRNA 
Sbjct: 126 ASAGMTEAAVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNAL 185

Query: 177 WNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGAT 236
           WNGGYFGVI+Q+R  +P AKT  +KT NDLIAG IGG    +  +T   VVKSRIQS   
Sbjct: 186 WNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVG-TMLNTPFDVVKSRIQS--- 241

Query: 237 TTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFF 296
              A  + V KYNW  PSL  IY EEGF ALYKGF+PK+ RL PGG +MLVVF GMM FF
Sbjct: 242 -VDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFF 300

Query: 297 QEM 299
           +++
Sbjct: 301 RDL 303

>Scas_640.25
          Length = 306

 Score =  387 bits (995), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 191/299 (63%), Positives = 229/299 (76%), Gaps = 6/299 (2%)

Query: 2   SEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTG--SGVAYNGVIDCLGQ 59
           ++ PLPF YQF++GA AG+SEL+VMYPLDVVKTRMQLQV +G    S   Y GVIDCL Q
Sbjct: 7   TQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQ 66

Query: 60  IVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLA 119
           IVK+EG   +YKGISSPMLMEAPKRA KFA ND + K++K ++G  +LTQQIS+LSG+ A
Sbjct: 67  IVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASA 126

Query: 120 GVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNG 179
           G+TEA VIVPFELVKIRLQDVNSKF GP+EV+   I++ G+  LY+G+EST+WRNA WN 
Sbjct: 127 GITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNA 186

Query: 180 GYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTL 239
           GYFGVIFQ+R LLP AK+  EKT NDL AG +GG       +T   VVKSRIQS     +
Sbjct: 187 GYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMF-NTPFDVVKSRIQSDGNEII 245

Query: 240 ADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFFQE 298
                V KYNWTWPS+ KIY EEGF ALYKGF+PK+LRLGPGG ++LVVF  +M  F+E
Sbjct: 246 NG---VRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFRE 301

 Score = 35.0 bits (79), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 41/90 (45%), Gaps = 2/90 (2%)

Query: 14  SGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGV-AYNGVIDCLGQIVKREGFSRLYKG 72
           +G   G   ++   P DVVK+R+Q   G+   +GV  YN     + +I   EGF  LYKG
Sbjct: 215 AGFVGGTFGVMFNTPFDVVKSRIQSD-GNEIINGVRKYNWTWPSVMKIYHEEGFRALYKG 273

Query: 73  ISSPMLMEAPKRATKFACNDSYQKMFKDLY 102
               +L   P  A       +   +F++ +
Sbjct: 274 FVPKVLRLGPGGAVLLVVFTNVMNVFREFH 303

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score =  374 bits (959), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 186/298 (62%), Positives = 226/298 (75%), Gaps = 11/298 (3%)

Query: 4   KPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKR 63
           K LPF+YQF +GA AGVSE+LVMYPLDVVKTRMQLQV  G G    Y GV+DCL +IV  
Sbjct: 7   KSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGP--HYTGVVDCLKKIVAG 64

Query: 64  EGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTE 123
           EG  RLYKGISSP+LMEAPKRATKFACND +QK++K  +GV+KL+Q +S+L+G+ AG  E
Sbjct: 65  EGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVE 124

Query: 124 ACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFG 183
           A V+VPFELVKIRLQD +S + GP++VV K +   G+L++YNGLEST+WR+A WNGGYFG
Sbjct: 125 AFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFG 184

Query: 184 VIFQIRALLPKAKTNTEKTTNDLIAGTIGGY--CRYSTEHTILSVVKSRIQSGATTTLAD 241
           +IFQ RALLP A   T+  TNDLI+ +IG    C  ST      VVKSRIQ+ A      
Sbjct: 185 IIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTP---FDVVKSRIQNTAVIP--- 238

Query: 242 GTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFFQEM 299
             VV KYNW+ PSL  IY EEGF ALYKGF+PK+LRLGPGGGI+LVVF G++ F + +
Sbjct: 239 -GVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVLDFCRAI 295

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score =  356 bits (913), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 181/311 (58%), Positives = 227/311 (72%), Gaps = 22/311 (7%)

Query: 1   MSEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVA--------YNG 52
           +  +PLPFIYQF +GA AGVSELLVMYPLDVVKTRMQLQV +     V         Y G
Sbjct: 4   IDNRPLPFIYQFTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTG 63

Query: 53  VIDCLGQIVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVD--KLTQQ 110
           V+DCL +IVK+EGFS LYKGI+SP+LMEAPKRA KF+ ND++Q  +K ++     ++TQ+
Sbjct: 64  VMDCLTKIVKKEGFSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIFPTPNGEMTQK 123

Query: 111 ISILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLEST 170
           I+I SG+ AG  EA V+ PFELVKIRLQDVNS+F  P+EVV  ++ + G+LSL+NGLE+T
Sbjct: 124 IAIYSGASAGAVEAFVVAPFELVKIRLQDVNSQFKTPIEVVKNSVVKGGVLSLFNGLEAT 183

Query: 171 MWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGY--CRYSTEHTILSVVK 228
           +WR+  WN GYFG+IFQIR LLP AKT+TEKT NDLIAG IGG   C  +T      VVK
Sbjct: 184 IWRHVLWNAGYFGIIFQIRKLLPAAKTSTEKTRNDLIAGAIGGTVGCLLNTP---FDVVK 240

Query: 229 SRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVV 288
           SRIQ  +         + KYNW+ PS+  +Y EEGF ALYKGF PK++RL PGGG++LVV
Sbjct: 241 SRIQRSSGP-------LRKYNWSLPSVLLVYREEGFKALYKGFAPKVMRLAPGGGLLLVV 293

Query: 289 FNGMMAFFQEM 299
           F  +M FF+E+
Sbjct: 294 FTNVMDFFREV 304

>Scas_589.10
          Length = 316

 Score =  281 bits (718), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 138/302 (45%), Positives = 191/302 (63%), Gaps = 16/302 (5%)

Query: 6   LPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGT--GSGVA------YNGVIDCL 57
           LPFIYQF+SGA AG+SE ++MYPLDVVKTR QLQ+       S VA      ++ ++ CL
Sbjct: 11  LPFIYQFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCL 70

Query: 58  GQIVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGS 117
            +I+K EGF  LYKG+S P+LME PKRA KFA N+ +Q++    + + ++T  +++L+G+
Sbjct: 71  SKILKEEGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKFKLKEVTSTVTLLAGT 130

Query: 118 LAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFW 177
            AG+TE+ ++VPFELVKIRLQD  S +  P+      I   G+  +Y G EST+WRN  W
Sbjct: 131 FAGITESLIVVPFELVKIRLQDAQSDYRSPIRCTRTIIENQGLFGIYAGFESTIWRNTIW 190

Query: 178 NGGYFGVIFQIRALLPKAKTNT--EKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGA 235
           N  YFG+IFQ++  +P+AK+ T  +   ND + G I G C          VVK+R+Q   
Sbjct: 191 NASYFGLIFQVKKFIPRAKSTTKFQGIRNDFLVGAIAG-CMSCFLSVPFDVVKTRMQGSK 249

Query: 236 TTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAF 295
            T+   G     Y W W S+F IY  EG   +YKG +P I R GPGGG++LVVFNG+   
Sbjct: 250 KTS--SGMC---YGWAWQSVFLIYRTEGIKGIYKGILPIICRYGPGGGLLLVVFNGVNEL 304

Query: 296 FQ 297
           F+
Sbjct: 305 FR 306

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score =  125 bits (314), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 97/303 (32%), Positives = 141/303 (46%), Gaps = 36/303 (11%)

Query: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR 68
           +Y F  G+ AG     V+YP+D +KTRMQ Q      S   Y   IDCL +I+ REG   
Sbjct: 531 LYNFSLGSIAGCIGATVVYPIDFIKTRMQAQ-----RSLAQYKNSIDCLLKIISREGIKG 585

Query: 69  LYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIV 128
           LY G+   ++  AP++A K   ND  +    D  G  KL+    I+SG+ AG  +     
Sbjct: 586 LYSGLGPQLIGVAPEKAIKLTVNDFMRNRLTDKNG--KLSLFPEIISGASAGACQVIFTN 643

Query: 129 PFELVKIRLQDVNSKFNG-----PMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFG 183
           P E+VKIRLQ V S + G       E   + +++ G+  LYNG+ + + R+  ++  YF 
Sbjct: 644 PLEIVKIRLQ-VQSDYVGENIQQANETATQIVKKLGLRGLYNGVAACLMRDVPFSAIYFP 702

Query: 184 VIFQIRALL------PKAKTNTEKTTNDLIAGTIGGY-CRYSTEHTILSVVKSRIQ---- 232
               ++  L       K K N  KT   L AG I G    + T  T   V+K+R+Q    
Sbjct: 703 TYAHLKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLT--TPFDVIKTRLQIDPR 760

Query: 233 SGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGM 292
            G T          KYN  + ++  I  EE F + +KG   ++LR  P  G  L  +   
Sbjct: 761 KGET----------KYNGIFHAIRTILKEESFRSFFKGGGARVLRSSPQFGFTLAAYELF 810

Query: 293 MAF 295
             F
Sbjct: 811 KGF 813

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score =  119 bits (298), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 88/298 (29%), Positives = 144/298 (48%), Gaps = 32/298 (10%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71
            ++G  AG+ E L  +PLD +K RMQ+         V   G I     I ++EGF  LYK
Sbjct: 14  LMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFLALYK 73

Query: 72  GISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQIS----ILSGSLAGVTEACVI 127
           G+ + ++   PK A +F+  + Y+ +      V+K +  +S     ++G  AG+TEA ++
Sbjct: 74  GLGAVVIGIIPKMAIRFSSYEFYRTLL-----VNKESGIVSTGNTFVAGVGAGITEAVLV 128

Query: 128 V-PFELVKIRLQ---------DVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFW 177
           V P E+VKIRLQ         +   K+N  +   +  ++E G+ +LY G+  T  R A  
Sbjct: 129 VNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATN 188

Query: 178 NGGYFGVIFQIRALLPKAKT-----NTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQ 232
            G  F V  +++  L          + E +   LI+G IG +      +  L  +K+R+Q
Sbjct: 189 QGANFTVYSKLKEFLQNYHQMDVLPSWETSCIGLISGAIGPFS-----NAPLDTIKTRLQ 243

Query: 233 SGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFN 290
              + +L   + + K       L K   EEGF ALYKG  P+++R+ PG  +   V+ 
Sbjct: 244 KDKSISLEKQSGMKKIITIGAQLLK---EEGFRALYKGITPRVMRVAPGQAVTFTVYE 298

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 83/195 (42%), Gaps = 10/195 (5%)

Query: 111 ISILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEV----VFKTIR----ETGILS 162
           I++++G  AG+ EA    P + +K+R+Q +  +  G   V      KT R    + G L+
Sbjct: 12  INLMAGGTAGLFEALCCHPLDTIKVRMQ-IYRRVAGIEHVKPPGFIKTGRTIYQKEGFLA 70

Query: 163 LYNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHT 222
           LY GL + +          F      R LL   ++    T N  +AG   G         
Sbjct: 71  LYKGLGAVVIGIIPKMAIRFSSYEFYRTLLVNKESGIVSTGNTFVAGVGAGITEAVLVVN 130

Query: 223 ILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGG 282
            + VVK R+Q+   T  ++    PKYN    + + I  EEG +ALY+G      R     
Sbjct: 131 PMEVVKIRLQAQHLTP-SEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATNQ 189

Query: 283 GIMLVVFNGMMAFFQ 297
           G    V++ +  F Q
Sbjct: 190 GANFTVYSKLKEFLQ 204

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 37/74 (50%)

Query: 28  PLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGISSPMLMEAPKRATK 87
           PLD +KTR+Q               +I    Q++K EGF  LYKGI+  ++  AP +A  
Sbjct: 234 PLDTIKTRLQKDKSISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVT 293

Query: 88  FACNDSYQKMFKDL 101
           F   +  ++  ++L
Sbjct: 294 FTVYEYVREHLENL 307

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score =  117 bits (293), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 91/302 (30%), Positives = 141/302 (46%), Gaps = 42/302 (13%)

Query: 11  QFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLY 70
             ++G  AG+ E L  +PLD +K RMQ+   S    G+   G I     I   EG   LY
Sbjct: 13  NLIAGGTAGLFEALCCHPLDTIKVRMQIYRRSAL-EGIKPPGFIKTGRNIYTEEGLLALY 71

Query: 71  KGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQIS----ILSGSLAGVTEACV 126
           KG+ + ++   PK A +F+  + Y+         DK T  +S     L+G  AG TEA +
Sbjct: 72  KGLGAVVIGIIPKMAIRFSSYEFYRSAL-----ADKQTGSVSTGNTFLAGVGAGTTEAVL 126

Query: 127 IV-PFELVKIRLQD--------VNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFW 177
           +V P E+VKIRLQ          + ++   ++  +  ++E GI +LY G+  T  R A  
Sbjct: 127 VVNPMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGIGALYRGVSLTAARQATN 186

Query: 178 NGGYFGVIFQIRALLPKA-KTNT----EKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQ 232
            G  F V  +++  L +  KT+     E +   LI+G IG +      +  L  +K+R+Q
Sbjct: 187 QGANFTVYSKLKEFLQEHHKTDALPSWETSCIGLISGAIGPF-----SNAPLDTIKTRLQ 241

Query: 233 SGATTTLADGTVVPKYNWTWPSLFKI----YSEEGFTALYKGFIPKILRLGPGGGIMLVV 288
              +T    G         W  +  I      EEGF ALYKG  P+++R+ PG  +   V
Sbjct: 242 KDKSTANMSG---------WSRIVTIGKQLIKEEGFRALYKGITPRVMRVAPGQAVTFTV 292

Query: 289 FN 290
           + 
Sbjct: 293 YE 294

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 81/194 (41%), Gaps = 8/194 (4%)

Query: 111 ISILSGSLAGVTEACVIVPFELVKIRLQDVN-SKFNGPMEVVF-KTIR----ETGILSLY 164
           +++++G  AG+ EA    P + +K+R+Q    S   G     F KT R    E G+L+LY
Sbjct: 12  VNLIAGGTAGLFEALCCHPLDTIKVRMQIYRRSALEGIKPPGFIKTGRNIYTEEGLLALY 71

Query: 165 NGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTIL 224
            GL + +          F      R+ L   +T +  T N  +AG   G          +
Sbjct: 72  KGLGAVVIGIIPKMAIRFSSYEFYRSALADKQTGSVSTGNTFLAGVGAGTTEAVLVVNPM 131

Query: 225 SVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGI 284
            VVK R+Q  A     +    P+Y     + + I  EEG  ALY+G      R     G 
Sbjct: 132 EVVKIRLQ--AQHLHPETAASPRYRNALQACYLIVKEEGIGALYRGVSLTAARQATNQGA 189

Query: 285 MLVVFNGMMAFFQE 298
              V++ +  F QE
Sbjct: 190 NFTVYSKLKEFLQE 203

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score =  119 bits (298), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 96/306 (31%), Positives = 139/306 (45%), Gaps = 39/306 (12%)

Query: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR 68
           IY F  G+ AG     V+YP+D+VKTRMQ Q      S   Y   IDC  +I  REG   
Sbjct: 519 IYNFTLGSIAGCIGATVVYPIDLVKTRMQAQ-----RSFSQYKNSIDCFAKIFSREGIRG 573

Query: 69  LYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIV 128
           +Y G+   ++  AP++A K   ND  +    D +    L     ILSG+ AG  +     
Sbjct: 574 IYSGLGPQLIGVAPEKAIKLTVNDYMRGRLMDKHA--NLKWYFEILSGACAGACQVVFTN 631

Query: 129 PFELVKIRLQDVNSKFNGPM----EVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGV 184
           P E+VKIRLQ V S++ G +          I++ GI  LY G+ + + R+  ++  YF  
Sbjct: 632 PLEVVKIRLQ-VRSEYAGDVLKSQVTALGVIKQLGIKGLYKGIAACLMRDVPFSAIYFPT 690

Query: 185 IFQIRALL----PKAKT--NTEKTTNDLIAGTIGGY-CRYSTEHTILSVVKSRIQ----S 233
              ++  +    PK K   N  KT   L+AG + G    Y T  T   V+K+R+Q     
Sbjct: 691 YAHLKKDVFKYDPKDKKQRNKLKTWELLVAGGLAGMPAAYLT--TPFDVIKTRLQIDPRK 748

Query: 234 GATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMM 293
           G T          +Y   + +   I  EE F + +KG   ++LR  P  G  L  +    
Sbjct: 749 GET----------RYEGIFHAARTILKEESFKSFFKGGSARVLRSSPQFGFTLAAYE--- 795

Query: 294 AFFQEM 299
             FQ M
Sbjct: 796 -IFQNM 800

 Score = 70.9 bits (172), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 54/217 (24%), Positives = 102/217 (47%), Gaps = 19/217 (8%)

Query: 6   LPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREG 65
           L + ++ +SGA AG  +++   PL+VVK R+Q++      +G      +  LG ++K+ G
Sbjct: 610 LKWYFEILSGACAGACQVVFTNPLEVVKIRLQVR---SEYAGDVLKSQVTALG-VIKQLG 665

Query: 66  FSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVD--------KLTQQISILSGS 117
              LYKGI++ ++ + P  A  F    +Y  + KD++  D        KL     +++G 
Sbjct: 666 IKGLYKGIAACLMRDVPFSAIYFP---TYAHLKKDVFKYDPKDKKQRNKLKTWELLVAGG 722

Query: 118 LAGVTEACVIVPFELVKIRLQ----DVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWR 173
           LAG+  A +  PF+++K RLQ       +++ G        ++E    S + G  + + R
Sbjct: 723 LAGMPAAYLTTPFDVIKTRLQIDPRKGETRYEGIFHAARTILKEESFKSFFKGGSARVLR 782

Query: 174 NAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGT 210
           ++   G         + + P  +  +  T +D  A T
Sbjct: 783 SSPQFGFTLAAYEIFQNMFPLKREESTFTKDDTPAVT 819

>Scas_691.4
          Length = 334

 Score =  114 bits (284), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 90/320 (28%), Positives = 142/320 (44%), Gaps = 51/320 (15%)

Query: 2   SEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIV 61
            +K  P I   V+G  AG+ E L  +PLD +K RMQ+   +    G+  +G I     I 
Sbjct: 8   DKKSSPLI-NLVAGGTAGLFEALCCHPLDTIKVRMQI---AKRTEGMRPHGFITTGRNIY 63

Query: 62  KREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGV 121
             EGF  LYKG+ + ++   PK A +F+  + Y+    D      +T   + L+G  AG+
Sbjct: 64  SHEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRNALTD-KETRTITTGNTFLAGVGAGI 122

Query: 122 TEACVIV-PFELVKIRLQD----------------------VNSKFNGPMEVVFKTIRET 158
           TEA ++V P E+VKIRLQ                          K+   +   +  ++E 
Sbjct: 123 TEAVLVVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIVKEE 182

Query: 159 GILSLYNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNT-----EKTTNDLIAGTIGG 213
           G  +LY G+  T  R A   G  F V   ++  L K          E +   LI+G IG 
Sbjct: 183 GAGALYRGVSLTAARQATNQGANFTVYSYLKDYLQKYHNRESLPSWETSCIGLISGAIGP 242

Query: 214 YCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLF----KIYSEEGFTALYK 269
           +      +  L  +K+R+Q   + +          N  W  ++    ++  EEGF ALYK
Sbjct: 243 FS-----NAPLDTIKTRLQKDKSIS---------SNSAWKKIYIIGTQLIKEEGFRALYK 288

Query: 270 GFIPKILRLGPGGGIMLVVF 289
           G  P+++R+ PG  +   V+
Sbjct: 289 GITPRVMRVAPGQAVTFTVY 308

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 53/205 (25%), Positives = 80/205 (39%), Gaps = 18/205 (8%)

Query: 111 ISILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTI-----RETGILSLYN 165
           I++++G  AG+ EA    P + +K+R+Q +  +  G     F T         G L+LY 
Sbjct: 15  INLVAGGTAGLFEALCCHPLDTIKVRMQ-IAKRTEGMRPHGFITTGRNIYSHEGFLALYK 73

Query: 166 GLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILS 225
           GL + +          F      R  L   +T T  T N  +AG   G          + 
Sbjct: 74  GLGAVVIGIIPKMAIRFSSYEFYRNALTDKETRTITTGNTFLAGVGAGITEAVLVVNPME 133

Query: 226 VVKSRIQSGATTTL--------ADGTVV----PKYNWTWPSLFKIYSEEGFTALYKGFIP 273
           VVK R+Q+     L        A GT      PKY     + + I  EEG  ALY+G   
Sbjct: 134 VVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIVKEEGAGALYRGVSL 193

Query: 274 KILRLGPGGGIMLVVFNGMMAFFQE 298
              R     G    V++ +  + Q+
Sbjct: 194 TAARQATNQGANFTVYSYLKDYLQK 218

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 38/74 (51%), Gaps = 2/74 (2%)

Query: 28  PLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGISSPMLMEAPKRATK 87
           PLD +KTR  LQ      S  A+  +     Q++K EGF  LYKGI+  ++  AP +A  
Sbjct: 247 PLDTIKTR--LQKDKSISSNSAWKKIYIIGTQLIKEEGFRALYKGITPRVMRVAPGQAVT 304

Query: 88  FACNDSYQKMFKDL 101
           F   +  +K  + L
Sbjct: 305 FTVYEFVRKHLETL 318

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score =  116 bits (290), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 94/298 (31%), Positives = 138/298 (46%), Gaps = 39/298 (13%)

Query: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR 68
           IY F  G+ AG    +V+YP+D+VKTRMQ Q          Y   IDCL +I+ +EG   
Sbjct: 525 IYNFTLGSVAGCIGAMVVYPIDMVKTRMQAQRDFSK-----YKNSIDCLLKILSKEGVRG 579

Query: 69  LYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVD-KLTQQISILSGSLAGVTEACVI 127
           LY G+   ++  AP++A K   ND    M   L G D KL+    I+SG+ AG  +    
Sbjct: 580 LYSGLGPQLIGVAPEKAIKLTVND---HMRATLAGRDGKLSLPCEIISGATAGACQVVFT 636

Query: 128 VPFELVKIRLQDVNSKFNGPMEV----VFKTIRETGILSLYNGLESTMWRNAFWNGGYFG 183
            P E+VKIRLQ V S +              I+  G++ LY G  + + R+  ++  YF 
Sbjct: 637 NPLEIVKIRLQ-VKSDYVADAARNSVNAISVIKNLGLIGLYRGAGACLLRDIPFSAIYFP 695

Query: 184 VIFQIRALL----PK--AKTNTEKTTNDLIAGTIGGY-CRYSTEHTILSVVKSRIQSGAT 236
               I++ +    PK   K N   T   L++G + G    + T  T   V+K+R+Q    
Sbjct: 696 TYAHIKSNVFNFDPKDSDKRNKLNTWQLLVSGGLAGMPAAFLT--TPFDVIKTRLQ---- 749

Query: 237 TTLADGTVVPK-----YNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVF 289
                  + PK     YN  W +   I  EEG  + +KG   ++LR  P  G  L  +
Sbjct: 750 -------IDPKKGESVYNGIWDAARTILKEEGIKSFFKGGPARVLRSSPQFGFTLAAY 800

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/87 (31%), Positives = 42/87 (48%), Gaps = 3/87 (3%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71
            VSG  AG+    +  P DV+KTR+Q+    G      YNG+ D    I+K EG    +K
Sbjct: 724 LVSGGLAGMPAAFLTTPFDVIKTRLQIDPKKGES---VYNGIWDAARTILKEEGIKSFFK 780

Query: 72  GISSPMLMEAPKRATKFACNDSYQKMF 98
           G  + +L  +P+     A  + +  +F
Sbjct: 781 GGPARVLRSSPQFGFTLAAYEIFHNLF 807

 Score = 38.1 bits (87), Expect = 0.008,   Method: Composition-based stats.
 Identities = 27/88 (30%), Positives = 41/88 (46%), Gaps = 13/88 (14%)

Query: 207 IAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTA 266
           +AG IG    Y      + +VK+R+Q+    +        KY  +   L KI S+EG   
Sbjct: 533 VAGCIGAMVVYP-----IDMVKTRMQAQRDFS--------KYKNSIDCLLKILSKEGVRG 579

Query: 267 LYKGFIPKILRLGPGGGIMLVVFNGMMA 294
           LY G  P+++ + P   I L V + M A
Sbjct: 580 LYSGLGPQLIGVAPEKAIKLTVNDHMRA 607

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score =  112 bits (280), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 88/295 (29%), Positives = 144/295 (48%), Gaps = 33/295 (11%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71
            ++G  AG+ E L  +PLD +K RMQ+   +  GSGV   G I   G+I + EGF   YK
Sbjct: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQI-YKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72

Query: 72  GISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEA-CVIVPF 130
           G+ + ++   PK A +F+  + Y+ +  D     K++   + ++G  AG+TEA  V+ P 
Sbjct: 73  GLGAVVIGITPKMAIRFSSYEFYRTLLADKE-TGKVSTGNTFIAGVGAGITEAVVVVNPM 131

Query: 131 ELVKIRLQDVN-------SKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFG 183
           E+VKIRLQ  +        K+   ++  +  ++E G  +LY G+  T  R A   G  F 
Sbjct: 132 EVVKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFT 191

Query: 184 VIFQIRALLPKAKTNT-----EKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTT 238
           V  +++  L            E +   LI+G IG +      +  L  +K+R+Q   +T 
Sbjct: 192 VYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFS-----NAPLDTIKTRLQKDKSTK 246

Query: 239 LADG----TVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVF 289
              G    T++ K         ++  EEGF ALYKG  P+++R+ PG  +    +
Sbjct: 247 NMSGLKRITIIGK---------QLIQEEGFRALYKGITPRVMRVAPGQAVTFTAY 292

 Score = 53.1 bits (126), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 78/193 (40%), Gaps = 9/193 (4%)

Query: 111 ISILSGSLAGVTEACVIVPFELVKIRLQ----DVNSKFNGP--MEVVFKTIRETGILSLY 164
           +++++G  AG+ E     P + +K+R+Q     V S    P  ++   +  R  G L+ Y
Sbjct: 12  VNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFY 71

Query: 165 NGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTIL 224
            GL + +          F      R LL   +T    T N  IAG   G          +
Sbjct: 72  KGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAVVVVNPM 131

Query: 225 SVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGI 284
            VVK R+Q+     +      PKY     + + I  EEGF+ALY+G      R     G 
Sbjct: 132 EVVKIRLQAQHLNPVEG---APKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGA 188

Query: 285 MLVVFNGMMAFFQ 297
              V++ +  F Q
Sbjct: 189 NFTVYSKLKEFLQ 201

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 42/74 (56%), Gaps = 5/74 (6%)

Query: 28  PLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGISSPMLMEAPKRATK 87
           PLD +KTR+Q    +   SG+    +I    Q+++ EGF  LYKGI+  ++  AP +A  
Sbjct: 231 PLDTIKTRLQKDKSTKNMSGLKRITIIG--KQLIQEEGFRALYKGITPRVMRVAPGQAVT 288

Query: 88  FACNDSYQKMFKDL 101
           F    +Y+ + K+L
Sbjct: 289 FT---AYEFIRKEL 299

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score =  110 bits (274), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 93/323 (28%), Positives = 146/323 (45%), Gaps = 52/323 (16%)

Query: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQL--------------------------QVGS 42
           +   V+G  AG+ E L  +PLD +K RMQ+                            G 
Sbjct: 12  VVNLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVGGG 71

Query: 43  GTGSGVAYNGVIDCLGQIVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLY 102
              + +   G I     I  +EGF  LYKG+ + ++   PK A +F+  + Y+ +  D  
Sbjct: 72  DATAAIKPPGFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADKQ 131

Query: 103 -GVDKLTQQISILSGSLAGVTEACVIV-PFELVKIRLQD---------VNSKFNGPMEVV 151
            GV  ++   + ++G  AGVTEA ++V P E+VKIRLQ             K+   ++  
Sbjct: 132 TGV--VSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAG 189

Query: 152 FKTIRETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRALLPKAK-TNT----EKTTNDL 206
           +  I+E GI +LY G+  T  R A   G  F V  ++R  L +   T T    E +   L
Sbjct: 190 YTIIKEEGISALYRGVSLTAARQATNQGANFTVYSKLREFLQEYHGTETLPSWETSCIGL 249

Query: 207 IAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTA 266
           I+G IG +      +  L  +K+R+Q   +T+    +   +       L K   EEGF A
Sbjct: 250 ISGAIGPFS-----NAPLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLK---EEGFRA 301

Query: 267 LYKGFIPKILRLGPGGGIMLVVF 289
           LYKG  P+++R+ PG  +   V+
Sbjct: 302 LYKGITPRVMRVAPGQAVTFTVY 324

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/221 (23%), Positives = 79/221 (35%), Gaps = 34/221 (15%)

Query: 111 ISILSGSLAGVTEACVIVPFELVKIRLQ-------------------------------D 139
           +++++G  AG+ EA    P + +K+R+Q                               D
Sbjct: 13  VNLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVGGGD 72

Query: 140 VNSKFNGP--MEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKT 197
             +    P  +        + G L+LY GL + +          F      R LL   +T
Sbjct: 73  ATAAIKPPGFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADKQT 132

Query: 198 NTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFK 257
               T+N  IAG   G          + VVK R+Q+       D    PKY     + + 
Sbjct: 133 GVVSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHD-LAKPKYTNAVQAGYT 191

Query: 258 IYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFFQE 298
           I  EEG +ALY+G      R     G    V++ +  F QE
Sbjct: 192 IIKEEGISALYRGVSLTAARQATNQGANFTVYSKLREFLQE 232

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 38/74 (51%)

Query: 28  PLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGISSPMLMEAPKRATK 87
           PLD +KTR+Q    +       +  +     Q++K EGF  LYKGI+  ++  AP +A  
Sbjct: 261 PLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKEEGFRALYKGITPRVMRVAPGQAVT 320

Query: 88  FACNDSYQKMFKDL 101
           F   +  ++  ++L
Sbjct: 321 FTVYEFVRRHLENL 334

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score =  110 bits (274), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 86/294 (29%), Positives = 141/294 (47%), Gaps = 32/294 (10%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71
            V+G  AG+ E L  +PLD +K RMQ+   +  G+     G +     I   EG    YK
Sbjct: 61  LVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPP--GFLRTGANIYSGEGLLAFYK 118

Query: 72  GISSPMLMEAPKRATKFACNDSYQKMFKDLY-GVDKLTQQISILSGSLAGVTEACVIV-P 129
           G+ + ++   PK A +F+  + Y+ +  D   GV  ++   + L+G  AGVTEA ++V P
Sbjct: 119 GLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGV--VSTGNTFLAGVGAGVTEAVLVVNP 176

Query: 130 FELVKIRLQDVN-------SKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYF 182
            E+VKIRLQ  +        K+   ++  +  ++E GI +LY G+  T  R A   G  F
Sbjct: 177 MEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANF 236

Query: 183 GVIFQIRALLPKAKTNT-----EKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATT 237
            V  ++   L +   +      E +   L++G IG +      +  L  +K+R+Q   +T
Sbjct: 237 TVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPF-----SNAPLDTIKTRLQKDKST 291

Query: 238 TLADGTVVPKYNWTWPSLF--KIYSEEGFTALYKGFIPKILRLGPGGGIMLVVF 289
                      NW   +    ++  EEGF ALYKG  P+++R+ PG  +   V+
Sbjct: 292 RNLS-------NWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVY 338

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/235 (23%), Positives = 94/235 (40%), Gaps = 30/235 (12%)

Query: 81  APKRATKFACNDSYQKMFKDLYGVDKLTQQ--ISILSGSLAGVTEACVIVPFELVKIRLQ 138
           A +R+    C+   Q+ + D +   K +    +++++G  AG+ EA    P + +K+R+Q
Sbjct: 27  ARRRSVADPCSAVCQQPYPDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQ 86

Query: 139 -----DVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVIFQI----- 188
                +  +K  G +          G+L+ Y GL + +           G+I ++     
Sbjct: 87  IYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVV----------IGIIPKMAIRFS 136

Query: 189 -----RALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGT 243
                R LL   +T    T N  +AG   G          + VVK R+Q+      A+  
Sbjct: 137 SYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQ 196

Query: 244 VVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFFQE 298
              KY     + + I  EEG  ALY+G      R     G    V++ +M   QE
Sbjct: 197 ---KYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQE 248

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 44/91 (48%), Gaps = 8/91 (8%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLG-QIVKREGFSRLY 70
            VSGA    S      PLD +KTR+Q    +   S       I  +G Q+V+ EGF  LY
Sbjct: 265 LVSGAIGPFSNA----PLDTIKTRLQKDKSTRNLSNWVR---ITTIGRQLVQEEGFRALY 317

Query: 71  KGISSPMLMEAPKRATKFACNDSYQKMFKDL 101
           KGI+  ++  AP +A  F   +  ++  + L
Sbjct: 318 KGITPRVMRVAPGQAVTFTVYEFVRRHLEGL 348

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score =  108 bits (269), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 95/303 (31%), Positives = 137/303 (45%), Gaps = 35/303 (11%)

Query: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR 68
           I+ F  G+ AG     V+YP+D+VKTRMQ Q  S     V Y   IDC+ +I + +G   
Sbjct: 505 IHNFTLGSIAGCIGATVVYPIDLVKTRMQAQRNS-----VQYKNSIDCVVKIFQTKGIRG 559

Query: 69  LYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIV 128
           LY G+   ++  AP++A K   ND  ++ F +     K  Q+  ILSG+ AG  +     
Sbjct: 560 LYSGLGPQLIGVAPEKAIKLTVNDFMRQYFMNKSRTIKWYQE--ILSGATAGACQVVFTN 617

Query: 129 PFELVKIRLQDVNSKFNG----PMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGV 184
           P E+VKIRLQ + S + G    P       IR+ G+  LY G  + + R+  ++  YF  
Sbjct: 618 PLEIVKIRLQ-MRSDYVGENARPQLGAVGIIRQLGLRGLYKGAAACLLRDVPFSAIYFPT 676

Query: 185 IFQIRALL------PKAKTNTEKTTNDLIAGTIGGY-CRYSTEHTILSVVKSRIQ----S 233
              ++  +       K K N  KT   L+AG I G    Y T  T   V+K+R+Q     
Sbjct: 677 YAHLKKDVFNFDPNDKNKRNKLKTWELLLAGGIAGMPAAYLT--TPFDVIKTRLQIDPRK 734

Query: 234 GATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMM 293
           G TT          Y     +   I  EE   + +KG   ++LR  P  G  L  F    
Sbjct: 735 GETT----------YTGVIHAARTILKEESIKSFFKGGPARVLRSSPQFGFTLAAFEMFQ 784

Query: 294 AFF 296
             F
Sbjct: 785 GLF 787

 Score = 62.8 bits (151), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 92/205 (44%), Gaps = 25/205 (12%)

Query: 11  QFVSGAAAGVSELLVMYPLDVVKTRMQLQ---VGSGTGSGVAYNGVIDCLGQIVKREGFS 67
           + +SGA AG  +++   PL++VK R+Q++   VG      +   G+I  L       G  
Sbjct: 601 EILSGATAGACQVVFTNPLEIVKIRLQMRSDYVGENARPQLGAVGIIRQL-------GLR 653

Query: 68  RLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVD--------KLTQQISILSGSLA 119
            LYKG ++ +L + P  A  F    +Y  + KD++  D        KL     +L+G +A
Sbjct: 654 GLYKGAAACLLRDVPFSAIYFP---TYAHLKKDVFNFDPNDKNKRNKLKTWELLLAGGIA 710

Query: 120 GVTEACVIVPFELVKIRLQDVNSK----FNGPMEVVFKTIRETGILSLYNGLESTMWRNA 175
           G+  A +  PF+++K RLQ    K    + G +      ++E  I S + G  + + R++
Sbjct: 711 GMPAAYLTTPFDVIKTRLQIDPRKGETTYTGVIHAARTILKEESIKSFFKGGPARVLRSS 770

Query: 176 FWNGGYFGVIFQIRALLPKAKTNTE 200
              G         + L P    N E
Sbjct: 771 PQFGFTLAAFEMFQGLFPSHFKNHE 795

>Scas_602.8
          Length = 885

 Score =  107 bits (267), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 87/293 (29%), Positives = 138/293 (47%), Gaps = 28/293 (9%)

Query: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR 68
           I+ F  G+ AG     ++YP+D +KTRMQ Q      S   Y   IDCL +I  +EG   
Sbjct: 499 IFNFSLGSVAGCIGATLVYPIDFIKTRMQAQ-----RSLTKYKNSIDCLVKIFGKEGIRG 553

Query: 69  LYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIV 128
           LY G+   ++  AP++A K   ND  +K   D  G  +L  +  +LSG+ AG  +     
Sbjct: 554 LYSGLGPQLIGVAPEKAIKLTVNDFMRKSLVDKKGNLQLGAE--VLSGATAGACQVVFTN 611

Query: 129 PFELVKIRLQDVNSKFNGPM-----EVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFG 183
           P E+VKIRLQ V S++   M        F+ I+E  ++ LY G+ + + R+  ++  YF 
Sbjct: 612 PLEIVKIRLQ-VKSEYTNAMIPKSQLTAFQIIKELKLIGLYKGVGACLLRDVPFSAIYFP 670

Query: 184 VIFQIRALL------PKAKTNTEKTTNDLIAGTIGGY-CRYSTEHTILSVVKSRIQSGAT 236
               ++  +       K K +  KT   L AG + G    + T  T   V+K+R+Q    
Sbjct: 671 TYAHLKKNVFQFDPNDKDKRDRLKTWELLTAGALAGVPAAFLT--TPFDVIKTRLQ---- 724

Query: 237 TTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVF 289
             +  G    +Y     ++  I  EE F + +KG   +++R  P  G  L  +
Sbjct: 725 --IEPGVGETRYTGILHAVRTILKEESFRSFFKGGAARVMRSSPQFGFTLAAY 775

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 46/86 (53%), Gaps = 3/86 (3%)

Query: 13  VSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKG 72
            +GA AGV    +  P DV+KTR+Q++ G G      Y G++  +  I+K E F   +KG
Sbjct: 700 TAGALAGVPAAFLTTPFDVIKTRLQIEPGVGE---TRYTGILHAVRTILKEESFRSFFKG 756

Query: 73  ISSPMLMEAPKRATKFACNDSYQKMF 98
            ++ ++  +P+     A  + ++ MF
Sbjct: 757 GAARVMRSSPQFGFTLAAYELFKNMF 782

>Kwal_47.18216
          Length = 333

 Score =  103 bits (257), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 86/324 (26%), Positives = 139/324 (42%), Gaps = 62/324 (19%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71
            V+G  AG+ E L  +PLD +K RMQ+        G    G I     I  +EGF  LYK
Sbjct: 14  LVAGGTAGLFEALCCHPLDTIKVRMQI-YSRAREQGQRARGFIGTARDISTQEGFLALYK 72

Query: 72  GISSPMLMEAPKRATKFACNDSYQKMFKDLY-GVDKLTQQISILSGSLAGVTEACVIV-P 129
           G+ + ++   PK A +F   + ++ +  D   GV  ++   + ++G  AG+TEA ++V P
Sbjct: 73  GLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGV--VSTGNTFVAGVGAGITEAVMVVNP 130

Query: 130 FELVKIRLQ----------------------------------DVNSKFNGPMEVVFKTI 155
            E+VKIRLQ                                      K+   ++  +  +
Sbjct: 131 MEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAATPKYRNAIQAAYVIV 190

Query: 156 RETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNT-----EKTTNDLIAGT 210
           +E G  +LY G+  T  R A   G  F V   +++ L +          E +   LI+G 
Sbjct: 191 KEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLISGA 250

Query: 211 IGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKI----YSEEGFTA 266
           +G +      +  L  +K+R+Q   +T+   G         W  +  I      EEGF A
Sbjct: 251 LGPFS-----NAPLDTIKTRLQKDKSTSKDSG---------WSRILAIGRQLIREEGFRA 296

Query: 267 LYKGFIPKILRLGPGGGIMLVVFN 290
           LYKG  P+++R+ PG  +   V+ 
Sbjct: 297 LYKGITPRVMRVAPGQAVTFTVYE 320

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 57/218 (26%), Positives = 91/218 (41%), Gaps = 41/218 (18%)

Query: 12  FVSGAAAGVSE-LLVMYPLDVVKTRMQLQ-----------VGS----------------G 43
           FV+G  AG++E ++V+ P++VVK R+Q Q            GS                 
Sbjct: 113 FVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATEN 172

Query: 44  TGSGVAYNGVIDCLGQIVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYG 103
             +   Y   I     IVK EG   LY+G+S     +A  +   F    + +   ++ + 
Sbjct: 173 VAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQ 232

Query: 104 VDKL----TQQISILSGSLAGVTEACVIVPFELVKIRLQ-----DVNSKFNGPMEVVFKT 154
            D L    T  I ++SG+L   + A    P + +K RLQ       +S ++  + +  + 
Sbjct: 233 TDMLPSWETSLIGLISGALGPFSNA----PLDTIKTRLQKDKSTSKDSGWSRILAIGRQL 288

Query: 155 IRETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRALL 192
           IRE G  +LY G+   + R A      F V   IR  L
Sbjct: 289 IREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 41/74 (55%), Gaps = 2/74 (2%)

Query: 28  PLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGISSPMLMEAPKRATK 87
           PLD +KTR+Q    +   SG  ++ ++    Q+++ EGF  LYKGI+  ++  AP +A  
Sbjct: 258 PLDTIKTRLQKDKSTSKDSG--WSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVT 315

Query: 88  FACNDSYQKMFKDL 101
           F   +  +K  + L
Sbjct: 316 FTVYELIRKKLEGL 329

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 52/228 (22%), Positives = 84/228 (36%), Gaps = 50/228 (21%)

Query: 111 ISILSGSLAGVTEACVIVPFELVKIRLQ------DVNSKFNGPMEVVFKTIRETGILSLY 164
           I++++G  AG+ EA    P + +K+R+Q      +   +  G +        + G L+LY
Sbjct: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALY 71

Query: 165 NGLESTMWRNAFWNGGYFGVIFQI----------RALLPKAKTNTEKTTNDLIAGTIGGY 214
            GL + +           G+I ++          R LL   +T    T N  +AG   G 
Sbjct: 72  KGLGAVV----------IGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGI 121

Query: 215 CRYSTEHTILSVVKSRIQS------------------------GATTTLADGTVVPKYNW 250
                    + VVK R+Q+                         ATT   +    PKY  
Sbjct: 122 TEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAATPKYRN 181

Query: 251 TWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFFQE 298
              + + I  EEG  ALY+G      R     G    V++ + +  QE
Sbjct: 182 AIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQE 229

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score =  104 bits (259), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 88/297 (29%), Positives = 128/297 (43%), Gaps = 36/297 (12%)

Query: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR 68
           +Y F  G+ AG     ++YP+D VKTRMQ Q      S   Y   IDC  +I+ REG   
Sbjct: 544 LYNFSLGSVAGCIGATIVYPIDFVKTRMQAQ-----RSLSQYKNSIDCFLKILSREGIRG 598

Query: 69  LYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIV 128
           +Y G+   ++  AP++A K   ND  +   KD  G  KL     I+SG+ AG  +     
Sbjct: 599 VYSGLGPQLIGVAPEKAIKLTVNDYMRNKLKDKNG--KLGLLSEIISGASAGACQVIFTN 656

Query: 129 PFELVKIRLQ----DVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGV 184
           P E+VKIRLQ     V            + I+  G+  LY G  + + R+  ++  YF  
Sbjct: 657 PLEIVKIRLQVKGEYVAENAENAKLTALQIIKRLGLPGLYKGAAACLLRDVPFSAIYFPT 716

Query: 185 IFQIRALL------PKAKTNTEKTTNDLIAGTIGGY-CRYSTEHTILSVVKSRIQSGATT 237
              ++  L       K K +   T   L AG + G    Y T  T   V+K+R+Q     
Sbjct: 717 YAHLKRDLFNFDPNDKNKRSRLNTWELLSAGALAGMPAAYLT--TPFDVIKTRLQ----- 769

Query: 238 TLADGTVVPK-----YNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVF 289
                 + PK     Y     +   I  EE F + +KG   ++LR  P  G  L  +
Sbjct: 770 ------IDPKKGETIYKGIIHAARTILREESFKSFFKGGAARVLRSSPQFGFTLAAY 820

 Score = 71.2 bits (173), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 53/184 (28%), Positives = 91/184 (49%), Gaps = 22/184 (11%)

Query: 6   LPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLG--QIVKR 63
           L  + + +SGA+AG  +++   PL++VK R+Q++     G  VA N     L   QI+KR
Sbjct: 635 LGLLSEIISGASAGACQVIFTNPLEIVKIRLQVK-----GEYVAENAENAKLTALQIIKR 689

Query: 64  EGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVD--------KLTQQISILS 115
            G   LYKG ++ +L + P  A  F    +Y  + +DL+  D        +L     + +
Sbjct: 690 LGLPGLYKGAAACLLRDVPFSAIYFP---TYAHLKRDLFNFDPNDKNKRSRLNTWELLSA 746

Query: 116 GSLAGVTEACVIVPFELVKIRLQDVNSK----FNGPMEVVFKTIRETGILSLYNGLESTM 171
           G+LAG+  A +  PF+++K RLQ    K    + G +      +RE    S + G  + +
Sbjct: 747 GALAGMPAAYLTTPFDVIKTRLQIDPKKGETIYKGIIHAARTILREESFKSFFKGGAARV 806

Query: 172 WRNA 175
            R++
Sbjct: 807 LRSS 810

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 29/112 (25%), Positives = 54/112 (48%), Gaps = 8/112 (7%)

Query: 14  SGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGI 73
           +GA AG+    +  P DV+KTR+Q+    G      Y G+I     I++ E F   +KG 
Sbjct: 746 AGALAGMPAAYLTTPFDVIKTRLQIDPKKGE---TIYKGIIHAARTILREESFKSFFKGG 802

Query: 74  SSPMLMEAPKRATKFACNDSYQKMF-----KDLYGVDKLTQQISILSGSLAG 120
           ++ +L  +P+     A  + +  +F     KD + + +  ++  IL+ +  G
Sbjct: 803 AARVLRSSPQFGFTLAAYELFHNIFPLPNDKDKFVISEDDRRAKILNNNARG 854

>Kwal_47.17321
          Length = 881

 Score =  104 bits (259), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 90/306 (29%), Positives = 138/306 (45%), Gaps = 39/306 (12%)

Query: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR 68
           IY F+ G+ AG      +YP+D+VKTRMQ Q          Y   IDC  +I  REG   
Sbjct: 501 IYNFLLGSVAGCIGATAVYPIDLVKTRMQAQRNFS-----QYKNSIDCFVKIFSREGIRG 555

Query: 69  LYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIV 128
           +Y G+   ++  AP++A K   ND  +K+  D    ++LT  + I+SG+ AG  +     
Sbjct: 556 IYSGLGPQLVGVAPEKAIKLTVNDYVRKLLMD--ENNRLTLPLEIISGAAAGACQVIFTN 613

Query: 129 PFELVKIRLQDVNSKFNGPME----VVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGV 184
           P E+VKIRLQ V S++   +          ++  G+  LY GL + + R+  ++  YF  
Sbjct: 614 PLEIVKIRLQ-VRSEYADSLPKSQLTALGVVKSLGLRGLYKGLVACLMRDVPFSAIYFPT 672

Query: 185 IFQIRALL----PKAKTNTEK--TTNDLIAGTIGGY-CRYSTEHTILSVVKSRIQ----S 233
              ++  +    P+ K    +  T   L AG + G    Y T  T   V+K+R+Q     
Sbjct: 673 YAHLKRDIFNYDPQDKNKRARLHTWELLTAGGLAGMPAAYLT--TPFDVIKTRLQIDPRK 730

Query: 234 GATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMM 293
           G T          +Y     +   I  EE F + +KG   ++LR  P  G  L  +    
Sbjct: 731 GET----------RYTGILHAARTILKEERFKSFFKGGGARVLRSSPQFGFTLAAY---- 776

Query: 294 AFFQEM 299
             FQ M
Sbjct: 777 EIFQNM 782

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 41/86 (47%), Gaps = 3/86 (3%)

Query: 13  VSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKG 72
            +G  AG+    +  P DV+KTR+Q+    G      Y G++     I+K E F   +KG
Sbjct: 701 TAGGLAGMPAAYLTTPFDVIKTRLQIDPRKGE---TRYTGILHAARTILKEERFKSFFKG 757

Query: 73  ISSPMLMEAPKRATKFACNDSYQKMF 98
             + +L  +P+     A  + +Q MF
Sbjct: 758 GGARVLRSSPQFGFTLAAYEIFQNMF 783

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score =  100 bits (250), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 81/303 (26%), Positives = 134/303 (44%), Gaps = 33/303 (10%)

Query: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR 68
           I   +SG A G++++LV  P D+ K RMQ   GS T         +D +  ++K EG   
Sbjct: 24  IKDILSGTAGGIAQVLVGQPFDITKVRMQTSAGSATA--------VDVVTSLIKNEGILG 75

Query: 69  LYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYG--VDKLTQQISILSGSLAGVTEACV 126
            YKG  +P++      + +F  N++ ++ F+ + G     L+ +   + G  +G   A +
Sbjct: 76  FYKGTLAPLVGVGACVSCQFGVNEAMKRRFRRMNGDPSKPLSLKQYYVCGVASGCANAFL 135

Query: 127 IVPFELVKIRLQ-----DVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGY 181
             P E V+IRLQ       N+++ G ++ + K +++    +L  G  +T+ R     G Y
Sbjct: 136 ATPIEHVRIRLQLQTKSLANAEYQGSLDCMRKLLKQG---ALMRGFTATLMRTCHGFGIY 192

Query: 182 FG-----VIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGAT 236
           F      +  Q +  +P+      K     I G   G C ++  + I  VVKS +QS   
Sbjct: 193 FSTYEALIANQHKKGIPRKDIAPWKVC---IFGAFSGACYWAMAYPI-DVVKSIMQSDRL 248

Query: 237 TTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFF 296
            +   GT V      W     IY+  G  A  KGF+P +LR  P  G     F   M   
Sbjct: 249 VSPVHGTNV------WQVAKSIYTTRGKRAFIKGFMPAMLRSLPVNGATFATFEMTMRLL 302

Query: 297 QEM 299
           + +
Sbjct: 303 ERV 305

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 2/66 (3%)

Query: 3   EKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVK 62
            KPL     +V G A+G +   +  P++ V+ R+QLQ  S   +   Y G +DC+ +++K
Sbjct: 113 SKPLSLKQYYVCGVASGCANAFLATPIEHVRIRLQLQTKS--LANAEYQGSLDCMRKLLK 170

Query: 63  REGFSR 68
           +    R
Sbjct: 171 QGALMR 176

>Kwal_33.15446
          Length = 305

 Score = 97.1 bits (240), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 79/287 (27%), Positives = 126/287 (43%), Gaps = 26/287 (9%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71
           FVSG  +G+++  V +P D +K R+Q    +G      + G +DC+ Q ++++G    Y 
Sbjct: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGR-----FKGPLDCVYQTMRQQGIRGFYL 76

Query: 72  GISSPMLMEAPKRATKFACNDSYQKMFKD--LYGVDKLTQQISILSGSLAGVTEACVIVP 129
           G + P++      +    C  +Y+ + K       +KL     ILSG LAG + + +  P
Sbjct: 77  GFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAP 136

Query: 130 FELVKIRLQ----DVNSKFNGPMEVVFKTIRETGILSLYNGLESTM-WRNAF--WNGGYF 182
            EL K +LQ       +++ GP++V+ K     GI  +Y GL ST+ +R  F  W G Y 
Sbjct: 137 VELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFVYWWGSY- 195

Query: 183 GVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADG 242
               ++     KA TN   T  +  AG       + T      V+K  I         DG
Sbjct: 196 ----ELLTRWFKANTNLSDTAINFWAGGFSASFGFWTTAYPSDVIKQVI---LCNDKYDG 248

Query: 243 TVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVF 289
           ++    N    +   I+   G    +KGF+P  LR  P     L  F
Sbjct: 249 SLRSWRN----AASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASF 291

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 82/178 (46%), Gaps = 14/178 (7%)

Query: 105 DKLTQQISILSGSLAGVTEACVIVPFELVKIRLQDVNS--KFNGPMEVVFKTIRETGILS 162
           +  ++ +  +SG  +G+ +  V  PF+ +K+RLQ      +F GP++ V++T+R+ GI  
Sbjct: 14  EAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRG 73

Query: 163 LYNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKT---TNDLIAGTIGGYC-RYS 218
            Y G    +      +    G +   R LL K     E+    +  +++G + G+   + 
Sbjct: 74  FYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFI 133

Query: 219 TEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKIL 276
                L+  K ++Q  A TT   G +          + K+Y+ +G   +YKG +  ++
Sbjct: 134 AAPVELAKAKLQVQYDAQTTRYRGPL--------DVIKKVYAADGIRGMYKGLVSTLI 183

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 3   EKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVK 62
           E+ LP     +SG  AG S   +  P+++ K ++Q+Q  + T     Y G +D + ++  
Sbjct: 111 EEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQT---TRYRGPLDVIKKVYA 167

Query: 63  REGFSRLYKGISSPMLME 80
            +G   +YKG+ S ++  
Sbjct: 168 ADGIRGMYKGLVSTLIFR 185

>CAGL0B03883g 383602..384522 weakly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, hypothetical
           start
          Length = 306

 Score = 94.7 bits (234), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 87/298 (29%), Positives = 140/298 (46%), Gaps = 32/298 (10%)

Query: 1   MSEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQL-QVGSGTGSGVAYNGVIDCLGQ 59
           +SE+    +  FV+G  +GV++  V +P D VK R+Q  QVGSG  +G+ + G +DC+ +
Sbjct: 2   VSEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSG--AGIQFKGPLDCVYK 59

Query: 60  IVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMF-KDLY-GVDKLTQQISILSGS 117
            +K +G   LY G + P+       +       +Y+ +  K +Y   DKL     I+SG 
Sbjct: 60  TLKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGV 119

Query: 118 LAGVTEACVIVPFELVKIRLQ----DVNSKFNGPMEVVFKTIRE--------TGILSLYN 165
           +AG T + +  P EL K +LQ       +K+ GP++VV K  ++         G+ SLY 
Sbjct: 120 MAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYK 179

Query: 166 GLESTM-WRN--AFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHT 222
           GL ST+ +R+   FW G Y     ++     +  TN      +  AG +     + T   
Sbjct: 180 GLISTLIFRSNFVFWWGSY-----ELITQWFQKNTNLSAPAINFWAGGLSASFGFWTSAY 234

Query: 223 ILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGP 280
              VVK  +         DG+     +W   ++  IY + G    +KGF+P  LR  P
Sbjct: 235 PSDVVKQVV---LCNDKYDGSFK---SWR-TAVSDIYRQRGIHGFFKGFLPSFLRSFP 285

>Scas_718.5
          Length = 324

 Score = 94.0 bits (232), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 84/313 (26%), Positives = 142/313 (45%), Gaps = 38/313 (12%)

Query: 1   MSEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQI 60
           M++     +   ++G   G+S+++V  P D  K RMQ    S         G +D + ++
Sbjct: 32  MAKDSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKS--------VGALDIIRKL 83

Query: 61  VKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQIS-------- 112
           VK EG    YKG   P++      + +F  N++ ++ F++ +   + TQ           
Sbjct: 84  VKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFRE-WNTSRGTQHRDGTLQLGQY 142

Query: 113 ILSGSLAGVTEACVIVPFELVKIRLQDV-----NSKFNGPMEVVFKTIRETGILSLYNGL 167
            + G   GV  + +  P E V+IRLQ         +F GP++ + K ++E    SL  GL
Sbjct: 143 YICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGL 199

Query: 168 ESTMWRNAFWNGGYFGVIFQ--IRALLPKAKTNTEKTTNDLIA-GTIGGYCRYSTEHTIL 224
              M R     G YF + ++  I   + K K  +E  +  L + G++ G   +   +  L
Sbjct: 200 RPMMLRAGHGLGCYF-LTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYP-L 257

Query: 225 SVVKSRIQSGATTTLADGTVVPKYNWTWPSLF-KIYSEEGFTALYKGFIPKILRLGPGGG 283
            VVKS IQ   T TL +    P++  +  ++   +Y E+G +A +KGF P +LR  P  G
Sbjct: 258 DVVKSMIQ---TDTLRN----PRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNG 310

Query: 284 IMLVVFNGMMAFF 296
              V F  +M   
Sbjct: 311 ATFVTFELVMRLL 323

 Score = 28.9 bits (63), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 41/101 (40%), Gaps = 12/101 (11%)

Query: 198 NTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFK 257
           ++ +   D++AGT GG  +           K R+Q+ A +  A   +            K
Sbjct: 35  DSTRVLKDILAGTCGGISQVIVGQP-FDTTKVRMQTSAKSVGALDIIR-----------K 82

Query: 258 IYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFFQE 298
           +   EG  A YKG +  I+ +G    +   V   M  FF+E
Sbjct: 83  LVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFRE 123

>Kwal_23.4354
          Length = 343

 Score = 93.6 bits (231), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 83/339 (24%), Positives = 143/339 (42%), Gaps = 64/339 (18%)

Query: 11  QFVSGAAAGVSELLVMYPLDVVKTRMQLQ-----VGSGTGSG------------------ 47
           + +S     +   L++ P+DVV+ R+Q Q      G  T +G                  
Sbjct: 14  RLLSAVVGSLLTSLILTPMDVVRIRLQQQKMLPDCGCETDAGLTSRASSKGVFWQDICFE 73

Query: 48  --------VAYNGVIDCLGQIVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFK 99
                   V YN   D  G+I K EG   L++G+S  +LM AP     F     Y+ +  
Sbjct: 74  DVRCKTSPVRYNSTWDAFGKIAKIEGVQSLWRGLSITLLMAAPANMVYFI---GYESLRD 130

Query: 100 DLYGVDKLTQQISILSGSLAGVTEACVIVPFELVKIRLQDV--NSKFNGPMEVVFKTIRE 157
                DK      ++ G+LA V  A  + P EL + RLQ +  +S  +    ++   I+E
Sbjct: 131 KSRLQDKYPTLNPLMCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAMMIKDLIKE 190

Query: 158 T-------GILSLYNGLESTMWRNAFWNGGYFGV---------IFQIRALLPKAKTNTEK 201
           +       G  +L+ GLE T+WR+  ++  Y+G          I   ++++  + +N   
Sbjct: 191 SRYEISKVGYKALFRGLEITLWRDVPFSSIYWGCYEFYKSNVSIDSEKSIVNSSNSNWNH 250

Query: 202 TTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSE 261
             N  + G+ GG       H    V K+R+Q     T  + T+  K +    ++FK  ++
Sbjct: 251 FVNSFVGGSFGGAVAAVLTHP-FDVGKTRMQ----ITYLNSTLEKKPS---KNMFKYLNQ 302

Query: 262 ----EGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFF 296
               EG  ALY G +P+++++ P   IM+  +      F
Sbjct: 303 MRKSEGLAALYTGLVPRVIKIAPSCAIMISTYEVCKRLF 341

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 44/91 (48%)

Query: 8   FIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFS 67
           F+  FV G+  G    ++ +P DV KTRMQ+   + T        +   L Q+ K EG +
Sbjct: 251 FVNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQMRKSEGLA 310

Query: 68  RLYKGISSPMLMEAPKRATKFACNDSYQKMF 98
            LY G+   ++  AP  A   +  +  +++F
Sbjct: 311 ALYTGLVPRVIKIAPSCAIMISTYEVCKRLF 341

 Score = 36.6 bits (83), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 75/182 (41%), Gaps = 25/182 (13%)

Query: 7   PFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAY--NGVIDCLGQIVKRE 64
           P +   + GA A V     + PL++ +TR+Q    S   S  A     +I      + + 
Sbjct: 139 PTLNPLMCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAMMIKDLIKESRYEISKV 198

Query: 65  GFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQI------------S 112
           G+  L++G+   +  + P  +  + C + Y    K    +D     +            S
Sbjct: 199 GYKALFRGLEITLWRDVPFSSIYWGCYEFY----KSNVSIDSEKSIVNSSNSNWNHFVNS 254

Query: 113 ILSGSLAGVTEACVIVPFELVKIRLQD--VNSKFN-GPMEVVFKTI----RETGILSLYN 165
            + GS  G   A +  PF++ K R+Q   +NS     P + +FK +    +  G+ +LY 
Sbjct: 255 FVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQMRKSEGLAALYT 314

Query: 166 GL 167
           GL
Sbjct: 315 GL 316

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score = 91.3 bits (225), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 77/282 (27%), Positives = 123/282 (43%), Gaps = 28/282 (9%)

Query: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR 68
           I  FVSG  +G+++  V +P D +K R+Q    S       + G +DC+ +   ++G   
Sbjct: 61  IMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDS-----TRFKGPLDCVYKTFTQQGIRG 115

Query: 69  LYKGISSPMLMEAPKRATKFACNDSYQKMFKD--LYGVDKLTQQISILSGSLAGVTEACV 126
            Y G + P++      +    C  +Y+ + K    Y  +KL     I+SG +AG + + +
Sbjct: 116 FYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFI 175

Query: 127 IVPFELVKIRLQ----DVNSKFNGPMEVVFKTIRETGILSLYNGLESTM-WRN--AFWNG 179
             P EL K +LQ       +K+ GP++V+ K     G+  LY GL ST+ +R    FW G
Sbjct: 176 AAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFVFWWG 235

Query: 180 GYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTL 239
            Y     ++     K  TN   T  +  +G       + T      V+K   Q       
Sbjct: 236 SY-----ELLTRWFKEHTNMSDTAINFWSGGFSASFGFWTTAYPSDVIK---QVVLCNDK 287

Query: 240 ADGTVVPKYNWTWPSLFK-IYSEEGFTALYKGFIPKILRLGP 280
            DGT       +W    K I+   G+   +KGF+P  LR  P
Sbjct: 288 YDGTFR-----SWKLAAKDIWRTRGYRGFFKGFVPSFLRSFP 324

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 2   SEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIV 61
           +E+ LP     +SG  AG S   +  P+++ K ++Q+Q  + T     Y G +D + ++ 
Sbjct: 152 NEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKT---TKYTGPVDVIKKVY 208

Query: 62  KREGFSRLYKGISSPMLME 80
              G   LYKG++S ++  
Sbjct: 209 SSNGVRGLYKGLTSTLIFR 227

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score = 89.7 bits (221), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 81/296 (27%), Positives = 130/296 (43%), Gaps = 33/296 (11%)

Query: 11  QFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLY 70
             ++G A GVS++L+  P D  K R+Q      T         +D + ++VK EGF   Y
Sbjct: 26  DLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTT--------ALDVVKKLVKNEGFRGFY 77

Query: 71  KGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILS----GSLAGVTEACV 126
           KG  +P++      + +F  N++ ++ F    G     + + +L     G   G   + +
Sbjct: 78  KGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFL 137

Query: 127 IVPFELVKIRLQD-----VNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGY 181
             P E V+IRLQ        ++F+GP++ + K        SL  GL  TM R +   G Y
Sbjct: 138 ASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN---SLMRGLTPTMLRESHGCGVY 194

Query: 182 FGVIFQ--IRALLPKAKTNTEKTTNDL-IAGTIGGYCRYSTEHTILSVVKSRIQSGATTT 238
           F + ++  I   L K  + +E  T  L + G   G   +   +  L V+KS +Q+     
Sbjct: 195 F-LTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYP-LDVIKSVMQT----- 247

Query: 239 LADGTVVPKYNWTWPSLFK-IYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMM 293
             D  + PK       + K IYS  G ++ +KGF P +LR  P  G     F   M
Sbjct: 248 --DSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAM 301

 Score = 54.3 bits (129), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 88/183 (48%), Gaps = 12/183 (6%)

Query: 6   LPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREG 65
           L  +  ++ G A G +   +  P++ V+ R+Q Q  +GTG+   ++G +DC+ ++     
Sbjct: 118 LGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQ--TGTGAAAQFHGPLDCIKKLTAN-- 173

Query: 66  FSRLYKGISSPMLMEAPKRATKFACNDSY--QKMFKDLYGVDKLTQQISILSGSLAGVTE 123
            + L +G++  ML E+      F   ++    ++ K +   +  T ++ +  G+ +G T 
Sbjct: 174 -NSLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLF-GATSGTTL 231

Query: 124 ACVIVPFELVKIRLQD---VNSKFNGPMEVVFKTIRET-GILSLYNGLESTMWRNAFWNG 179
             +I P +++K  +Q    +  K    M  V KTI  T G+ S + G   TM R A  NG
Sbjct: 232 WLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANG 291

Query: 180 GYF 182
             F
Sbjct: 292 ATF 294

 Score = 36.6 bits (83), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 43/208 (20%), Positives = 81/208 (38%), Gaps = 24/208 (11%)

Query: 97  MFKDLYGVDKLTQQI-SILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTI 155
           +  DL G    T+    +L+G+  GV++  +  PF+  K+RLQ  +S     ++VV K +
Sbjct: 10  IIDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQ-TSSVPTTALDVVKKLV 68

Query: 156 RETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTN---------DL 206
           +  G    Y G  + +          FGV   ++        N+                
Sbjct: 69  KNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGF 128

Query: 207 IAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTA 266
             GT   +     EH     V+ R+Q+   T  A      +++     + K+ +     +
Sbjct: 129 AGGTANSFLASPIEH-----VRIRLQTQTGTGAA-----AQFHGPLDCIKKLTANN---S 175

Query: 267 LYKGFIPKILRLGPGGGIMLVVFNGMMA 294
           L +G  P +LR   G G+  + +  ++A
Sbjct: 176 LMRGLTPTMLRESHGCGVYFLTYEALIA 203

 Score = 29.6 bits (65), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 39/101 (38%), Gaps = 12/101 (11%)

Query: 198 NTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFK 257
           ++ +   DL+AGT GG  +           K R+Q+ +  T A   V            K
Sbjct: 19  DSTRVFKDLLAGTAGGVSQVLIGQP-FDTTKVRLQTSSVPTTALDVVK-----------K 66

Query: 258 IYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFFQE 298
           +   EGF   YKG +  ++ +G    +   V   M  FF  
Sbjct: 67  LVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHS 107

>Scas_489.4
          Length = 297

 Score = 88.6 bits (218), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 83/308 (26%), Positives = 141/308 (45%), Gaps = 30/308 (9%)

Query: 3   EKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVK 62
           +KP+  ++ F++GA AG  E  + YP +  KTR+QL   + T S       +  +    K
Sbjct: 5   KKPVDPLHSFIAGALAGAIEASITYPFEFAKTRLQLIDKTSTAS----RNPLVLIYNTAK 60

Query: 63  REGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVT 122
            +G   +Y G  + ++    K   +F   D+ + M +D     +L+    +++G  AG+ 
Sbjct: 61  TQGTGAIYVGCPAFIVGNTAKAGIRFLGFDTIKNMLRDPV-TGELSGPRGVVAGLGAGLL 119

Query: 123 EACVIV-PFELVKIRL----QDVNSKFN----GPMEVVFKTIRETGILSLYNGLESTMWR 173
           E+ V V PFE +K  L    Q +  K+     G +      +R+ GI+ LY G+     R
Sbjct: 120 ESVVAVTPFEAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIMGLYRGVLPVSMR 179

Query: 174 NAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAG---TIGGYCRYSTEHTILSV--VK 228
            A       G   +I+ ++ +  TN  K    L +G    +G +    T +T + +  VK
Sbjct: 180 QAANQAVRLGCYNKIKTMV-QDYTNAPK-DRPLSSGLTFIVGAFSGVVTVYTTMPIDTVK 237

Query: 229 SRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVV 288
           +R+QS       D T   KY  T     KI+ EEG    +KG  P++ RL   GGI+  +
Sbjct: 238 TRMQS------LDAT---KYTSTVNCFAKIFKEEGLKTFWKGATPRLGRLILSGGIVFTI 288

Query: 289 FNGMMAFF 296
           +  ++ F 
Sbjct: 289 YENVLVFL 296

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score = 88.6 bits (218), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 82/311 (26%), Positives = 132/311 (42%), Gaps = 45/311 (14%)

Query: 5   PLPF---IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIV 61
           P P+   +    +G   GV+++LV  P D  K R+Q        +     GVI+ +  ++
Sbjct: 20  PTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQ--------TSKTKIGVIEVVQNLL 71

Query: 62  KREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISI-------- 113
           + EG    YKG+ +P+L      + +F  N+S ++ F   Y  D++  Q  +        
Sbjct: 72  RNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAA-YNADRVDPQKHVPLPLHQYY 130

Query: 114 LSGSLAGVTEACVIVPFELVKIRLQDVNSK-----FNGPMEVVFKTIRETGILSLYNGLE 168
           L G   GV  + +  P E V+IRLQ   S+     F GP + + K  +     +L  GL 
Sbjct: 131 LCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK---ALMRGLL 187

Query: 169 STMWRNAFWNGGYFG-----VIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTI 223
            TM R     G YF      V+ +     P+ +    K  +    G + G   + T + +
Sbjct: 188 PTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCS---FGALSGTILWLTVYPV 244

Query: 224 LSVVKSRIQSGATTTLADGTVVPKY-NWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGG 282
             VVKS +Q+       D    PKY N    +   +Y + G  A +KGF+P ++R  P  
Sbjct: 245 -DVVKSVLQT-------DSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPAN 296

Query: 283 GIMLVVFNGMM 293
               V F   M
Sbjct: 297 AATFVSFEMTM 307

>Scas_667.22
          Length = 306

 Score = 87.8 bits (216), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 81/297 (27%), Positives = 133/297 (44%), Gaps = 32/297 (10%)

Query: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR 68
           I   ++G A G++++LV  P D  K R+Q      T         ++ + +++K EG   
Sbjct: 26  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTT--------AMEVIRKLLKNEGPKG 77

Query: 69  LYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISI----LSGSLAGVTEA 124
            YKG  +P++      + +F  N++ ++ F      D  +Q +S+    + G   G+T +
Sbjct: 78  FYKGTLTPLIGVGACVSLQFGVNEAMKRFFHS-RNPDSTSQILSLPQYYICGLTGGITNS 136

Query: 125 CVIVPFELVKIRLQD-----VNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNG 179
            +  P E V+IRLQ       N +F GP++ + K   + G +    GL  TM R     G
Sbjct: 137 FLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFM---RGLTPTMLREGHGCG 193

Query: 180 GYFGVIFQIRA-LLPKAKTNTEKTTNDL-IAGTIGGYCRYSTEHTILSVVKSRIQSGATT 237
            YF V   + A  + K    TE     L + G + G   +   +  L V+KS +Q+    
Sbjct: 194 TYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYP-LDVIKSVMQT---- 248

Query: 238 TLADGTVVPKYNWTWPSLFK-IYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMM 293
              D    PKY  +  S+ K +Y++ G  A +KGF P +LR  P  G     F   M
Sbjct: 249 ---DNLKSPKYGNSISSVAKTLYAKGGLGAFFKGFGPTMLRAAPANGATFATFELAM 302

 Score = 29.6 bits (65), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 41/110 (37%), Gaps = 12/110 (10%)

Query: 188 IRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPK 247
           I  L    K +  +   DL+AGT GG  +           K R+Q+ +T T A   +   
Sbjct: 11  IDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQP-FDTTKVRLQTSSTPTTAMEVIR-- 67

Query: 248 YNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFFQ 297
                    K+   EG    YKG +  ++ +G    +   V   M  FF 
Sbjct: 68  ---------KLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFH 108

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score = 87.0 bits (214), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 78/282 (27%), Positives = 125/282 (44%), Gaps = 28/282 (9%)

Query: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR 68
           I  FV+G  +GV++  V +P D +K R+Q      + +   + G +DC+ +  + +G   
Sbjct: 24  IMGFVAGVFSGVAKNAVGHPFDTIKVRLQT-----SQNETRFKGPLDCVYKTFRNQGIRG 78

Query: 69  LYKGISSPMLMEAPKRATKFACNDSYQK-MFKDLYGVD-KLTQQISILSGSLAGVTEACV 126
            Y G + P++      +    C  +Y+  M K +Y  D KL     I+SG LAG + + +
Sbjct: 79  FYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFI 138

Query: 127 IVPFELVKIRLQ----DVNSKFNGPMEVVFKTIRETGILSLYNGLESTM-WRNAF--WNG 179
             P EL K +LQ       +++ GP++V+ K     GI  LY GL ST+ +R  F  W G
Sbjct: 139 APPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFVYWWG 198

Query: 180 GYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTL 239
            Y     ++     +  T   +   +  AG       + T      VVK   Q       
Sbjct: 199 SY-----ELLTRWFRENTKMSEAAINFWAGGFSASFGFWTTAYPSDVVK---QVVLCNDK 250

Query: 240 ADGTVVPKYNWTWPSLFK-IYSEEGFTALYKGFIPKILRLGP 280
            DG+       +W +  K IY  +G    +KGF+P  LR  P
Sbjct: 251 YDGSFK-----SWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 40/79 (50%), Gaps = 3/79 (3%)

Query: 2   SEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIV 61
           +++ LP     +SG  AG S   +  P+++ K ++Q+Q    T     Y G +D + +I 
Sbjct: 115 NDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTT---TRYKGPLDVIKKIY 171

Query: 62  KREGFSRLYKGISSPMLME 80
             +G   LYKG+ S ++  
Sbjct: 172 SAQGIRGLYKGLISTLIFR 190

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score = 85.1 bits (209), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 82/297 (27%), Positives = 132/297 (44%), Gaps = 40/297 (13%)

Query: 14  SGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGI 73
           SG   GV+++LV  P D++K R+Q   G+ T    A+  + D    +VK EGF   YKG 
Sbjct: 30  SGTVGGVAQVLVGQPFDIIKVRLQTMPGNAT----AWEAITD----LVKYEGFMGFYKGT 81

Query: 74  SSPMLMEAPKRATKFACNDSYQKMFKDL---YGV--DKLTQQISILSGSLAGVTEACVIV 128
            +P++      + +F  N++ ++ F+DL    G+  + L+       G ++G   A +  
Sbjct: 82  MAPLVGVGACVSCQFGINEAMKRYFRDLNRSRGIYDNTLSLGQYYTCGFVSGSANALLAT 141

Query: 129 PFELVKIRLQ-----DVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFG 183
           P E V+IRLQ       N+++   ++   K +++    SL  G  +T+ R +      FG
Sbjct: 142 PIEHVRIRLQLQKEALANAEYKSTLDCTEKLLKQG---SLMRGFTATLMRTSHG----FG 194

Query: 184 VIFQIRALLPKAKTNTEKTTNDLIA------GTIGGYCRYSTEHTILSVVKSRIQSGATT 237
           + F     L  ++        D+ A      G + G   ++  +    VVKS +Q     
Sbjct: 195 IYFLTYETLIASQLAHGFRREDISAWKACMFGALSGAFFWAMTYP-FDVVKSVMQ----- 248

Query: 238 TLADGTVVPKYNWTWPSLFK-IYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMM 293
             AD  V P Y      + K IY E G  A  KGF+P +LR  P  G     F   M
Sbjct: 249 --ADKLVNPAYGTNVVQVAKNIYRERGLRAFTKGFMPTMLRSLPVNGATFAAFEVTM 303

 Score = 40.8 bits (94), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 78/177 (44%), Gaps = 10/177 (5%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71
           +  G  +G +  L+  P++ V+ R+QLQ      +   Y   +DC  +++K+     L +
Sbjct: 126 YTCGFVSGSANALLATPIEHVRIRLQLQ--KEALANAEYKSTLDCTEKLLKQ---GSLMR 180

Query: 72  GISSPMLMEAPKRATKFACNDSY-QKMFKDLYGVDKLTQQISILSGSLAGVTEACVIVPF 130
           G ++ ++  +      F   ++         +  + ++   + + G+L+G     +  PF
Sbjct: 181 GFTATLMRTSHGFGIYFLTYETLIASQLAHGFRREDISAWKACMFGALSGAFFWAMTYPF 240

Query: 131 ELVKIRLQD---VNSKFNGPMEVVFKTI-RETGILSLYNGLESTMWRNAFWNGGYFG 183
           ++VK  +Q    VN  +   +  V K I RE G+ +   G   TM R+   NG  F 
Sbjct: 241 DVVKSVMQADKLVNPAYGTNVVQVAKNIYRERGLRAFTKGFMPTMLRSLPVNGATFA 297

 Score = 35.0 bits (79), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 3/67 (4%)

Query: 100 DLYGVDKLTQQISILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETG 159
           DL+G  K  +   + SG++ GV +  V  PF+++K+RLQ +        E +   ++  G
Sbjct: 17  DLHGFRKTLK--DVFSGTVGGVAQVLVGQPFDIIKVRLQTMPGNATA-WEAITDLVKYEG 73

Query: 160 ILSLYNG 166
            +  Y G
Sbjct: 74  FMGFYKG 80

 Score = 32.7 bits (73), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 21/100 (21%), Positives = 42/100 (42%), Gaps = 12/100 (12%)

Query: 200 EKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIY 259
            KT  D+ +GT+GG  +         ++K R+Q+           +P     W ++  + 
Sbjct: 22  RKTLKDVFSGTVGGVAQVLVGQP-FDIIKVRLQT-----------MPGNATAWEAITDLV 69

Query: 260 SEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFFQEM 299
             EGF   YKG +  ++ +G        +   M  +F+++
Sbjct: 70  KYEGFMGFYKGTMAPLVGVGACVSCQFGINEAMKRYFRDL 109

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score = 84.3 bits (207), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 78/286 (27%), Positives = 123/286 (43%), Gaps = 31/286 (10%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71
           FV+G  A    + V  P D VKTRMQLQ      +   Y   I   G I K EG + L K
Sbjct: 24  FVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNPIQAFGVIFKNEGIAGLQK 83

Query: 72  GISSPMLMEAPKRATKFACNDSYQKMFKDLY--GVDKLTQQ---ISILSGSLAGVTEACV 126
           G++S  L +     ++    +  + +  +++   V+    Q   I++ +G+ +GV  A +
Sbjct: 84  GLASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHKVQHIGINVAAGATSGVVGAFI 143

Query: 127 IVPFELVKIRLQDVN------------SKFNGPMEVVFKTIRETGILSLYNGLESTMWRN 174
             P  LVK R+Q  +            S FNG +  +F   R  GI  L+ G+++ M R 
Sbjct: 144 GSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNG-LATIF---RSEGIKGLFRGVDAAMLRT 199

Query: 175 AFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSG 234
              +     +    +  L K     + T   L++ TI G+           VV +R+ + 
Sbjct: 200 GIGSAVQLPIYNICKNFLLKHDLMNDGTGLHLLSSTIAGF-GVGVAMNPWDVVLTRVYN- 257

Query: 235 ATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGP 280
                  G +   Y+       K    EG +ALYKGF  +ILR+GP
Sbjct: 258 -----QKGNL---YSGPIDCFIKTVRNEGLSALYKGFGAQILRIGP 295

 Score = 49.7 bits (117), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 48/203 (23%), Positives = 81/203 (39%), Gaps = 24/203 (11%)

Query: 105 DKLTQQISILSGSLAGVTEACVIVPFELVKIRLQ-------DVNSKFNGPMEVVFKTIRE 157
            K+++  S ++G LA      V  PF+ VK R+Q       +    +  P++      + 
Sbjct: 16  HKVSKFGSFVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNPIQAFGVIFKN 75

Query: 158 TGILSLYNGLESTMWRNAFWNGGYFGVIFQIRALL-----PKAKTNTEKTTNDLIA---- 208
            GI  L  GL S        NG   G    IR +L     P  +++  +     +A    
Sbjct: 76  EGIAGLQKGLASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHKVQHIGINVAAGAT 135

Query: 209 -GTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTAL 267
            G +G +       + L +VK+R+QS +            Y   +  L  I+  EG   L
Sbjct: 136 SGVVGAFIG-----SPLFLVKTRMQSYSNAIHIGQQT--HYTSAFNGLATIFRSEGIKGL 188

Query: 268 YKGFIPKILRLGPGGGIMLVVFN 290
           ++G    +LR G G  + L ++N
Sbjct: 189 FRGVDAAMLRTGIGSAVQLPIYN 211

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 84.7 bits (208), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 73/271 (26%), Positives = 119/271 (43%), Gaps = 31/271 (11%)

Query: 45  GSGVAYNGVIDCLGQIVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGV 104
            S + +N   +   +I + EG + L++G+S  +LM  P     F    S  +MF+D   +
Sbjct: 92  NSALRFNSTWEAFTKISEVEGLATLWRGLSITLLMAIPANVVYF----SGYEMFRDHSPM 147

Query: 105 -DKLTQQISILSGSLAGVTEACVIVPFELVKIRLQDV-NSKFNGPMEVVFKT-------- 154
            D       +  G+ A +  A  + P EL+K RLQ +  S+ +   +++FK         
Sbjct: 148 RDSYPSLNPLFCGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRNE 207

Query: 155 IRETGILSLYNGLESTMWRN----AFWNGGY------FGVIFQIRALLPKAKTNTEKTTN 204
           IR  G   L+ GLE T+WR+    A + G Y      F + F  + L      N +   N
Sbjct: 208 IRSGGYKVLFKGLEITLWRDVPFSAIYWGSYEFYKKNFWIDFSEQCLRWNLSPNWDFFIN 267

Query: 205 DLIAGTIGGYCRYSTEHTILSVVKSRIQ--SGATTTLADGTVVPKYNWTWPSLFK----I 258
             I G++ G       H    V K+R+Q          +  V PK   +   +FK    I
Sbjct: 268 SFIGGSVSGSSAALLTHP-FDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYNI 326

Query: 259 YSEEGFTALYKGFIPKILRLGPGGGIMLVVF 289
              EG+ ALY G IP+++++ P   IM+  +
Sbjct: 327 KQTEGYGALYTGLIPRVMKIAPSCAIMISTY 357

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 47/100 (47%), Gaps = 9/100 (9%)

Query: 8   FIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVG---------SGTGSGVAYNGVIDCLG 58
           FI  F+ G+ +G S  L+ +P DV KTRMQ+ +                V+  G+   L 
Sbjct: 265 FINSFIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLY 324

Query: 59  QIVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMF 98
            I + EG+  LY G+   ++  AP  A   +  +  +++F
Sbjct: 325 NIKQTEGYGALYTGLIPRVMKIAPSCAIMISTYELSKRLF 364

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 38/174 (21%), Positives = 76/174 (43%), Gaps = 15/174 (8%)

Query: 7   PFIYQFVSGAAAGVSELLVMYPLDVVKTRMQL--QVGSGTGSGVAYNGVIDCLGQIVKRE 64
           P +     GA A +     + PL+++KTR+Q   +    T + + +  ++      ++  
Sbjct: 152 PSLNPLFCGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRNEIRSG 211

Query: 65  GFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQI---------SILS 115
           G+  L+KG+   +  + P  A  +   + Y+K F   +    L   +         S + 
Sbjct: 212 GYKVLFKGLEITLWRDVPFSAIYWGSYEFYKKNFWIDFSEQCLRWNLSPNWDFFINSFIG 271

Query: 116 GSLAGVTEACVIVPFELVKIRLQ---DVNSKFNGPMEVVFKTIRETGILS-LYN 165
           GS++G + A +  PF++ K R+Q   D+ +K    +    K +   G+   LYN
Sbjct: 272 GSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYN 325

>Kwal_55.21335
          Length = 317

 Score = 84.0 bits (206), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 67/284 (23%), Positives = 121/284 (42%), Gaps = 27/284 (9%)

Query: 15  GAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR-LYKGI 73
           G+ AG +  ++ YPLD +K R+Q Q          +     C+    ++EGF +  Y+G+
Sbjct: 52  GSIAGAAGKVIEYPLDTIKVRLQTQPAH------VFPTSWSCIKYTYQKEGFVKGFYQGV 105

Query: 74  SSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIVPFELV 133
           +SP++  A + A  F   +  Q   +    V  L+Q  ++LSG+ AG   + V+ P EL+
Sbjct: 106 ASPLVGAALENAVLFVTFNRAQNFLQQYESVSPLSQ--TVLSGAFAGACTSYVLTPVELI 163

Query: 134 KIRLQDVN-----SKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVIFQI 188
           K  LQ  N     ++ +     V   ++  GI  L+ G  ST  R       +F     +
Sbjct: 164 KCTLQVSNLEGATTRHSKIWPTVKHIVQHKGIGGLWQGQSSTFIRECAGGAVWFTTYESL 223

Query: 189 RALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKY 248
           ++ L + + +TE  T +L+A        ++        +KS  Q+     + D T     
Sbjct: 224 KSYLARRRNDTENHTWELLASGASAGVAFNASIFPADTIKSTAQT-QHLGIVDATK---- 278

Query: 249 NWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGM 292
                   +I +  G   LY+G    ++R  P   I+   +  +
Sbjct: 279 --------RILARSGPAGLYRGLGITLIRAAPANAIVFYTYETL 314

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/190 (21%), Positives = 80/190 (42%), Gaps = 17/190 (8%)

Query: 113 ILSGSLAGVTEACVIVPFELVKIRLQDVNSK-FNGPMEVVFKTIRETGILS-LYNGLEST 170
           IL GS+AG     +  P + +K+RLQ   +  F      +  T ++ G +   Y G+ S 
Sbjct: 49  ILYGSIAGAAGKVIEYPLDTIKVRLQTQPAHVFPTSWSCIKYTYQKEGFVKGFYQGVASP 108

Query: 171 MWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSR 230
           +   A  N   F    + +  L + ++     +  +++G   G C  S   T + ++K  
Sbjct: 109 LVGAALENAVLFVTFNRAQNFLQQYES-VSPLSQTVLSGAFAGACT-SYVLTPVELIKCT 166

Query: 231 IQ----SGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIML 286
           +Q     GATT         +++  WP++  I   +G   L++G     +R   GG +  
Sbjct: 167 LQVSNLEGATT---------RHSKIWPTVKHIVQHKGIGGLWQGQSSTFIRECAGGAVWF 217

Query: 287 VVFNGMMAFF 296
             +  + ++ 
Sbjct: 218 TTYESLKSYL 227

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 10/77 (12%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71
             SGA+AGV+    ++P D +K+  Q Q          + G++D   +I+ R G + LY+
Sbjct: 242 LASGASAGVAFNASIFPADTIKSTAQTQ----------HLGIVDATKRILARSGPAGLYR 291

Query: 72  GISSPMLMEAPKRATKF 88
           G+   ++  AP  A  F
Sbjct: 292 GLGITLIRAAPANAIVF 308

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 83.6 bits (205), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 80/284 (28%), Positives = 127/284 (44%), Gaps = 17/284 (5%)

Query: 7   PFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVK---R 63
           P +YQ  +GA AG+ E  +M+P+D +KTRM  Q  S TGS  A     + L QI K    
Sbjct: 16  PLVYQLAAGAFAGIMEHSIMFPIDAIKTRM--QAVSTTGSSAATRLPSNMLAQIAKISTT 73

Query: 64  EGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQI--SILSGSLAGV 121
           EG   L+KG+ S +L   P  A  FA  +  +    D    D+ T Q   + LSG+LA V
Sbjct: 74  EGSLALWKGVQSVVLGAGPAHAVYFATYEMCKSRLID--PEDRQTHQPLKTALSGTLATV 131

Query: 122 TEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGY 181
               ++ PF+ +K RLQ   S  +   +   +  +  GI + +    +T+  N  +    
Sbjct: 132 AADALMNPFDTIKQRLQLHPS--DSMTKCAVRMYQREGIAAFFYSYPTTIAMNIPFAALN 189

Query: 182 FGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQ-SGATTTLA 240
           F VI++    +     N     + L  G  G  C   T  T L  VK+ +Q  GA +   
Sbjct: 190 F-VIYESSTKIFNPSNNYNPWIHCLCGGISGATCAAIT--TPLDCVKTVLQIRGADSV-- 244

Query: 241 DGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGI 284
              +  + +    +   I+   G++  ++G  P+I+   P   I
Sbjct: 245 QSQLFKEADTFRKAASAIHKTYGWSGFFRGLKPRIISNMPATAI 288

 Score = 32.7 bits (73), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 40/87 (45%), Gaps = 9/87 (10%)

Query: 206 LIAGTIGGYCRYSTEHTIL---SVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEE 262
           L AG   G      EH+I+     +K+R+Q+ +TT  +  T +P        + KI + E
Sbjct: 21  LAAGAFAGI----MEHSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLA--QIAKISTTE 74

Query: 263 GFTALYKGFIPKILRLGPGGGIMLVVF 289
           G  AL+KG    +L  GP   +    +
Sbjct: 75  GSLALWKGVQSVVLGAGPAHAVYFATY 101

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score = 82.4 bits (202), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 84/303 (27%), Positives = 132/303 (43%), Gaps = 34/303 (11%)

Query: 11  QFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLY 70
            FV+GA AG  E  + YP +  KTR+QL   S   S  + N ++  +    K +G   +Y
Sbjct: 13  SFVAGALAGAVEASITYPFEFAKTRLQLIDKS---SKASRNPLV-LIYNTAKTQGVGAIY 68

Query: 71  KGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIV-P 129
            G  + ++    K AT+F   D+ + + KD     +L+    +L+G  AG+ E+ V V P
Sbjct: 69  VGCPAFIVGNTAKAATRFLGYDTIRNLLKD-KKTGELSGPRGVLAGLGAGLLESVVAVTP 127

Query: 130 FELVKIRL----QDVNSKFNGPMEVVFKT----IRETGILSLYNGLESTMWRNAFWNGGY 181
           FE +K  L    Q V  K+      + +     +++ G   LY G+     R A      
Sbjct: 128 FEAIKTVLIDDKQSVRPKYQNNGRSMARNYISLVKDEGFRGLYGGVLPVSMRQAANQAVR 187

Query: 182 FGVIFQIRALL------PKAKTNTEKTTNDLIAGTIGGYCR-YSTEHTILSVVKSRIQSG 234
            G   +I+ L+      PK K  T   T   I G   G    Y+T    +  VK+R+QS 
Sbjct: 188 LGCYNKIKVLVQDYTGAPKDKPLTSGLT--FIVGAFSGVVTVYATMP--IDTVKTRMQS- 242

Query: 235 ATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMA 294
                       KY+ T      IY EEG    +KG  P++ RL   GGI+  ++  ++ 
Sbjct: 243 --------LTASKYSSTLNCFTTIYKEEGLKTFWKGATPRLGRLILSGGIVFTIYENVLL 294

Query: 295 FFQ 297
           +  
Sbjct: 295 YLS 297

 Score = 63.5 bits (153), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 60/211 (28%), Positives = 89/211 (42%), Gaps = 20/211 (9%)

Query: 97  MFKDLYGVDKLTQQISILSGSLAGVTEACVIVPFELVKIRLQ--DVNSKFN-GPMEVVFK 153
           M KD   VD      S ++G+LAG  EA +  PFE  K RLQ  D +SK +  P+ +++ 
Sbjct: 1   MSKDSKKVDPTK---SFVAGALAGAVEASITYPFEFAKTRLQLIDKSSKASRNPLVLIYN 57

Query: 154 TIRETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGG 213
           T +  G+ ++Y G  + +  N       F     IR LL   KT        ++AG   G
Sbjct: 58  TAKTQGVGAIYVGCPAFIVGNTAKAATRFLGYDTIRNLLKDKKTGELSGPRGVLAGLGAG 117

Query: 214 YCRYSTEHTILSVVKSRIQSGATTTLADG--TVVPKYNWTWPSLFKIY----SEEGFTAL 267
                   T    +K        T L D   +V PKY     S+ + Y     +EGF  L
Sbjct: 118 LLESVVAVTPFEAIK--------TVLIDDKQSVRPKYQNNGRSMARNYISLVKDEGFRGL 169

Query: 268 YKGFIPKILRLGPGGGIMLVVFNGMMAFFQE 298
           Y G +P  +R      + L  +N +    Q+
Sbjct: 170 YGGVLPVSMRQAANQAVRLGCYNKIKVLVQD 200

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 38/76 (50%), Gaps = 7/76 (9%)

Query: 3   EKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVK 62
           +KPL     F+ GA +GV  +    P+D VKTRMQ    S       Y+  ++C   I K
Sbjct: 207 DKPLTSGLTFIVGAFSGVVTVYATMPIDTVKTRMQSLTAS------KYSSTLNCFTTIYK 260

Query: 63  REGFSRLYKGISSPML 78
            EG    +KG ++P L
Sbjct: 261 EEGLKTFWKG-ATPRL 275

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score = 81.6 bits (200), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 72/299 (24%), Positives = 124/299 (41%), Gaps = 28/299 (9%)

Query: 1   MSEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQI 60
           MSE         + G  AG    LV YP D VK R+Q Q      S   +     C+   
Sbjct: 1   MSEDADKAYKDLLYGGVAGSLGKLVEYPFDTVKVRLQTQ------SAALFPTTWSCVSHT 54

Query: 61  VKREGFSR-LYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLA 119
            K+EG  R  Y+G++SP+     + A  F   +  Q + ++ Y    L +   + +G++A
Sbjct: 55  YKQEGLWRGFYQGMASPVFGAFLEHAVLFVSFNRAQAVLENCYSCGPLEK--VVFAGAIA 112

Query: 120 GVTEACVIVPFELVKIRLQDVN------SKFNGPMEVVFKTIRETGILSLYNGLESTMWR 173
           G   + V+ P ELVK +LQ  N       ++   +  +   +++ G+  L+ G   T  R
Sbjct: 113 GACTSYVLTPVELVKCKLQVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLWQGQSGTFIR 172

Query: 174 NAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQS 233
            +     +F     ++  L + + +TE T  +L+A   G    +         VKS +Q 
Sbjct: 173 ESAGGAVWFTAYEVLKGWLARRRGSTENTVWELLASGAGAGAAFHASIFPADTVKSTMQ- 231

Query: 234 GATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGM 292
             T  L  G          P++  +  + G T  Y+G    +LR  P   ++  V+  +
Sbjct: 232 --TEHLGLG----------PAVRTVLKKHGPTGFYRGVGITLLRALPANAVIFYVYESL 278

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score = 80.5 bits (197), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 78/307 (25%), Positives = 132/307 (42%), Gaps = 41/307 (13%)

Query: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR 68
           I   +SG + G++++LV  P D+ K RMQ   GS T         I+ +  +VK EG   
Sbjct: 24  IKDIISGTSGGIAQVLVGQPFDITKVRMQTSSGSPTA--------IEVIKNLVKNEGLLA 75

Query: 69  LYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILS----GSLAGVTEA 124
            YKG   P++      + +F  N++ ++ F  + G     Q +S+L     G ++G   A
Sbjct: 76  FYKGTLVPLIGVGACVSCQFGVNEAMKRYFLRVNGYKD--QHLSLLQYYTCGFVSGSANA 133

Query: 125 CVIVPFELVKIRLQ-----DVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNG 179
            +  P E V+IRLQ        +++ G ++ + K +++    +L  G  +T+ R +    
Sbjct: 134 FLATPIEHVRIRLQLQTKALAKAEYRGSLDCMKKLLKQK---ALMRGFTATLMRTSHG-- 188

Query: 180 GYFGVIFQIRALLPKAKTNTEKTTNDL------IAGTIGGYCRYSTEHTILSVVKSRIQS 233
             FGV F     L   +        D+      + G   G   ++  +    VVKS +Q 
Sbjct: 189 --FGVYFLTYEALIMNQNKNGVLRKDIPPWKVCVFGAFSGAFFWAMTYP-FDVVKSIMQ- 244

Query: 234 GATTTLADGTVVPKYNWTWPSLFK-IYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGM 292
                 AD  V P +      + K I++  G+ A  KGF+P +LR  P  G     F   
Sbjct: 245 ------ADRLVSPVHGKNVFQVAKSIHATRGWGAFVKGFVPTMLRSLPVNGATFATFEVT 298

Query: 293 MAFFQEM 299
           M   + +
Sbjct: 299 MRLLESL 305

 Score = 34.7 bits (78), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 40/191 (20%), Positives = 83/191 (43%), Gaps = 20/191 (10%)

Query: 3   EKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVK 62
           ++ L  +  +  G  +G +   +  P++ V+ R+QLQ  +   +   Y G +DC+ +++K
Sbjct: 113 DQHLSLLQYYTCGFVSGSANAFLATPIEHVRIRLQLQ--TKALAKAEYRGSLDCMKKLLK 170

Query: 63  REGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQIS----ILSGSL 118
           ++    L +G ++ ++  +      F    +Y+ +  +      L + I      + G+ 
Sbjct: 171 QKA---LMRGFTATLMRTSHGFGVYFL---TYEALIMNQNKNGVLRKDIPPWKVCVFGAF 224

Query: 119 AGVTEACVIVPFELVKIRLQDVNSKFNGPME-----VVFKTIRET-GILSLYNGLESTMW 172
           +G     +  PF++VK  +Q    +   P+       V K+I  T G  +   G   TM 
Sbjct: 225 SGAFFWAMTYPFDVVKSIMQ--ADRLVSPVHGKNVFQVAKSIHATRGWGAFVKGFVPTML 282

Query: 173 RNAFWNGGYFG 183
           R+   NG  F 
Sbjct: 283 RSLPVNGATFA 293

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 80.5 bits (197), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 76/299 (25%), Positives = 128/299 (42%), Gaps = 35/299 (11%)

Query: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR 68
           +   ++G A G++++LV  P D  K R+Q      T         ++ + +++  EG   
Sbjct: 26  VKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTT--------AMEVVRKLLANEGPRG 77

Query: 69  LYKGISSPMLMEAPKRATKFACNDSYQKMFK----DLYGVDKLTQQISILSGSLAGVTEA 124
            YKG  +P++      + +F  N++ ++ F     D+     L Q  +   G   G+  +
Sbjct: 78  FYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYAC--GVTGGIVNS 135

Query: 125 CVIVPFELVKIRLQD-----VNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNG 179
            +  P E V+IRLQ       N++F GP+E + K +R     +L  GL  T+ R     G
Sbjct: 136 FLASPIEHVRIRLQTQTGSGTNAEFKGPLECI-KKLRHNK--ALLRGLTPTILREGHGCG 192

Query: 180 GYFGVIFQIRALLPKAKTNTEKTT----NDLIAGTIGGYCRYSTEHTILSVVKSRIQSGA 235
            YF V   + A     +   E+         I G + G   +   +  L V+KS +Q+  
Sbjct: 193 TYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYP-LDVIKSVMQT-- 249

Query: 236 TTTLADGTVVPKYNWTWPSLFK-IYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMM 293
                D    PK+  +  S+ K +Y+  G  A +KGF P +LR  P  G     F   M
Sbjct: 250 -----DNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFELAM 303

 Score = 35.0 bits (79), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 38/89 (42%), Gaps = 3/89 (3%)

Query: 1   MSEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQI 60
           +  K +P     + GA +G +  L++YPLDV+K+ MQ         G + + V   L   
Sbjct: 212 LERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTL--- 268

Query: 61  VKREGFSRLYKGISSPMLMEAPKRATKFA 89
               G    +KG    ML  AP     FA
Sbjct: 269 YANGGIGAFFKGFGPTMLRAAPANGATFA 297

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 42/111 (37%), Gaps = 12/111 (10%)

Query: 188 IRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPK 247
           I  L    + +  +   DL+AGT GG  +           K R+Q+ +T T A   V   
Sbjct: 11  IDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQP-FDTTKVRLQTSSTPTTAMEVVR-- 67

Query: 248 YNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFFQE 298
                    K+ + EG    YKG +  ++ +G    +   V   M  FF  
Sbjct: 68  ---------KLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHH 109

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 79.7 bits (195), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 74/282 (26%), Positives = 123/282 (43%), Gaps = 24/282 (8%)

Query: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVI--DCLGQIVKREGF 66
           + + +  A+AG+ E+ V +P+D +  R+ +   +   SG   N VI  D   + + +  F
Sbjct: 11  LARLLGSASAGIMEIAVFHPVDTISKRL-MSNHTKITSGQELNRVIFRDHFSEPLGKRLF 69

Query: 67  SRLYKGISSPMLMEAPKRATKFA--------CNDSYQKMFKDLYGVDKLTQQISILSGSL 118
           + L+ G+      +  +R  K+          N  Y+K F +L+G        S  +GSL
Sbjct: 70  T-LFPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDNLFGEKTGKAMRSAAAGSL 128

Query: 119 AGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWN 178
            G+ E  V++P +++KI+ Q     F G      K +R+ G+ +LY G   T  RNA  +
Sbjct: 129 IGIGE-IVLLPLDVLKIKRQTNPESFKG--RGFIKILRDEGLFNLYRGWGWTAARNAPGS 185

Query: 179 GGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTT 238
              FG     +  +   K  ++ T +     +I G C        L V+K+RIQ+     
Sbjct: 186 FALFGGNAFAKEYILGLKDYSQATWSQNFISSIVGACSSLIVSAPLDVIKTRIQNRNFDN 245

Query: 239 LADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGP 280
              G  + K              EG TA +KG  PK+L  GP
Sbjct: 246 PESGLRIVK---------NTLKNEGVTAFFKGLTPKLLTTGP 278

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 42/91 (46%), Gaps = 6/91 (6%)

Query: 11  QFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLY 70
            F+S      S L+V  PLDV+KTR+Q +      SG      +  +   +K EG +  +
Sbjct: 213 NFISSIVGACSSLIVSAPLDVIKTRIQNRNFDNPESG------LRIVKNTLKNEGVTAFF 266

Query: 71  KGISSPMLMEAPKRATKFACNDSYQKMFKDL 101
           KG++  +L   PK    FA   S    F +L
Sbjct: 267 KGLTPKLLTTGPKLVFSFALAQSLIPRFDNL 297

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score = 79.7 bits (195), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 77/301 (25%), Positives = 133/301 (44%), Gaps = 34/301 (11%)

Query: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR 68
           ++ F++G+ AG +E  + YP +  KTR+QL       S  + N ++  + +  K +G   
Sbjct: 13  LHSFLAGSLAGAAEACITYPFEFAKTRLQLI---DKASKASRNPLV-LIYKTAKTQGIGS 68

Query: 69  LYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEA-CVI 127
           +Y G  + ++    K   +F   D+ + M +D     +L+    +++G  AG+ E+   +
Sbjct: 69  IYVGCPAFIIGNTAKAGIRFLGFDTIKDMLRD-SETGELSGTRGVIAGLGAGLLESVAAV 127

Query: 128 VPFELVKIRL----QDVNSKFNGPMEVVFKT----IRETGILSLYNGLESTMWRNAFWNG 179
            PFE +K  L    Q    K++     V +     +R+ G   LY G+     R A    
Sbjct: 128 TPFEAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSGLYRGVLPVSMRQAANQA 187

Query: 180 GYFGVIFQIRALL------PKAKTNTEKTTNDLIAGTIGGYCR-YSTEHTILSVVKSRIQ 232
              G   +I+ L+      PK K  +   T   + G   G    YST    L  VK+R+Q
Sbjct: 188 VRLGCYNKIKTLIQDYTDSPKDKPLSSGLT--FLVGAFSGIVTVYSTMP--LDTVKTRMQ 243

Query: 233 SGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGM 292
           S  +T         KY+ T      I+ EEG    +KG  P++ RL   GGI+  ++  +
Sbjct: 244 SLDST---------KYSSTMNCFATIFKEEGLKTFWKGATPRLGRLVLSGGIVFTIYEKV 294

Query: 293 M 293
           +
Sbjct: 295 L 295

 Score = 75.9 bits (185), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 90/196 (45%), Gaps = 17/196 (8%)

Query: 112 SILSGSLAGVTEACVIVPFELVKIRLQ--DVNSKFN-GPMEVVFKTIRETGILSLYNGLE 168
           S L+GSLAG  EAC+  PFE  K RLQ  D  SK +  P+ +++KT +  GI S+Y G  
Sbjct: 15  SFLAGSLAGAAEACITYPFEFAKTRLQLIDKASKASRNPLVLIYKTAKTQGIGSIYVGCP 74

Query: 169 STMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVK 228
           + +  N    G  F     I+ +L  ++T     T  +IAG   G        T    +K
Sbjct: 75  AFIIGNTAKAGIRFLGFDTIKDMLRDSETGELSGTRGVIAGLGAGLLESVAAVTPFEAIK 134

Query: 229 SRIQSGATTTLADG--TVVPKYNWTWPSLFKIYS----EEGFTALYKGFIPKILRLGPGG 282
                   T L D   +  PKY+     + + YS    ++GF+ LY+G +P  +R     
Sbjct: 135 --------TALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSGLYRGVLPVSMRQAANQ 186

Query: 283 GIMLVVFNGMMAFFQE 298
            + L  +N +    Q+
Sbjct: 187 AVRLGCYNKIKTLIQD 202

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 38/76 (50%), Gaps = 7/76 (9%)

Query: 3   EKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVK 62
           +KPL     F+ GA +G+  +    PLD VKTRMQ      +     Y+  ++C   I K
Sbjct: 209 DKPLSSGLTFLVGAFSGIVTVYSTMPLDTVKTRMQ------SLDSTKYSSTMNCFATIFK 262

Query: 63  REGFSRLYKGISSPML 78
            EG    +KG ++P L
Sbjct: 263 EEGLKTFWKG-ATPRL 277

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score = 80.1 bits (196), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 86/312 (27%), Positives = 134/312 (42%), Gaps = 50/312 (16%)

Query: 14  SGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGI 73
           +G   G++++LV  P D  K R+Q      T         ++ L  +VK EG    YKG 
Sbjct: 40  AGTIGGIAQVLVGQPFDTTKVRLQTATTRTT--------TLEVLRNLVKNEGVFAFYKGA 91

Query: 74  SSPMLMEAPKRATKFACNDSYQKMFK---------------DLYGVDKLTQQISILSGSL 118
            +P+L      + +F  N++ ++ F+               DL   + L      + G  
Sbjct: 92  LTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLT 151

Query: 119 AGVTEACVIVPFELVKIRLQDVNS-----KFNGPMEVVFKTIRETGILSLYNGLESTMWR 173
            GV  + +  P E ++IRLQ   S     +F GP + + K   + G++    GL  TM R
Sbjct: 152 GGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLM---RGLFPTMIR 208

Query: 174 NAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDL------IAGTIGGYCRYSTEHTILSVV 227
                G YF V     AL+ + +  T  T N++      + G   G   + T +  L VV
Sbjct: 209 AGHGLGTYFLVY---EALVAR-EIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYP-LDVV 263

Query: 228 KSRIQSGATTTLADGTVVPKYNWTWPSLFK-IYSEEGFTALYKGFIPKILRLGPGGGIML 286
           KS IQ+       D    PKY  +   + K IY++EG  A +KGF P ++R  P  G   
Sbjct: 264 KSIIQN-------DDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATF 316

Query: 287 VVFNGMMAFFQE 298
           + F  +M F  E
Sbjct: 317 LTFELVMRFLGE 328

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 78/185 (42%), Gaps = 16/185 (8%)

Query: 6   LPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREG 65
           LP    +V G   GV    +  P++ ++ R+Q Q  +  G    + G  DC+ ++  + G
Sbjct: 140 LPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQ--TSNGGDREFKGPWDCIKKLKAQGG 197

Query: 66  FSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQIS----ILSGSLAGV 121
              L +G+   M+       T F     Y+ +     G      +I      L G+ +G 
Sbjct: 198 ---LMRGLFPTMIRAGHGLGTYFLV---YEALVAREIGTGLTRNEIPPWKLCLFGAFSGT 251

Query: 122 TEACVIVPFELVKIRLQDVN---SKFNGPMEVVFKTI-RETGILSLYNGLESTMWRNAFW 177
                + P ++VK  +Q+ +    K+   +  V KTI  + GI + + G   TM R+A  
Sbjct: 252 MLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPV 311

Query: 178 NGGYF 182
           NG  F
Sbjct: 312 NGATF 316

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/199 (20%), Positives = 84/199 (42%), Gaps = 26/199 (13%)

Query: 112 SILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTM 171
            I +G++ G+ +  V  PF+  K+RLQ   ++    +EV+   ++  G+ + Y G  + +
Sbjct: 37  DIFAGTIGGIAQVLVGQPFDTTKVRLQTATTRTTT-LEVLRNLVKNEGVFAFYKGALTPL 95

Query: 172 WRNAFWNGGYFGVIFQIRALLPK----------------AKTNTEKTTNDLIAGTIGGYC 215
                     FGV   ++                     +++NT   +   + G  GG  
Sbjct: 96  LGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVV 155

Query: 216 RYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKI 275
             S   + +  ++ R+Q+  T+   D     ++   W  + K+ ++ G   L +G  P +
Sbjct: 156 N-SFLASPIEQIRIRLQT-QTSNGGDR----EFKGPWDCIKKLKAQGG---LMRGLFPTM 206

Query: 276 LRLGPGGGIMLVVFNGMMA 294
           +R G G G   +V+  ++A
Sbjct: 207 IRAGHGLGTYFLVYEALVA 225

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score = 79.0 bits (193), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 76/300 (25%), Positives = 125/300 (41%), Gaps = 33/300 (11%)

Query: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR 68
           +   ++G A G++++L+  P D  K R+Q      + + V  N        ++K EG   
Sbjct: 26  VKDLLAGTAGGIAQVLIGQPFDTTKVRLQTSKVPTSAAEVVKN--------LLKNEGPKG 77

Query: 69  LYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQIS--ILSGSLAGVTEACV 126
            YKG  +P++      + +F  N++ ++ F         T  +S   L G   G+T + +
Sbjct: 78  FYKGTLTPLVGVGACVSIQFGVNEAMKRFFHARNVDHNATLSLSQYYLCGLTGGMTNSFL 137

Query: 127 IVPFELVKIRLQD-----VNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGY 181
             P E V+IRLQ        ++F GP++ + K   + G++    GL  TM R     G Y
Sbjct: 138 ASPIEHVRIRLQTQTGSGAQAEFKGPIDCIKKLRSQKGLM---RGLIPTMLREGHGCGTY 194

Query: 182 FGVIFQIRALLPKAKTNTEKTTND-----LIAGTIGGYCRYSTEHTILSVVKSRIQSGAT 236
           F V     AL+ K      K T        + G + G   +   + I  VVKS +Q+   
Sbjct: 195 FLVY---EALVSKQINQGLKRTEIPPWKLCLYGALSGTALWLMVYPI-DVVKSVMQTDNL 250

Query: 237 TTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFF 296
               +G  + +          +Y+ EG  A +KGF P +LR  P  G     F   M   
Sbjct: 251 NKPQNGKNMIQVARN------LYAREGLKAFFKGFGPTMLRAAPANGGTFATFELAMRLL 304

>Scas_632.9
          Length = 292

 Score = 78.2 bits (191), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 70/289 (24%), Positives = 120/289 (41%), Gaps = 30/289 (10%)

Query: 13  VSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR-LYK 71
           V+G+ AG    ++ YP D VK R+Q Q     GS + +     C+      EG  R  ++
Sbjct: 22  VNGSIAGAFGKIIEYPFDTVKVRLQTQ-----GSHI-FPTTWSCIKYTYHNEGVWRGFFQ 75

Query: 72  GISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIVPFE 131
           GI SP+   A + AT F   +    + +    V  L+    +LSG+ AG   + V+ P E
Sbjct: 76  GIGSPLFGAALENATLFVSYNQCSNVLEKFTNVSPLSN--ILLSGAFAGSCASFVLTPVE 133

Query: 132 LVKIRLQDVN--------SKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFG 183
           L+K +LQ  N         K    +  +   +RE GIL L+ G  ST  R +     +F 
Sbjct: 134 LIKCKLQVSNLQTAVEGQIKHTKIIPTLMYVLREKGILGLWQGQSSTFIRESLGGVAWFA 193

Query: 184 VIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGT 243
               ++  L   + +TE  T +L+         ++        VKS +Q+   T +    
Sbjct: 194 TYEVMKQGLKDRRKDTENKTWELLVSGASAGLAFNASIFPADTVKSMMQTEHITLIN--- 250

Query: 244 VVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGM 292
                     ++ K+ +  G T  Y+G    ++R  P    +  ++  +
Sbjct: 251 ----------AVKKVLTTYGITGFYRGLGITLIRAVPANATVFYMYETL 289

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 77/172 (44%), Gaps = 6/172 (3%)

Query: 113 ILSGSLAGVTEACVIVPFELVKIRLQDVNSK-FNGPMEVVFKTIRETGILS-LYNGLEST 170
           I++GS+AG     +  PF+ VK+RLQ   S  F      +  T    G+    + G+ S 
Sbjct: 21  IVNGSIAGAFGKIIEYPFDTVKVRLQTQGSHIFPTTWSCIKYTYHNEGVWRGFFQGIGSP 80

Query: 171 MWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSR 230
           ++  A  N   F    Q   +L K  TN    +N L++G   G C  S   T + ++K +
Sbjct: 81  LFGAALENATLFVSYNQCSNVLEKF-TNVSPLSNILLSGAFAGSCA-SFVLTPVELIKCK 138

Query: 231 IQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGG 282
           +Q     T  +G +  K+    P+L  +  E+G   L++G     +R   GG
Sbjct: 139 LQVSNLQTAVEGQI--KHTKIIPTLMYVLREKGILGLWQGQSSTFIRESLGG 188

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 78.6 bits (192), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 75/333 (22%), Positives = 130/333 (39%), Gaps = 51/333 (15%)

Query: 11  QFVSGAAAGVSELLVMYPLDVVKTRMQLQ--VGSGTGSG--------------------- 47
           + VS +A  +   L + PLDVV+ R+  Q  + S T +G                     
Sbjct: 14  RMVSASAGSLVTSLFLTPLDVVRVRLHQQEMLPSCTCTGQLSKPAGKVFWQDECFANVGC 73

Query: 48  ----VAYNGVIDCLGQIVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYG 103
                   G ++ L +I + EG   L++G+   ++M  P     F+    Y+ +  +   
Sbjct: 74  REPAARLQGTLEGLRKIAQLEGLPTLWRGLGITLVMAVPANVVYFS---GYEALRDNSPL 130

Query: 104 VDKLTQQISILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEV-----VFKTIRET 158
             +L     ++ G+ A +  A  I P EL++ RLQ V    +    +     + + +R  
Sbjct: 131 ASRLPVANPLVCGAFARILAATTIAPLELLRTRLQSVPRARDTERTIYLIGDLLREMRHE 190

Query: 159 ----GILSLYNGLESTMWRNAFWNGGYFGVI------FQIRALLPKAKTNTEKTTNDLIA 208
               G  +L+ GLE T+WR+  ++  Y+G        F  R       +N +        
Sbjct: 191 VSVMGYRALFKGLEITLWRDVPFSAIYWGTYEFCKTQFWARHAATHNASNWDHFIGSFAC 250

Query: 209 GTIGGYCRYSTEHTILSVVKSRIQSGAT-----TTLADGTVVPKYNWTWPSLFKIYSEEG 263
           G++GG       H    V K+R+Q         T     T        +  L  I   EG
Sbjct: 251 GSMGGAVAALLTHP-FDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNAIRKSEG 309

Query: 264 FTALYKGFIPKILRLGPGGGIMLVVFNGMMAFF 296
             ALY G +P+++++ P   IM+  +     FF
Sbjct: 310 IRALYTGLLPRVMKIAPSCAIMISTYELSKKFF 342

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 44/99 (44%), Gaps = 8/99 (8%)

Query: 8   FIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSG---TGSGVA-----YNGVIDCLGQ 59
           FI  F  G+  G    L+ +P DV KTRMQ+ + S    T  G A       G+   L  
Sbjct: 244 FIGSFACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNA 303

Query: 60  IVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMF 98
           I K EG   LY G+   ++  AP  A   +  +  +K F
Sbjct: 304 IRKSEGIRALYTGLLPRVMKIAPSCAIMISTYELSKKFF 342

 Score = 35.0 bits (79), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 41/187 (21%), Positives = 71/187 (37%), Gaps = 17/187 (9%)

Query: 6   LPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQI---VK 62
           LP     V GA A +     + PL++++TR+Q  V     +      + D L ++   V 
Sbjct: 134 LPVANPLVCGAFARILAATTIAPLELLRTRLQ-SVPRARDTERTIYLIGDLLREMRHEVS 192

Query: 63  REGFSRLYKGISSPMLMEAPKRATKFA----CNDSYQKMFKDLYGVDKLTQQI-SILSGS 117
             G+  L+KG+   +  + P  A  +     C   +       +        I S   GS
Sbjct: 193 VMGYRALFKGLEITLWRDVPFSAIYWGTYEFCKTQFWARHAATHNASNWDHFIGSFACGS 252

Query: 118 LAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVF-----KTIRETGILSLYNGLESTMW 172
           + G   A +  PF++ K R+Q        P ++       KT    G+ S  N +  +  
Sbjct: 253 MGGAVAALLTHPFDVGKTRMQIA---IASPQQLTVGGKATKTDDSRGMFSFLNAIRKSEG 309

Query: 173 RNAFWNG 179
             A + G
Sbjct: 310 IRALYTG 316

>Kwal_33.14050
          Length = 314

 Score = 77.8 bits (190), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 69/292 (23%), Positives = 119/292 (40%), Gaps = 19/292 (6%)

Query: 7   PFIYQFVSGAAAGVSELLVMYPLDVVKTRMQ---LQVGSGTGSGVAYNGVIDCLGQIVKR 63
           P  +Q  +GA AG+ E  +M+P+D +KTRMQ     +GS   +    + ++  + +I   
Sbjct: 15  PLTHQLAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARISTT 74

Query: 64  EGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTE 123
           EG   L+KG+ S +L   P  A  FA  +  +    D           +  SG  A V  
Sbjct: 75  EGSMALWKGVQSVILGAGPAHAVYFATYEMCKSYLIDPQDFQTHQPLKTAASGIAATVAA 134

Query: 124 ACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFG 183
             ++ PF+ +K R+Q      +    V  +  R  G+ + +    +T+  N  +    F 
Sbjct: 135 DLLMNPFDTIKQRMQLRTFSKDRMWSVASRIYRNEGLAAFFYSYPTTIAMNIPFAAFNFA 194

Query: 184 VIFQIRALLPKAKTNTEKTTNDLI----AGTIGGYCRYSTEHTILSVVKSRIQSGATTTL 239
           +             N E T N LI     G  G  C   T  T L  +K+ +Q   + ++
Sbjct: 195 IYESATKFF-----NPENTYNPLIHCLCGGISGATCAAIT--TPLDCIKTVLQVRGSESV 247

Query: 240 ADGTV--VPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVF 289
            D        ++    ++ K+Y   GF   ++G  P+I+   P   I    +
Sbjct: 248 VDPLFRQADTFSRAASAISKVYGWSGF---WRGLKPRIISNMPATAISWTAY 296

 Score = 35.0 bits (79), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 44/205 (21%), Positives = 78/205 (38%), Gaps = 30/205 (14%)

Query: 107 LTQQISILSGSLAGVTEACVIVPFELVKIRLQ-------DVNSKFNGPMEVVFKTIR--- 156
           LT Q++  +G+ AG+ E  ++ P + +K R+Q         N+    P  +V +  R   
Sbjct: 16  LTHQLA--AGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARIST 73

Query: 157 ETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRALL--PKAKTNTE--KTTNDLIAGTIG 212
             G ++L+ G++S +      +  YF      ++ L  P+     +  KT    IA T+ 
Sbjct: 74  TEGSMALWKGVQSVILGAGPAHAVYFATYEMCKSYLIDPQDFQTHQPLKTAASGIAATVA 133

Query: 213 GYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFI 272
                +   TI    K R+Q     T +   +       W    +IY  EG  A +  + 
Sbjct: 134 ADLLMNPFDTI----KQRMQ---LRTFSKDRM-------WSVASRIYRNEGLAAFFYSYP 179

Query: 273 PKILRLGPGGGIMLVVFNGMMAFFQ 297
             I    P       ++     FF 
Sbjct: 180 TTIAMNIPFAAFNFAIYESATKFFN 204

>Scas_562.12
          Length = 300

 Score = 77.0 bits (188), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 74/289 (25%), Positives = 125/289 (43%), Gaps = 38/289 (13%)

Query: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR 68
           + + +  A+AG+ E+ V +P+D +  R+   + + T  G ++      L +++ RE FS 
Sbjct: 11  VARLLGSASAGILEIGVFHPVDTISKRL---MSNHTKIGNSHE-----LNRVIFREHFSE 62

Query: 69  --------LYKGISSPMLMEAPKRATKFA--------CNDSYQKMFKDLYGVDKLTQQIS 112
                   L+ G+      +  +R  K+          N  Y+K F   +G        S
Sbjct: 63  PLGKRLFTLFPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDSAFGEKTGKAMRS 122

Query: 113 ILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMW 172
             +GSL G+ E  V++P +++KI+ Q     F G   V  K +++ GI +LY G   T  
Sbjct: 123 ATAGSLIGIGE-IVLLPLDVLKIKRQTNPEAFKGRGFV--KILKDEGIFNLYRGWGWTAA 179

Query: 173 RNAFWNGGYFG-VIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRI 231
           RNA  +   FG   F    +L     +    + + I+  +G  C        L V+K+RI
Sbjct: 180 RNAPGSFALFGGNAFAKEYILGLEDYSQASWSQNFISSIVGASCSLIVS-APLDVIKTRI 238

Query: 232 QSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGP 280
           Q+ +      G  + K           +  EG TA +KG  PK+L  GP
Sbjct: 239 QNRSFDNPETGLTIVK---------NTFKNEGITAFFKGLTPKLLTTGP 278

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 39/91 (42%), Gaps = 6/91 (6%)

Query: 11  QFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLY 70
            F+S        L+V  PLDV+KTR+Q +      +G+        +    K EG +  +
Sbjct: 213 NFISSIVGASCSLIVSAPLDVIKTRIQNRSFDNPETGLT------IVKNTFKNEGITAFF 266

Query: 71  KGISSPMLMEAPKRATKFACNDSYQKMFKDL 101
           KG++  +L   PK    FA   S    F  L
Sbjct: 267 KGLTPKLLTTGPKLVFSFALAQSLIPKFDSL 297

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score = 76.3 bits (186), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 73/285 (25%), Positives = 127/285 (44%), Gaps = 41/285 (14%)

Query: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR 68
           I   ++G A G++++LV  P D  K R+Q    S           +  +  ++K EG   
Sbjct: 24  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETS--------TNAVKVIKDLIKNEGPMG 75

Query: 69  LYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILS----GSLAGVTEA 124
            YKG  +P++      + +F  N++ ++ F      +  +Q +S+L     G   G T +
Sbjct: 76  FYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFD--EAASQHLSLLQYYICGVAGGFTNS 133

Query: 125 CVIVPFELVKIRLQD-----VNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNG 179
            +  P E ++IRLQ        ++F GP++ + K +R  G   L  GL  TM R +   G
Sbjct: 134 FLASPIEHIRIRLQTQTGSGATAEFKGPIDCI-KKLRVNG--QLMRGLTPTMLRESHGCG 190

Query: 180 GYFGVIFQIRALL-PKAKTNTEKTTNDLIA------GTIGGYCRYSTEHTILSVVKSRIQ 232
            YF       AL+  + K+  ++   D+ A      G   G   ++  +  L V+KS +Q
Sbjct: 191 VYF---LTYEALIGHQVKSGIQR--KDIPAWKLCLFGAASGTLLWTMVYP-LDVIKSVMQ 244

Query: 233 SGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILR 277
           +    T  +G  +     T      I + +G + L+KGF P +LR
Sbjct: 245 TDNLKTPKNGNNILTVGRT------IIARQGVSGLFKGFAPTMLR 283

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 79/182 (43%), Gaps = 20/182 (10%)

Query: 2   SEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIV 61
           + + L  +  ++ G A G +   +  P++ ++ R+Q Q GS  G+   + G IDC   I 
Sbjct: 112 ASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGS--GATAEFKGPIDC---IK 166

Query: 62  KREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISI------LS 115
           K     +L +G++  ML E+      F    +Y+ +    + V    Q+  I      L 
Sbjct: 167 KLRVNGQLMRGLTPTMLRESHGCGVYFL---TYEALIG--HQVKSGIQRKDIPAWKLCLF 221

Query: 116 GSLAGVTEACVIVPFELVKIRLQDVNSKF----NGPMEVVFKTIRETGILSLYNGLESTM 171
           G+ +G     ++ P +++K  +Q  N K     N  + V    I   G+  L+ G   TM
Sbjct: 222 GAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTM 281

Query: 172 WR 173
            R
Sbjct: 282 LR 283

 Score = 37.4 bits (85), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 1   MSEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQI 60
           +  K +P     + GAA+G     ++YPLDV+K+ MQ        +G   N ++     I
Sbjct: 208 IQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNG---NNILTVGRTI 264

Query: 61  VKREGFSRLYKGISSPML 78
           + R+G S L+KG +  ML
Sbjct: 265 IARQGVSGLFKGFAPTML 282

>Scas_645.9
          Length = 391

 Score = 76.3 bits (186), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 71/262 (27%), Positives = 119/262 (45%), Gaps = 26/262 (9%)

Query: 45  GSGVAYNGVIDCLGQIVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGV 104
            S V +NG ++   +I K EG + L++GIS  +LM  P     F     Y+ +  +    
Sbjct: 124 NSSVRFNGTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFT---GYEYLRDNSPLA 180

Query: 105 DKLTQQISILSGSLAGVTEACVIVPFELVKIRLQDVN--SKFNGPMEVVFKTIRET---- 158
                   ++ G++A +  A  + P EL+K +LQ +   SK      +V + ++ET    
Sbjct: 181 TSSPTFNPLMCGAIARILAASTVAPLELLKTKLQSIPRVSKSTTSWMMVKELLKETRQEM 240

Query: 159 ----GILSLYNGLESTMWRNAFWNGGYFGVIFQIRALL----PKAKTNTEKTTNDLIAGT 210
                  +L+ GLE T+WR+  ++  Y+G     +  L     K+ +N     N  I G+
Sbjct: 241 RISGASNALFKGLEITLWRDVPFSAIYWGSYEFCKTHLWMDTSKSHSNLTFFINSFIGGS 300

Query: 211 IGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVV--PKYNWTWPSLFK----IYSEEGF 264
           I G       H    V K+R Q        D +VV  P    T  ++FK    I+  EG+
Sbjct: 301 ISGTIAALVTHP-FDVGKTRWQISFMGN-NDKSVVKSPDIEQT-KNMFKFLRNIWKLEGW 357

Query: 265 TALYKGFIPKILRLGPGGGIML 286
            ALY G +P+++++ P   IM+
Sbjct: 358 GALYTGLVPRMVKIAPSCAIMI 379

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 44/98 (44%), Gaps = 7/98 (7%)

Query: 8   FIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVID-------CLGQI 60
           FI  F+ G+ +G    LV +P DV KTR Q+         V  +  I+        L  I
Sbjct: 292 FINSFIGGSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNI 351

Query: 61  VKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMF 98
            K EG+  LY G+   M+  AP  A   +  +  +++F
Sbjct: 352 WKLEGWGALYTGLVPRMVKIAPSCAIMISSYELSKRLF 389

 Score = 32.7 bits (73), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 47/196 (23%), Positives = 85/196 (43%), Gaps = 15/196 (7%)

Query: 7   PFIYQFVSGAAAGVSELLVMYPLDVVKTRMQL--QVGSGTGSGVAYNGVIDCLGQIVKRE 64
           P     + GA A +     + PL+++KT++Q   +V   T S +    ++    Q ++  
Sbjct: 184 PTFNPLMCGAIARILAASTVAPLELLKTKLQSIPRVSKSTTSWMMVKELLKETRQEMRIS 243

Query: 65  GFSR-LYKGISSPMLMEAPKRATKFACNDSYQKMFKDLY-----GVDKLTQQI-SILSGS 117
           G S  L+KG+   +  + P  A  +    SY+     L+         LT  I S + GS
Sbjct: 244 GASNALFKGLEITLWRDVPFSAIYWG---SYEFCKTHLWMDTSKSHSNLTFFINSFIGGS 300

Query: 118 LAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFW 177
           ++G   A V  PF++ K R Q      N    V    I +T   +++  L + +W+   W
Sbjct: 301 ISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTK--NMFKFLRN-IWKLEGW 357

Query: 178 NGGYFGVIFQIRALLP 193
              Y G++ ++  + P
Sbjct: 358 GALYTGLVPRMVKIAP 373

>Kwal_26.7967
          Length = 297

 Score = 74.3 bits (181), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 71/303 (23%), Positives = 136/303 (44%), Gaps = 26/303 (8%)

Query: 3   EKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVK 62
           +K +  ++ F++G+ AG  E  + YP +  KTR+QL   S T S       +  + +  K
Sbjct: 4   KKQVDPLHSFLAGSLAGAVEASITYPFEFAKTRLQLVDKSSTAS----RNPLTLIYRTAK 59

Query: 63  REGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVT 122
            +G   +Y G  + ++    K   +F   D+ + + +D     +L+    I++G  AG+ 
Sbjct: 60  VQGLGAVYVGCPAFIVGNTAKAGVRFLGFDAIKNILRDPT-TGELSGPRGIVAGLGAGLL 118

Query: 123 EACVIV-PFELVKIRL----QDVNSKFN----GPMEVVFKTIRETGILSLYNGLESTMWR 173
           E+ V V PFE +K  L    Q  + K++    G +      + + G   LY G+     R
Sbjct: 119 ESVVAVTPFEAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGFSGLYRGVLPVSMR 178

Query: 174 NAFWNGGYFGVIFQIRALLPK-AKTNTEKTTNDLIAGTIGGYCRYSTEHTILSV--VKSR 230
            A       G   +I+ ++     +  +K  +  +   +G +    T +T + +  VK+R
Sbjct: 179 QAANQAVRLGCYNKIKTMIQDYTNSAKDKPLSSGMTFVVGAFSGIVTVYTTMPIDTVKTR 238

Query: 231 IQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFN 290
           +QS  ++         KY+ T      ++ EEG    +KG  P++ RL   GGI+  ++ 
Sbjct: 239 MQSLDSS---------KYSSTINCFATVFREEGLKTFWKGATPRLGRLILSGGIVFTIYE 289

Query: 291 GMM 293
            ++
Sbjct: 290 KVL 292

 Score = 63.9 bits (154), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 85/196 (43%), Gaps = 17/196 (8%)

Query: 112 SILSGSLAGVTEACVIVPFELVKIRLQDVN---SKFNGPMEVVFKTIRETGILSLYNGLE 168
           S L+GSLAG  EA +  PFE  K RLQ V+   +    P+ ++++T +  G+ ++Y G  
Sbjct: 12  SFLAGSLAGAVEASITYPFEFAKTRLQLVDKSSTASRNPLTLIYRTAKVQGLGAVYVGCP 71

Query: 169 STMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVK 228
           + +  N    G  F     I+ +L    T        ++AG   G        T    +K
Sbjct: 72  AFIVGNTAKAGVRFLGFDAIKNILRDPTTGELSGPRGIVAGLGAGLLESVVAVTPFEAIK 131

Query: 229 SRIQSGATTTLADG--TVVPKYNWTWPSLFKIYS----EEGFTALYKGFIPKILRLGPGG 282
                   T L D   +  PKY+     + + YS    ++GF+ LY+G +P  +R     
Sbjct: 132 --------TALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGFSGLYRGVLPVSMRQAANQ 183

Query: 283 GIMLVVFNGMMAFFQE 298
            + L  +N +    Q+
Sbjct: 184 AVRLGCYNKIKTMIQD 199

>Kwal_27.12599
          Length = 304

 Score = 74.7 bits (182), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 74/302 (24%), Positives = 130/302 (43%), Gaps = 37/302 (12%)

Query: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR 68
           +   ++G A G++++LV  P D  K R+Q      T         ++ + ++VK EG   
Sbjct: 25  LKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTA--------VEVVKKLVKNEGLRG 76

Query: 69  LYKGISSPMLMEAPKRATKFACNDSYQKMFK----DLYGVDKLTQQISILSGSLAGVTEA 124
            YKG  +P++      + +F  N++ ++ F+    D +    L Q    + G + GV  +
Sbjct: 77  FYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQY--YICGFVGGVANS 134

Query: 125 CVIVPFELVKIRLQDVN-----SKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNG 179
            +  P E V+IRLQ        ++F GP++ + K +R  G  +L  GL  T+ R A    
Sbjct: 135 FLASPIEHVRIRLQTQTASGTVAEFKGPLDCINK-LRANG--ALMRGLSPTILREAQGCA 191

Query: 180 GYF-----GVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSG 234
            YF      V  QI   + ++     K     + G + G   + T +  L V+KS +Q+ 
Sbjct: 192 TYFLTYEALVANQIGKGIARSDVPAWKLC---LFGAVSGVTLWLTVYP-LDVIKSLMQTD 247

Query: 235 ATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMA 294
                  G  + +          + ++ G+ + +KGF P +LR  P  G     F   M 
Sbjct: 248 NLKNPVRGKNIIQVARL------VNAKYGWKSFFKGFGPTMLRAAPANGATFATFELAMR 301

Query: 295 FF 296
           F 
Sbjct: 302 FL 303

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 83/189 (43%), Gaps = 16/189 (8%)

Query: 3   EKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVK 62
            K L     ++ G   GV+   +  P++ V+ R+Q Q  SGT +   + G +DC+ ++  
Sbjct: 114 HKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVA--EFKGPLDCINKL-- 169

Query: 63  REGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQIS----ILSGSL 118
                 L +G+S  +L EA   AT F    +Y+ +  +  G       +      L G++
Sbjct: 170 -RANGALMRGLSPTILREAQGCATYFL---TYEALVANQIGKGIARSDVPAWKLCLFGAV 225

Query: 119 AGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIR----ETGILSLYNGLESTMWRN 174
           +GVT    + P +++K  +Q  N K     + + +  R    + G  S + G   TM R 
Sbjct: 226 SGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRA 285

Query: 175 AFWNGGYFG 183
           A  NG  F 
Sbjct: 286 APANGATFA 294

 Score = 28.5 bits (62), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 38/100 (38%), Gaps = 12/100 (12%)

Query: 198 NTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFK 257
           ++ +   DL+AGT GG  +           K R+Q+  T T A   V            K
Sbjct: 20  DSGRVLKDLLAGTAGGMAQVLVGQP-FDTTKVRLQTSTTPTTAVEVVK-----------K 67

Query: 258 IYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFFQ 297
           +   EG    YKG +  ++ +G        V   M  FF+
Sbjct: 68  LVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFR 107

>Scas_558.2
          Length = 289

 Score = 73.9 bits (180), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 82/316 (25%), Positives = 132/316 (41%), Gaps = 64/316 (20%)

Query: 8   FIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFS 67
           F+   +SGAAAG S  LV +P+D +KTR+Q +       G   NG            G+ 
Sbjct: 6   FVMSLLSGAAAGTSTDLVFFPIDTLKTRLQAK------GGFFQNG------------GYH 47

Query: 68  RLYKGISSPMLMEAPKRATKFACNDSYQKMF-------------KDLYGVDKLTQQISIL 114
            +Y+G+ S ++  AP  +  F   DS +                +  + VD +   I+  
Sbjct: 48  GIYRGLGSAVVASAPSASLFFVTYDSMKVRVRPHVERVINSSGTRSPHSVDTIVHMIASS 107

Query: 115 SGSLAGVTEACVI-VPFELVKIRLQ--DVNSKFNGPMEVVFKTIRETGIL-SLYNGLEST 170
            G LA    AC++ VP E++K R Q    NS +      + K   + GI+ +LY G  +T
Sbjct: 108 MGELA----ACLVRVPAEVIKQRTQVHSTNSSWQ-TFRTILKNENQEGIIRNLYRGWSTT 162

Query: 171 MWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDL------IAGTIGGYCRYSTEHTIL 224
           + R       +  + F +   + K     +     L      I G+I G    +T  T L
Sbjct: 163 IMREI----PFTCIQFPLYEFMKKEWALYDNEVGHLKPWKGAICGSIAGGIAAATT-TPL 217

Query: 225 SVVKSRIQSGATTTLADGTVVPKYNWTWPSLFK-IYSEEGFTALYKGFIPKILRLGPGGG 283
             +K+R+       + +   +P       SL + IY EEGF   + G  P+ + +  GG 
Sbjct: 218 DFLKTRL-------MLNKDSIPI-----KSLIRNIYKEEGFKIFFSGIYPRTMWISAGGA 265

Query: 284 IMLVVFNGMMAFFQEM 299
           I L V+  M    Q +
Sbjct: 266 IFLGVYETMHFMLQSL 281

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 73.9 bits (180), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 74/295 (25%), Positives = 133/295 (45%), Gaps = 28/295 (9%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71
           F++G  AG  E  V YP +  KTR+QL       S  + N ++  +    K +G   +Y 
Sbjct: 13  FIAGCLAGAVEASVTYPFEFAKTRLQLL---DKASKASRNPLV-LIYNTAKTQGIGSVYV 68

Query: 72  GISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIV-PF 130
           G  + ++    K   +F   D+ + + +D     +L+    +++G  AG+ E+ V V PF
Sbjct: 69  GCPAFIVGNTAKAGVRFLGFDTIKNLLRDPK-TGELSGPRGVIAGLGAGLLESVVAVTPF 127

Query: 131 ELVKIRL----QDVNSKFN----GPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYF 182
           E +K  L    Q    K++    G +      +R+ G+  LY G+     R A       
Sbjct: 128 EAIKTALIDDKQSATPKYHNNGKGMLRNYTALVRKQGLSGLYRGVLPVSMRQAANQAVRL 187

Query: 183 GVIFQIRALLPKAKTNT--EKTTNDLIAGTIGGYCRYSTEHTILSV--VKSRIQSGATTT 238
           G   +I+ ++ +  TN   +K  +  +   +G +    T +T + +  VK+R+QS  +  
Sbjct: 188 GCYNKIKVMV-QDYTNAPKDKPLSSGLTFVVGAFSGIVTVYTTMPIDTVKTRMQSLDSK- 245

Query: 239 LADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMM 293
                   +Y+ T      I+ EEG  A +KG  P++ RL   GGI+  V+  ++
Sbjct: 246 --------RYSSTINCFTTIFKEEGLKAFWKGATPRLGRLFLSGGIVFTVYEKVL 292

 Score = 63.5 bits (153), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 84/196 (42%), Gaps = 17/196 (8%)

Query: 112 SILSGSLAGVTEACVIVPFELVKIRLQ--DVNSKFN-GPMEVVFKTIRETGILSLYNGLE 168
           S ++G LAG  EA V  PFE  K RLQ  D  SK +  P+ +++ T +  GI S+Y G  
Sbjct: 12  SFIAGCLAGAVEASVTYPFEFAKTRLQLLDKASKASRNPLVLIYNTAKTQGIGSVYVGCP 71

Query: 169 STMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVK 228
           + +  N    G  F     I+ LL   KT        +IAG   G        T    +K
Sbjct: 72  AFIVGNTAKAGVRFLGFDTIKNLLRDPKTGELSGPRGVIAGLGAGLLESVVAVTPFEAIK 131

Query: 229 SRIQSGATTTLADG--TVVPKYNWTWPSLFKIYS----EEGFTALYKGFIPKILRLGPGG 282
                   T L D   +  PKY+     + + Y+    ++G + LY+G +P  +R     
Sbjct: 132 --------TALIDDKQSATPKYHNNGKGMLRNYTALVRKQGLSGLYRGVLPVSMRQAANQ 183

Query: 283 GIMLVVFNGMMAFFQE 298
            + L  +N +    Q+
Sbjct: 184 AVRLGCYNKIKVMVQD 199

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 38/76 (50%), Gaps = 7/76 (9%)

Query: 3   EKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVK 62
           +KPL     FV GA +G+  +    P+D VKTRMQ      +     Y+  I+C   I K
Sbjct: 206 DKPLSSGLTFVVGAFSGIVTVYTTMPIDTVKTRMQ------SLDSKRYSSTINCFTTIFK 259

Query: 63  REGFSRLYKGISSPML 78
            EG    +KG ++P L
Sbjct: 260 EEGLKAFWKG-ATPRL 274

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 73.6 bits (179), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 80/303 (26%), Positives = 131/303 (43%), Gaps = 44/303 (14%)

Query: 8   FIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFS 67
           F    +SGAAAG S  LV +P+D +KTR+Q +       G   NG            G+ 
Sbjct: 4   FFLSLLSGAAAGTSTDLVFFPIDTIKTRLQAK------GGFFANG------------GYK 45

Query: 68  RLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQIS---------ILSGSL 118
            +Y+G+ S ++  AP  +  F   D Y K+    Y + KL  Q S         +LS S+
Sbjct: 46  GIYRGLGSAVVASAPGASLFFISYD-YMKVKSRPY-ISKLYSQGSEQLIDTTTHMLSSSI 103

Query: 119 AGVTEACVIVPFELVKIRLQ--DVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAF 176
             +    V VP E+VK R Q    NS +     ++    +E    +LY G  +T+ R   
Sbjct: 104 GEICACLVRVPAEVVKQRTQVHSTNSSWQTLQSILRNDNKEGLRKNLYRGWSTTIMREIP 163

Query: 177 WNGGYFGVIFQIRALLPKAKTNTE-KTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGA 235
           +    F +   ++    KA   ++ +     I G+I G    +T  T L  +K+R+    
Sbjct: 164 FTCIQFPLYEYLKKTWAKANGQSQVEPWKGAICGSIAGGIAAATT-TPLDFLKTRLMLNK 222

Query: 236 TTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAF 295
           TT  + G+V+           +IY EEG    + G  P+ + +  GG I L ++  + + 
Sbjct: 223 TTA-SLGSVI----------IRIYREEGPAVFFSGVGPRTMWISAGGAIFLGMYETVHSL 271

Query: 296 FQE 298
             +
Sbjct: 272 LSK 274

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 73.6 bits (179), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 67/282 (23%), Positives = 120/282 (42%), Gaps = 19/282 (6%)

Query: 7   PFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGF 66
           P  +Q ++GA AG+ E  V++P+D +KTR+Q      + SG A  G+I  + +I   EG 
Sbjct: 15  PLHHQLLAGAFAGIMEHSVLFPVDAIKTRIQ-----SSSSGAATQGLIKQISKITTAEGS 69

Query: 67  SRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACV 126
             L+KG+ S +L   P  A  FA  +  +    D   +       + +SG  A      +
Sbjct: 70  LALWKGVQSVILGAGPAHAVYFATYEFSKSKLIDPQDMHTHQPIKTAISGMAATTVADAL 129

Query: 127 IVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVIF 186
           + PF+++K R+Q +N++      V      + G  + Y    +T+  N  +    F +  
Sbjct: 130 MNPFDVIKQRMQ-LNTR-ESVWHVTKNIYHKEGFAAFYYSYPTTLVMNIPFAAFNFAIYE 187

Query: 187 QIRALLPKAKTNTEKTTNDLI----AGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADG 242
                +     N     N  I     G  G  C   T  T L  +K+ +Q   + T+++ 
Sbjct: 188 SATKFM-----NPSNEYNPFIHCISGGLSGATCAAIT--TPLDCIKTVLQVRGSETVSN- 239

Query: 243 TVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGI 284
            ++ + N    +   IY   G+    +G  P+++   P   I
Sbjct: 240 EIMKQANTFQRAASAIYKIHGWKGFLRGLKPRVIANMPATAI 281

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/186 (20%), Positives = 72/186 (38%), Gaps = 16/186 (8%)

Query: 113 ILSGSLAGVTEACVIVPFELVKIRLQDVNS--KFNGPMEVVFKTIRETGILSLYNGLEST 170
           +L+G+ AG+ E  V+ P + +K R+Q  +S     G ++ + K     G L+L+ G++S 
Sbjct: 20  LLAGAFAGIMEHSVLFPVDAIKTRIQSSSSGAATQGLIKQISKITTAEGSLALWKGVQSV 79

Query: 171 MWRNAFWNGGYFGVI-FQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKS 229
           +      +  YF    F    L+     +T +     I+G +              V+K 
Sbjct: 80  ILGAGPAHAVYFATYEFSKSKLIDPQDMHTHQPIKTAISG-MAATTVADALMNPFDVIKQ 138

Query: 230 RIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVF 289
           R+Q     ++            W     IY +EGF A Y  +   ++   P       ++
Sbjct: 139 RMQLNTRESV------------WHVTKNIYHKEGFAAFYYSYPTTLVMNIPFAAFNFAIY 186

Query: 290 NGMMAF 295
                F
Sbjct: 187 ESATKF 192

 Score = 34.3 bits (77), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 39/89 (43%), Gaps = 15/89 (16%)

Query: 204 NDLIAGTIGGYCRYSTEHTIL---SVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYS 260
           + L+AG   G      EH++L     +K+RIQS ++     G +          + KI +
Sbjct: 18  HQLLAGAFAGI----MEHSVLFPVDAIKTRIQSSSSGAATQGLI--------KQISKITT 65

Query: 261 EEGFTALYKGFIPKILRLGPGGGIMLVVF 289
            EG  AL+KG    IL  GP   +    +
Sbjct: 66  AEGSLALWKGVQSVILGAGPAHAVYFATY 94

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 73.2 bits (178), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 76/303 (25%), Positives = 130/303 (42%), Gaps = 28/303 (9%)

Query: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVI--DCLGQIVKREGF 66
           + + +  A+AG+ E+ V +P+D +  R+ +   +   SG   N VI  D   +   +  F
Sbjct: 11  VARLLGSASAGILEIGVFHPVDTISKRL-MSNHTKITSGAQLNSVIFRDHAAEAFGKRVF 69

Query: 67  SRLYKGISSPMLMEAPKRATKFA--------CNDSYQKMFKDLYGVDKLTQQI-SILSGS 117
           + L+ G+    + +  +R  K+          N  ++K F   +G DK  + + S  +GS
Sbjct: 70  T-LFPGLGYAAVYKILQRVYKYGGQPFANEFLNKHFKKDFDSAFG-DKTGKALRSATAGS 127

Query: 118 LAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFW 177
           L G+ E  V++P +++KI+ Q     F G      K +++ GI +LY G   T  RNA  
Sbjct: 128 LIGIGE-IVLLPLDVLKIKRQTNPEAFKG--RGFLKILKDEGIFNLYRGWGWTAARNAPG 184

Query: 178 NGGYFG-VIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGAT 236
           +   FG   F    +L     +    + + I+  +G           L V+K+RIQ+   
Sbjct: 185 SFALFGGNAFAKEYILGLQDYSQATWSQNFISSIVGASASLIVS-APLDVIKTRIQNRNF 243

Query: 237 TTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFF 296
                G  + K              EGFTA +KG  PK+L  GP       +   ++  F
Sbjct: 244 DNPESGFKIVK---------NTLKNEGFTAFFKGLTPKLLTTGPKLVFSFALAQSLIPMF 294

Query: 297 QEM 299
             M
Sbjct: 295 DNM 297

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score = 72.8 bits (177), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 71/295 (24%), Positives = 115/295 (38%), Gaps = 37/295 (12%)

Query: 15  GAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR-LYKGI 73
           G+ AG    ++ YP D VK R+Q Q          Y     C+      EG  +  Y+GI
Sbjct: 14  GSVAGAIGKVIEYPFDTVKVRLQTQPAH------LYPTTWSCIRSTYTDEGIWKGFYQGI 67

Query: 74  SSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIVPFELV 133
           +SP+   A + A  F   +       +   +  LT+  +I SG+ AG   + ++ P ELV
Sbjct: 68  ASPLFGAALENAVLFVSFNQCTNFLDEFTQLKPLTK--TIYSGAFAGACASFILTPVELV 125

Query: 134 KIRLQDVN--------SKFNGPMEVVFKTIRETGILSLYNGLESTMWRN----AFWNGGY 181
           K +LQ  N        ++       +   I+E G+L L+ G  ST  R     A W   Y
Sbjct: 126 KCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLGGAVWFTTY 185

Query: 182 FGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLAD 241
             +  +  +L P  K N   T   L++G   G   ++        VKS  Q+   + +  
Sbjct: 186 EIMKMKFASLHPAEKEN--HTWELLVSGASAG-VLFNASVFPADTVKSVCQTEHVSIVN- 241

Query: 242 GTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFF 296
                       +L K+    G T  Y+G    ++R  P    +   +  +   F
Sbjct: 242 ------------ALKKVLRTHGITGFYRGLGITLIRAAPANATVFYTYETLKKMF 284

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 82/190 (43%), Gaps = 8/190 (4%)

Query: 113 ILSGSLAGVTEACVIVPFELVKIRLQDVNSK-FNGPMEVVFKTIRETGILS-LYNGLEST 170
           I  GS+AG     +  PF+ VK+RLQ   +  +      +  T  + GI    Y G+ S 
Sbjct: 11  IAYGSVAGAIGKVIEYPFDTVKVRLQTQPAHLYPTTWSCIRSTYTDEGIWKGFYQGIASP 70

Query: 171 MWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSR 230
           ++  A  N   F    Q    L +  T  +  T  + +G   G C  S   T + +VK +
Sbjct: 71  LFGAALENAVLFVSFNQCTNFLDEF-TQLKPLTKTIYSGAFAGACA-SFILTPVELVKCK 128

Query: 231 IQ-SGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVF 289
           +Q S  + +L+  T   ++   WP++  +  E+G   L++G +   +R   GG +    +
Sbjct: 129 LQVSNISNSLSQTT---RHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLGGAVWFTTY 185

Query: 290 NGMMAFFQEM 299
             M   F  +
Sbjct: 186 EIMKMKFASL 195

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 45/87 (51%), Gaps = 10/87 (11%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71
            VSGA+AGV     ++P D VK+  Q +          +  +++ L ++++  G +  Y+
Sbjct: 208 LVSGASAGVLFNASVFPADTVKSVCQTE----------HVSIVNALKKVLRTHGITGFYR 257

Query: 72  GISSPMLMEAPKRATKFACNDSYQKMF 98
           G+   ++  AP  AT F   ++ +KMF
Sbjct: 258 GLGITLIRAAPANATVFYTYETLKKMF 284

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score = 73.2 bits (178), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 78/301 (25%), Positives = 126/301 (41%), Gaps = 31/301 (10%)

Query: 2   SEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQ-----LQVGSGTGSGVAYNGVIDC 56
             K   F+  F+ G  +         P++ VK  +Q     L+ GS       YNG++DC
Sbjct: 3   DNKQSNFLINFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKQGS---LDRRYNGIVDC 59

Query: 57  LGQIVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQIS--IL 114
             +    EG    ++G ++ ++   P +A  FA  D  + MF     VD   +  +  + 
Sbjct: 60  FKRTAASEGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFRKEVDGYAKWFAGNLA 119

Query: 115 SGSLAGVTEACVIVPFELVKIRL-QDVNS-------KFNGPMEVVFKTIRETGILSLYNG 166
           SG  AG      +   +  + RL  D  S       +FNG ++V  KT+   GI  LY G
Sbjct: 120 SGGAAGGLSLLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGIAGLYRG 179

Query: 167 LESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLI--AGTIGGYCRYSTEHTIL 224
              ++     + G YFG+   ++ LL      +    + L+  A T G     ST    L
Sbjct: 180 FLPSVVGIVVYRGLYFGMYDSLKPLLLTGNLESSFIASFLLGWAVTTGA----STASYPL 235

Query: 225 SVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGI 284
             V+ R+       +  G  V KY+  + +  KI + EG  +L+KG    ILR   G G+
Sbjct: 236 DTVRRRMM------MTSGQAV-KYDGAFDAFRKIVAAEGVKSLFKGCGANILRGVAGAGV 288

Query: 285 M 285
           +
Sbjct: 289 I 289

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/193 (22%), Positives = 75/193 (38%), Gaps = 26/193 (13%)

Query: 8   FIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSG-VAYNGVIDCLGQIVKREGF 66
           F     SG AAG   LL +Y LD  +TR+     S    G   +NG++D   + +  +G 
Sbjct: 114 FAGNLASGGAAGGLSLLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGI 173

Query: 67  SRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACV 126
           + LY+G    ++     R   F   DS + +   L G  + +   S L G       +  
Sbjct: 174 AGLYRGFLPSVVGIVVYRGLYFGMYDSLKPLL--LTGNLESSFIASFLLGWAVTTGASTA 231

Query: 127 IVPFELVKIRL-----------------------QDVNSKFNGPMEVVFKTIRETGILSL 163
             P + V+ R+                       + V S F G    + + +   G++SL
Sbjct: 232 SYPLDTVRRRMMMTSGQAVKYDGAFDAFRKIVAAEGVKSLFKGCGANILRGVAGAGVISL 291

Query: 164 YNGLESTMWRNAF 176
           Y+ L+  ++   F
Sbjct: 292 YDQLQLVLFGKKF 304

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 72.8 bits (177), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 76/299 (25%), Positives = 125/299 (41%), Gaps = 30/299 (10%)

Query: 3   EKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQ---VGSGTGSGVAYNGVIDCLGQ 59
           ++   F   F+ G  +         P++ VK  +Q Q   +  GT     Y+G++DC  +
Sbjct: 7   QQETNFAINFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGT-LDKKYSGIVDCFKR 65

Query: 60  IVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKM--FKDLYGVDKLTQQISILSGS 117
             K+EG    ++G ++ ++   P +A  FA  D  + M  FK   G  K     ++ SG 
Sbjct: 66  TAKQEGLISFWRGNTANVIRYFPTQALNFAFKDKIKLMFGFKKEEGYGKWFAG-NLASGG 124

Query: 118 LAGVTEACVIVPFELVKIRL-QDVNS-------KFNGPMEVVFKTIRETGILSLYNGLES 169
            AG      +   +  + RL  D  S       +FNG  +V  KT++  GI  LY G   
Sbjct: 125 AAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYRGFMP 184

Query: 170 TMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTI---GGYCRYSTEHTILSV 226
           ++     + G YFG+   ++ L+     +     + L+   +      C Y      L  
Sbjct: 185 SVVGIVVYRGLYFGMFDSLKPLVLTGSLDGSFLASFLLGWVVTTGASTCSYP-----LDT 239

Query: 227 VKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIM 285
           V+ R+       +  G  V KYN     L KI + EG  +L+KG    ILR   G G++
Sbjct: 240 VRRRMM------MTSGQAV-KYNGAIDCLKKIVASEGVGSLFKGCGANILRSVAGAGVI 291

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/193 (22%), Positives = 76/193 (39%), Gaps = 26/193 (13%)

Query: 8   FIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGV-AYNGVIDCLGQIVKREGF 66
           F     SG AAG   LL +Y LD  +TR+     S    G   +NG+ D   + +K +G 
Sbjct: 116 FAGNLASGGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGI 175

Query: 67  SRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACV 126
           + LY+G    ++     R   F   DS + +   L G    +   S L G +     +  
Sbjct: 176 AGLYRGFMPSVVGIVVYRGLYFGMFDSLKPLV--LTGSLDGSFLASFLLGWVVTTGASTC 233

Query: 127 IVPFELVKIRL-----------------------QDVNSKFNGPMEVVFKTIRETGILSL 163
             P + V+ R+                       + V S F G    + +++   G++S+
Sbjct: 234 SYPLDTVRRRMMMTSGQAVKYNGAIDCLKKIVASEGVGSLFKGCGANILRSVAGAGVISM 293

Query: 164 YNGLESTMWRNAF 176
           Y+ L+  ++   F
Sbjct: 294 YDQLQMILFGKKF 306

>Scas_709.9
          Length = 365

 Score = 71.2 bits (173), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 87/319 (27%), Positives = 127/319 (39%), Gaps = 59/319 (18%)

Query: 13  VSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKG 72
           +SGA AG    +++ PLDV KTR+Q Q G  +     Y GV+  +  IV  EG   LYKG
Sbjct: 69  LSGALAGFLSGIIVCPLDVTKTRLQAQ-GIQSIENPYYRGVLGTMSTIVVDEGVRGLYKG 127

Query: 73  ISSPMLMEAPKRATKFACNDSYQKMFKDLY-----GVDKLTQQISILSGSLAGVTEACVI 127
           +   +L   P     F    S  +  KDLY       D ++   S ++   AG     + 
Sbjct: 128 LIPIILGYFPTWMIYF----SVYEFAKDLYPRVLPNSDFISHSCSAIT---AGAASTVLT 180

Query: 128 VPFELVKIRLQ------DVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGY 181
            P  +VK RL       +  + + G ++   K I + G+ +LY GL  +M+       G 
Sbjct: 181 NPIWVVKTRLMLQTPLGESRTHYRGTIDAFKKIITQEGVRTLYTGLVPSMF-------GL 233

Query: 182 FGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLA- 240
             V               EK  N L   TI G    S EH+ L + +  I S A+  LA 
Sbjct: 234 LHVAIHFPVY--------EKLKNRLHCDTITG-GHNSQEHS-LHLTRLIIASSASKMLAS 283

Query: 241 -----------------DGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGG 283
                            D  ++ K+      + + Y  EG    Y GF   +LR  P   
Sbjct: 284 ILTYPHEILRTRMQLKSDKLLISKHKL-LDLIKRTYRYEGLLGFYSGFATNLLRTVPASA 342

Query: 284 IMLVVF----NGMMAFFQE 298
           I LV F    N ++   Q+
Sbjct: 343 ITLVSFEYFRNALLKINQD 361

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 85/181 (46%), Gaps = 21/181 (11%)

Query: 8   FIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFS 67
           FI    S   AG +  ++  P+ VVKTR+ LQ   G  S   Y G ID   +I+ +EG  
Sbjct: 162 FISHSCSAITAGAASTVLTNPIWVVKTRLMLQTPLGE-SRTHYRGTIDAFKKIITQEGVR 220

Query: 68  RLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLT-----QQIS------ILSG 116
            LY G+  P +      A  F     Y+K+ K+    D +T     Q+ S      I++ 
Sbjct: 221 TLYTGL-VPSMFGLLHVAIHFPV---YEKL-KNRLHCDTITGGHNSQEHSLHLTRLIIAS 275

Query: 117 SLAGVTEACVIVPFELVKIRLQDVNSKF----NGPMEVVFKTIRETGILSLYNGLESTMW 172
           S + +  + +  P E+++ R+Q  + K     +  ++++ +T R  G+L  Y+G  + + 
Sbjct: 276 SASKMLASILTYPHEILRTRMQLKSDKLLISKHKLLDLIKRTYRYEGLLGFYSGFATNLL 335

Query: 173 R 173
           R
Sbjct: 336 R 336

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 77/179 (43%), Gaps = 20/179 (11%)

Query: 110 QISILSGSLAGVTEACVIVPFELVKIRLQDV------NSKFNGPMEVVFKTIRETGILSL 163
           +I+ LSG+LAG     ++ P ++ K RLQ        N  + G +  +   + + G+  L
Sbjct: 65  KITALSGALAGFLSGIIVCPLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIVVDEGVRGL 124

Query: 164 YNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTI 223
           Y GL   +         YF V    + L P+   N++  ++   A T G         T+
Sbjct: 125 YKGLIPIILGYFPTWMIYFSVYEFAKDLYPRVLPNSDFISHSCSAITAGAAS------TV 178

Query: 224 LS----VVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRL 278
           L+    VVK+R+     T L +      Y  T  +  KI ++EG   LY G +P +  L
Sbjct: 179 LTNPIWVVKTRLM--LQTPLGESRT--HYRGTIDAFKKIITQEGVRTLYTGLVPSMFGL 233

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score = 70.5 bits (171), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 71/301 (23%), Positives = 122/301 (40%), Gaps = 36/301 (11%)

Query: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR 68
           I   ++G+ AG    ++ +P D VK R+Q Q  +       +     C+    + EG +R
Sbjct: 14  ILDIINGSIAGACGKVIEFPFDTVKVRLQTQASN------VFPTTWSCIKFTYQNEGIAR 67

Query: 69  -LYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVI 127
             ++GI+SP++    + AT F   +   K  +    V  L Q   ++SG +AG   + V+
Sbjct: 68  GFFQGIASPLVGACLENATLFVSYNQCSKFLEKHTNVFPLGQ--ILISGGVAGSCASLVL 125

Query: 128 VPFELVKIRLQDVN-------SKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGG 180
            P ELVK +LQ  N       +K    +  +   I E G+  L+ G   T  R +F    
Sbjct: 126 TPVELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFIRESFGGVA 185

Query: 181 YFGVI------FQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSG 234
           +F          + R  L   K +  K    LI+G   G   ++        VKS +Q+ 
Sbjct: 186 WFATYEIVKKSLKDRHSLDDPKRDESKIWELLISGGSAGLA-FNASIFPADTVKSVMQT- 243

Query: 235 ATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMA 294
              +L +            ++ KI+ + G    Y+G    + R  P    +  +F  + A
Sbjct: 244 EHISLTN------------AVKKIFGKFGLKGFYRGLGITLFRAVPANAAVFYIFETLSA 291

Query: 295 F 295
            
Sbjct: 292 L 292

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score = 70.5 bits (171), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 81/304 (26%), Positives = 127/304 (41%), Gaps = 33/304 (10%)

Query: 1   MSEKPLP---FIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQ---VGSGTGSGVAYNGVI 54
           MSE   P   F   F+ G  +         P++ VK  +Q Q   +  G+     Y G++
Sbjct: 1   MSETKKPQSNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDH-RYKGIV 59

Query: 55  DCLGQIVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKM--FKDLYGVDKLTQQIS 112
           DC  +  ++EG    ++G ++ ++   P +A  FA  D  + M  FK   G  K     +
Sbjct: 60  DCFQRTARQEGIISFWRGNTANVIRYFPTQALNFAFKDQIKAMFGFKKEEGYAKWFAG-N 118

Query: 113 ILSGSLAGVTEACVIVPFELVKIRL-QDVNS-------KFNGPMEVVFKTIRETGILSLY 164
           + SG +AG      +   +  + RL  D  S       +FNG ++V  KTI   G+  LY
Sbjct: 119 LASGGIAGGLSLMFVYSLDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDGVAGLY 178

Query: 165 NGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYC---RYSTEH 221
            G   ++     + G YFG+    + LL      T       IA  + G+      ST  
Sbjct: 179 RGFLPSVIGIVVYRGLYFGLYDSCKPLLL-----TGSLEGSFIASFLLGWVVTTGASTAS 233

Query: 222 TILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPG 281
             L  V+ R+       +  G  V KY      L KI + EG ++L+KG    ILR   G
Sbjct: 234 YPLDTVRRRMM------MTSGQAV-KYKGAMDCLQKIVAAEGVSSLFKGCGANILRGVAG 286

Query: 282 GGIM 285
            G++
Sbjct: 287 AGVI 290

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 76/193 (39%), Gaps = 26/193 (13%)

Query: 8   FIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSG-VAYNGVIDCLGQIVKREGF 66
           F     SG  AG   L+ +Y LD  +TR+     S    G   +NG++D   + +  +G 
Sbjct: 115 FAGNLASGGIAGGLSLMFVYSLDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDGV 174

Query: 67  SRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACV 126
           + LY+G    ++     R   F   DS + +   L G  + +   S L G +     +  
Sbjct: 175 AGLYRGFLPSVIGIVVYRGLYFGLYDSCKPLL--LTGSLEGSFIASFLLGWVVTTGASTA 232

Query: 127 IVPFELVKIRL-----------------------QDVNSKFNGPMEVVFKTIRETGILSL 163
             P + V+ R+                       + V+S F G    + + +   G++SL
Sbjct: 233 SYPLDTVRRRMMMTSGQAVKYKGAMDCLQKIVAAEGVSSLFKGCGANILRGVAGAGVISL 292

Query: 164 YNGLESTMWRNAF 176
           Y+ L+  ++   F
Sbjct: 293 YDQLQMILFGKKF 305

>Scas_379.2
          Length = 301

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 66/291 (22%), Positives = 125/291 (42%), Gaps = 14/291 (4%)

Query: 7   PFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGF 66
           P  +Q ++GA AG+ E  VM+P+D +KTR+Q      + S  + + ++  + +I   EG 
Sbjct: 22  PLSHQLLAGAFAGIMEHSVMFPIDALKTRIQ------STSAKSTSNMLSQMAKISTAEGS 75

Query: 67  SRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACV 126
             L+KG+ S +L   P  A  FA  +  +K   D   +       + LSG++A +    +
Sbjct: 76  LALWKGVQSVILGAGPAHAVYFATYEYTKKYLIDEKDMQTHQPLKTALSGTVATIAADAL 135

Query: 127 IVPFELVKIRLQ-DVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVI 185
           + PF+ +K R+Q + N+      + ++K     G  + Y    +T+  N  +    F +I
Sbjct: 136 MNPFDTLKQRMQLNTNTTVWNVTKQIYK---NEGFSAFYYSYPTTLAMNIPFAAFNF-MI 191

Query: 186 FQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVV 245
           ++          +     + L  G  G  C   T  T L  +K+ +Q   + +++   V+
Sbjct: 192 YESATKFFNPTNDYNPLVHCLSGGLSGATCAAIT--TPLDCIKTVLQVRGSESVS-LQVM 248

Query: 246 PKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFF 296
            + N    +   IY   G    ++G  P++    P   I    +     F 
Sbjct: 249 KEANTFQKATKAIYQVHGAKGFWRGLQPRVFANMPATAIAWTAYECAKHFL 299

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 69.3 bits (168), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 78/300 (26%), Positives = 127/300 (42%), Gaps = 57/300 (19%)

Query: 8   FIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFS 67
           F+    SGAAAG S  L  +P+D +KTR+Q +       G   NG            G+ 
Sbjct: 6   FLVSLASGAAAGTSTDLAFFPIDTLKTRLQAK------GGFFANG------------GYK 47

Query: 68  RLYKGISSPMLMEAPKRATKFACNDS---YQK--MFKDLYGVDKLTQQISILSGSLAGVT 122
            +Y+G+ S ++  AP  +  F   DS   Y K  + K +   +++   +S +  S  G  
Sbjct: 48  GVYRGLGSAVIASAPSASLFFVSYDSMKVYSKPVISKYVTSNNQMADTLSHMFSSSIGEV 107

Query: 123 EACVI-VPFELVKIRLQ--DVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNG 179
            AC++ VP E++K R Q    NS +    +++     E  + +LY G  +T+ R      
Sbjct: 108 SACLVRVPAEVIKQRTQTHKTNSSWQTFTKILQNENGEGVLRNLYRGWNTTIMREI---- 163

Query: 180 GYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYC------RYSTEHTILSVVKSRI-- 231
            +  + F +   L   KT  ++   D +A   G  C        +   T L V+K+R+  
Sbjct: 164 PFTCIQFPLYEFL--KKTWAKRNGQDHVAPWQGSVCGSVAGAIAAATTTPLDVLKTRLML 221

Query: 232 --QSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVF 289
             +S     LA                 IY+EEGF   + G  P+ + +  GG I L V+
Sbjct: 222 SHKSIPVAQLAK---------------NIYAEEGFKVFFSGVGPRTMWISAGGAIFLGVY 266

 Score = 28.9 bits (63), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 73/182 (40%), Gaps = 23/182 (12%)

Query: 104 VDKLTQQISILSGSLAGVTEACVIVPFELVKIRLQDVNSKF-NGPMEVVFKTIRETGILS 162
           +D  +  +S+ SG+ AG +      P + +K RLQ     F NG            G   
Sbjct: 1   MDSSSFLVSLASGAAAGTSTDLAFFPIDTLKTRLQAKGGFFANG------------GYKG 48

Query: 163 LYNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHT 222
           +Y GL S +  +A  +   F V +    +  K   +   T+N+ +A T+     +S+   
Sbjct: 49  VYRGLGSAVIASAP-SASLFFVSYDSMKVYSKPVISKYVTSNNQMADTLSHM--FSSSIG 105

Query: 223 ILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEG----FTALYKGFIPKILRL 278
            +S    R+ +     +   T   K N +W +  KI   E        LY+G+   I+R 
Sbjct: 106 EVSACLVRVPA---EVIKQRTQTHKTNSSWQTFTKILQNENGEGVLRNLYRGWNTTIMRE 162

Query: 279 GP 280
            P
Sbjct: 163 IP 164

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 68.9 bits (167), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 72/299 (24%), Positives = 132/299 (44%), Gaps = 42/299 (14%)

Query: 8   FIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFS 67
           F+   VSGAAAG S  +V +P+D +KTR+Q +       G  +NG            G+ 
Sbjct: 5   FLASLVSGAAAGTSTDVVFFPIDTLKTRLQAK------GGFFHNG------------GYR 46

Query: 68  RLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQIS-----ILSGSLAGVT 122
            +Y+G+ S ++  AP  +  F   DS ++  + + G    ++Q++     +LS SL  ++
Sbjct: 47  GIYRGLGSAVVASAPGASLFFVTYDSMKQQLRPVMGRWTASEQLAEVLTHMLSSSLGEMS 106

Query: 123 EACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYF 182
              V VP E++K R Q  ++  N  ++ +   +R+     +  GL    W        + 
Sbjct: 107 ACLVRVPAEVIKQRTQTHHT--NSSLQTLRLILRDPTGEGVVRGLYRGWWTTIMREIPFT 164

Query: 183 GVIFQIRALLPK---AKTNTEKTT--NDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATT 237
            + F +   L K   A    E+ +     + G++ G    +     L V+K+R+      
Sbjct: 165 CIQFPLYEYLKKKWAAYAEIERVSAWQGAVCGSLAGGIAAAATTP-LDVLKTRM------ 217

Query: 238 TLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFF 296
            +     VP  +    +LF+   EEG    ++G  P+ + +  GG I L V+  + + F
Sbjct: 218 -MLHERRVPMLHLA-RTLFR---EEGARVFFRGIGPRTMWISAGGAIFLGVYEAVHSLF 271

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 84/313 (26%), Positives = 134/313 (42%), Gaps = 43/313 (13%)

Query: 2   SEKPL--PFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQ 59
           S KP   PF + F++G+ AG  E  + YP +  KTR+QL       S  + N ++  +  
Sbjct: 83  SNKPAVDPF-HSFLAGSIAGAIEASITYPFEFAKTRLQL---VDKASKASRNPLV-LIYN 137

Query: 60  IVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQIS----ILS 115
             K  G S +Y G  + ++    K   +F   D+ + + +     DK T ++S    +++
Sbjct: 138 TGKNYGISSIYVGCPAFIVGNTAKAGIRFLGFDTIKNLLR-----DKKTGELSGFRGVVA 192

Query: 116 GSLAGVTEACVIV-PFELVKIRLQD--------VNSKFNGPMEVVFKTIRETGILSLYNG 166
           G  AG+ E+ V V PFE +K  L D          +   G +    K + + G   LY G
Sbjct: 193 GLGAGLLESVVAVTPFEAIKTALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSGLYRG 252

Query: 167 LESTMWRNAFWNGGYFGVIFQIRAL------LPKAKTNTEKTTNDLIAGTIGGYCRYSTE 220
           +     R A       G   +I+ L      +PK K  +   T   I G   G     T 
Sbjct: 253 VLPVSMRQAANQAVRLGCYNKIKTLVQDYTNVPKDKPLSSGLT--FIVGAFSGIVTVYTT 310

Query: 221 HTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGP 280
             I   VK+R+QS     L  G    +Y+ T      I+ EEG    +KG  P++ RL  
Sbjct: 311 MPI-DTVKTRMQS-----LNAG----QYSSTINCFATIFKEEGLKTFWKGATPRLGRLIL 360

Query: 281 GGGIMLVVFNGMM 293
            GGI+  ++  ++
Sbjct: 361 SGGIVFTIYEKVL 373

 Score = 65.5 bits (158), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 85/196 (43%), Gaps = 17/196 (8%)

Query: 112 SILSGSLAGVTEACVIVPFELVKIRLQ--DVNSKFN-GPMEVVFKTIRETGILSLYNGLE 168
           S L+GS+AG  EA +  PFE  K RLQ  D  SK +  P+ +++ T +  GI S+Y G  
Sbjct: 93  SFLAGSIAGAIEASITYPFEFAKTRLQLVDKASKASRNPLVLIYNTGKNYGISSIYVGCP 152

Query: 169 STMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVK 228
           + +  N    G  F     I+ LL   KT        ++AG   G        T    +K
Sbjct: 153 AFIVGNTAKAGIRFLGFDTIKNLLRDKKTGELSGFRGVVAGLGAGLLESVVAVTPFEAIK 212

Query: 229 SRIQSGATTTLADG--TVVPKYNWTWPSLF----KIYSEEGFTALYKGFIPKILRLGPGG 282
                   T L D     VPKY      +     K+ S++GF+ LY+G +P  +R     
Sbjct: 213 --------TALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSGLYRGVLPVSMRQAANQ 264

Query: 283 GIMLVVFNGMMAFFQE 298
            + L  +N +    Q+
Sbjct: 265 AVRLGCYNKIKTLVQD 280

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/189 (21%), Positives = 90/189 (47%), Gaps = 12/189 (6%)

Query: 13  VSGAAAGVSELLV-MYPLDVVKTRM----QLQVGSGTGSGVAYNGVIDCLGQIVKREGFS 67
           V+G  AG+ E +V + P + +KT +    Q  V     +G    G++    +++  +GFS
Sbjct: 191 VAGLGAGLLESVVAVTPFEAIKTALIDDKQAAVPKYQNNG---KGMVSNYAKLLSDQGFS 247

Query: 68  RLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDK---LTQQISILSGSLAGVTEA 124
            LY+G+    + +A  +A +  C +  + + +D   V K   L+  ++ + G+ +G+   
Sbjct: 248 GLYRGVLPVSMRQAANQAVRLGCYNKIKTLVQDYTNVPKDKPLSSGLTFIVGAFSGIVTV 307

Query: 125 CVIVPFELVKIRLQDVNS-KFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFG 183
              +P + VK R+Q +N+ +++  +       +E G+ + + G    + R     G  F 
Sbjct: 308 YTTMPIDTVKTRMQSLNAGQYSSTINCFATIFKEEGLKTFWKGATPRLGRLILSGGIVFT 367

Query: 184 VIFQIRALL 192
           +  ++  +L
Sbjct: 368 IYEKVLTVL 376

>Scas_721.27
          Length = 374

 Score = 69.7 bits (169), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 73/325 (22%), Positives = 132/325 (40%), Gaps = 58/325 (17%)

Query: 7   PFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQV---------------------GSGTG 45
           P+++ FV+G   G++  +V  P D+VKTR+Q  +                      S   
Sbjct: 52  PWVH-FVAGGIGGMAGAVVTCPFDLVKTRLQSDIYQSVYKSKAATVTAAHNSKIANSLVQ 110

Query: 46  SGVAYNGVIDCLGQIVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVD 105
           +G  +      LG + KREGF  L+KG+   ++   P R+  F    + ++++   +   
Sbjct: 111 AGTHFKETFGILGNVYKREGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKAFNNG 170

Query: 106 KLTQQISILSGSLAGVTEACVIVPFELVKIRLQ----DVNSKFNGPMEVVFKTIRETGIL 161
           + T  I ++S + AG   +    P  ++K R+Q        K+    + +   ++  GI 
Sbjct: 171 QETPLIHLMSAATAGWATSTATNPIWMIKTRVQLDKAGTTRKYKNSWDCLKTVLKSEGIY 230

Query: 162 SLYNGLEST---------MW-----------RNAFWNGGYFGVIFQIRALLPKAKTNTEK 201
            LY GL ++          W           + +    G+ G + + R    K K   ++
Sbjct: 231 GLYRGLSASYLGSIEGILQWLLYEQMKHLIKQRSIEKFGHEGQLTKSRT--EKIKEWCQR 288

Query: 202 TTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSE 261
           + +  +A  I     Y  E     VV++R++      + +G   PKY     S   I  E
Sbjct: 289 SGSAGVAKFIASIVTYPHE-----VVRTRLRQ---MPMENGK--PKYTGLVQSFRVIIKE 338

Query: 262 EGFTALYKGFIPKILRLGPGGGIML 286
           EG  ++Y G  P ++R  P   IM 
Sbjct: 339 EGLASMYSGLTPHLMRTVPNSIIMF 363

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 68.9 bits (167), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 70/291 (24%), Positives = 126/291 (43%), Gaps = 38/291 (13%)

Query: 8   FIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFS 67
           F+   +SGAAAG S  LV +P+D +KTR+Q +                  G   +  G+ 
Sbjct: 5   FLISLLSGAAAGTSTDLVFFPIDTLKTRLQAK------------------GGFFRNGGYR 46

Query: 68  RLYKGISSPMLMEAPKRATKF----ACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTE 123
            +Y+G+ S ++  AP  +  F     C    +  F+ L     +   ++ +  S  G   
Sbjct: 47  GVYRGLGSAVVASAPGASLFFITYDTCKAETRGFFRGLLPSSNVADVVTHMFSSSMGEIA 106

Query: 124 ACVI-VPFELVKIRLQD--VNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGG 180
           AC++ VP E+VK R Q    +S +    E++     E    +LY G  +T+ R   +   
Sbjct: 107 ACMVRVPAEVVKQRSQTHASHSSWETLREILKNENGEGVRRNLYRGWSTTIMREIPFTCI 166

Query: 181 YFGVIFQIRALLPK-AKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTL 239
            F +   ++ +  +  +++  +     + G+I G    +T  T L  +K+R+      ++
Sbjct: 167 QFPLYEYMKKVWAELDESDRVEPWKGAVCGSIAGGIAAATT-TPLDFLKTRLML-CKKSI 224

Query: 240 ADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFN 290
             GT+V            IY EEGF   + G  P+ + +  GG I L ++ 
Sbjct: 225 PLGTLVS----------TIYKEEGFKVFFSGVGPRTMWISAGGAIFLGIYE 265

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 69.3 bits (168), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 68/263 (25%), Positives = 113/263 (42%), Gaps = 35/263 (13%)

Query: 50  YNGVIDCLGQIVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQ 109
           +NG ++   +I K EG + L++GIS  +LM  P     F     Y+ + +D   ++ L  
Sbjct: 110 FNGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFT---GYEYV-RDRSPLNGLYP 165

Query: 110 QIS-ILSGSLAGVTEACVIVPFELVKIRLQDV--NSKFNGPM------------EVVFKT 154
            I+ ++ G+ A    A  + P EL+K +LQ +  +S  NG +            E+  + 
Sbjct: 166 TINPLICGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSEIAMRG 225

Query: 155 IRETGILSLYNGLESTMWRNAFWNGGYFG--------VIFQIRALLPKAKTNTEKTTNDL 206
           + +T    ++ GLE T+WR+  ++  Y+         V +   +   K  +N    TN  
Sbjct: 226 VAQT----MFKGLEITLWRDVPFSAIYWASYEFYKTKVAYLSPSTFDKNSSNWFHFTNSF 281

Query: 207 IAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKY---NWTWPSLFKIYSEEG 263
           + G I G       H    V K+R Q    T         KY   N  +  L  I   EG
Sbjct: 282 LGGFISGSLAAICTHP-FDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIRKTEG 340

Query: 264 FTALYKGFIPKILRLGPGGGIML 286
             ALY G  P++ ++ P   IM+
Sbjct: 341 IGALYTGLAPRVAKIAPSCAIMI 363

 Score = 34.7 bits (78), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 49/105 (46%), Gaps = 3/105 (2%)

Query: 141 NSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTE 200
           N KFNG +E   K  +  G+ +L+ G+  T+      N  YF     +R   P       
Sbjct: 107 NQKFNGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFTGYEYVRDRSP--LNGLY 164

Query: 201 KTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVV 245
            T N LI G        +T    L ++K+++QS  ++++ +G+V+
Sbjct: 165 PTINPLICGAFARTLA-ATSVAPLELIKTKLQSIPSSSMKNGSVI 208

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 45/97 (46%), Gaps = 10/97 (10%)

Query: 8   FIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSG---TGSGVAY---NGVIDCLGQIV 61
           F+  F+SG+ A +      +P DV KTR Q+ + +      S + Y   N +   L  I 
Sbjct: 281 FLGGFISGSLAAI----CTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIR 336

Query: 62  KREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMF 98
           K EG   LY G++  +   AP  A   +  +  +++F
Sbjct: 337 KTEGIGALYTGLAPRVAKIAPSCAIMISSYELTKRLF 373

 Score = 32.7 bits (73), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 79/185 (42%), Gaps = 25/185 (13%)

Query: 7   PFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSG--TGSGVAYNGVIDCLGQIVKRE 64
           P I   + GA A       + PL+++KT++Q    S    GS + Y  + + +   +   
Sbjct: 165 PTINPLICGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSEIAMR 224

Query: 65  GFSR-LYKGISSPMLMEAPKRATKFACNDSYQKMFKDL--YGVDKLTQQI-----SILSG 116
           G ++ ++KG+   +  + P  A  +A  + Y+     L     DK +        S L G
Sbjct: 225 GVAQTMFKGLEITLWRDVPFSAIYWASYEFYKTKVAYLSPSTFDKNSSNWFHFTNSFLGG 284

Query: 117 SLAGVTEACVIVPFELVKIRLQ----------DVNSKFNGPMEVVF---KTIRET-GILS 162
            ++G   A    PF++ K R Q          + N K+ G    +F     IR+T GI +
Sbjct: 285 FISGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKY-GSSNTMFGFLNYIRKTEGIGA 343

Query: 163 LYNGL 167
           LY GL
Sbjct: 344 LYTGL 348

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score = 68.9 bits (167), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 57/200 (28%), Positives = 93/200 (46%), Gaps = 19/200 (9%)

Query: 25  VMYPLDVVKTRMQLQVGSGTGSGVAYN-GVIDCLGQIVKREGFSRLYKGISSPMLMEAPK 83
            M P+DVVKTR+QL+          YN G+I    QI+  EG   L  G    +L  + +
Sbjct: 30  AMVPIDVVKTRIQLEP-------TVYNKGMISSFKQIISSEGAGALLTGFGPTLLGYSLQ 82

Query: 84  RATKFACNDSYQKMFKDLYGVDKLT---QQISILSGSLAGVTEACVIVPFELVKIRLQDV 140
            + KF   + ++K+F D+ G D+       I I S ++A       + P E  +IRL   
Sbjct: 83  GSFKFGGYEVFKKLFIDVLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRIRLVSQ 142

Query: 141 NSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRALL------PK 194
            +  NG +    + ++E G  S YNG    +++   +N   F ++F+  A +      PK
Sbjct: 143 PTFANGLVGGFSRILKEEGAGSFYNGFTPILFKQIPYNIAKF-LVFERAAEVYFGMAGPK 201

Query: 195 AKTNTEKTTN-DLIAGTIGG 213
              +T  TT  +L++G   G
Sbjct: 202 ESLSTASTTGINLLSGLTAG 221

 Score = 32.7 bits (73), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 73/174 (41%), Gaps = 20/174 (11%)

Query: 114 LSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKT-IRETGILSLYNGLESTM- 171
           L+G++   T    +VP ++VK R+Q   + +N  M   FK  I   G  +L  G   T+ 
Sbjct: 18  LAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAGALLTGFGPTLL 77

Query: 172 ---WRNAFWNGGY--FGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSV 226
               + +F  GGY  F  +F I  L      N +   N +  G+      +  +  +  +
Sbjct: 78  GYSLQGSFKFGGYEVFKKLF-IDVLGYDQAVNYK---NSIYIGS-AAIAEFFADIALCPL 132

Query: 227 VKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGP 280
             +RI+  +  T A+G V            +I  EEG  + Y GF P + +  P
Sbjct: 133 EATRIRLVSQPTFANGLV--------GGFSRILKEEGAGSFYNGFTPILFKQIP 178

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 68.6 bits (166), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 66/296 (22%), Positives = 126/296 (42%), Gaps = 22/296 (7%)

Query: 7   PFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGF 66
           P  +Q ++GA AG+ E  VM+P+D +KTR+Q    S     ++   ++  +  I   EG 
Sbjct: 32  PLYHQLIAGAFAGIMEHSVMFPIDALKTRIQ----SANAKSLSAKNMLSQISHISTSEGT 87

Query: 67  SRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACV 126
             L+KG+ S +L   P  A  F   +  +K   D           + +SG+ A      +
Sbjct: 88  LALWKGVQSVILGAGPAHAVYFGTYEFCKKNLIDSSDTQTHHPFKTAISGACATTASDAL 147

Query: 127 IVPFELVKIRLQDVNSKFNGPMEVVFKTIRE----TGILSLYNGLESTMWRNAFWNGGYF 182
           + PF+ +K R+Q +N+  +     V++T ++     G+ + Y    +T+  N  +    F
Sbjct: 148 MNPFDTIKQRIQ-LNTSAS-----VWQTTKQIYQSEGLAAFYYSYPTTLVMNIPFAAFNF 201

Query: 183 GVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKS--RIQSGATTTLA 240
            VI++                + L     G  C   T  T L  +K+  +I+   T +L 
Sbjct: 202 -VIYESSTKFLNPSNEYNPLIHCLCGSISGSTCAAIT--TPLDCIKTVLQIRGSQTVSLE 258

Query: 241 DGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFF 296
                  ++    +++++Y  +GF   ++G+ P+I+   P   I    +     F 
Sbjct: 259 IMRKADTFSKAASAIYQVYGWKGF---WRGWKPRIVANMPATAISWTAYECAKHFL 311

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score = 68.9 bits (167), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 71/291 (24%), Positives = 129/291 (44%), Gaps = 27/291 (9%)

Query: 13  VSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKG 72
           VSGA AG    +++ PLDV KTR+Q Q G+G+G    Y G++  L  I++ EG + LYKG
Sbjct: 89  VSGALAGFVSGIMVCPLDVAKTRLQAQ-GAGSGERY-YRGIVGTLSAILRDEGVAGLYKG 146

Query: 73  ISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIVPFEL 132
           ++  +L   P     F+  +  ++ +        ++   S L+   AG     +  P  +
Sbjct: 147 LAPIVLGYFPTWMLYFSVYEKCKQRYPSYLPGGFVSHAASALT---AGAISTALTNPIWV 203

Query: 133 VKIRL---QDV---NSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVIF 186
           VK RL    DV   ++ +   ++   K  R  G+   Y+GL  +++   F    +F V  
Sbjct: 204 VKTRLMIQSDVSRDSTNYRSTLDAFRKMYRSEGLKVFYSGLVPSLF-GLFHVAIHFPVYE 262

Query: 187 QIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATT---TLADGT 243
           +++  L +     +    D        + +   +  I++   S++ +   T    +    
Sbjct: 263 KLKIWLHRNTPAADGQRLD--------HNKLQLDRLIVASCLSKVVASVITYPHEILRTR 314

Query: 244 VVPKYNWTWPSLF----KIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFN 290
           +  +++   PSL     +I + EG+   Y GF   ++R  P   I LV F 
Sbjct: 315 MQVRHSGVPPSLLNLLGRIRASEGYVGFYSGFATNLVRTVPASVITLVSFE 365

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 75/186 (40%), Gaps = 36/186 (19%)

Query: 110 QISILSGSLAGVTEACVIVPFELVKIRLQDVNS-----KFNGPMEVVFKTIRETGILSLY 164
           Q++ +SG+LAG     ++ P ++ K RLQ   +      + G +  +   +R+ G+  LY
Sbjct: 85  QVTAVSGALAGFVSGIMVCPLDVAKTRLQAQGAGSGERYYRGIVGTLSAILRDEGVAGLY 144

Query: 165 NGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTN---------TEKTTNDLIAGTIGGYC 215
            GL   +        GYF       ++  K K                + L AG I    
Sbjct: 145 KGLAPIVL-------GYFPTWMLYFSVYEKCKQRYPSYLPGGFVSHAASALTAGAI---- 193

Query: 216 RYSTEHT-ILSVVKSR--IQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFI 272
             ST  T  + VVK+R  IQS  +    D T    Y  T  +  K+Y  EG    Y G +
Sbjct: 194 --STALTNPIWVVKTRLMIQSDVSR---DST---NYRSTLDAFRKMYRSEGLKVFYSGLV 245

Query: 273 PKILRL 278
           P +  L
Sbjct: 246 PSLFGL 251

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/181 (21%), Positives = 72/181 (39%), Gaps = 21/181 (11%)

Query: 8   FIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFS 67
           F+    S   AG     +  P+ VVKTR+ +Q      S   Y   +D   ++ + EG  
Sbjct: 180 FVSHAASALTAGAISTALTNPIWVVKTRLMIQSDVSRDS-TNYRSTLDAFRKMYRSEGLK 238

Query: 68  RLYKGISSPMLMEAPKRATKFACNDSY-------------QKMFKDLYGVDKLTQQISIL 114
             Y G+  P L      A  F   +               Q++  +   +D+L     I+
Sbjct: 239 VFYSGL-VPSLFGLFHVAIHFPVYEKLKIWLHRNTPAADGQRLDHNKLQLDRL-----IV 292

Query: 115 SGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRET-GILSLYNGLESTMWR 173
           +  L+ V  + +  P E+++ R+Q  +S     +  +   IR + G +  Y+G  + + R
Sbjct: 293 ASCLSKVVASVITYPHEILRTRMQVRHSGVPPSLLNLLGRIRASEGYVGFYSGFATNLVR 352

Query: 174 N 174
            
Sbjct: 353 T 353

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/87 (22%), Positives = 43/87 (49%), Gaps = 6/87 (6%)

Query: 13  VSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKG 72
           V+   + V   ++ YP ++++TRMQ++      SGV    +++ LG+I   EG+   Y G
Sbjct: 292 VASCLSKVVASVITYPHEILRTRMQVR-----HSGVP-PSLLNLLGRIRASEGYVGFYSG 345

Query: 73  ISSPMLMEAPKRATKFACNDSYQKMFK 99
            ++ ++   P         + ++K  +
Sbjct: 346 FATNLVRTVPASVITLVSFEYFRKYLR 372

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score = 68.2 bits (165), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 125/294 (42%), Gaps = 30/294 (10%)

Query: 8   FIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQ---VGSGTGSGVAYNGVIDCLGQIVKRE 64
           F+  F+ G  +         P++ VK  +Q Q   +  GT     Y G++DC  +   +E
Sbjct: 23  FLIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMLKQGT-LDRKYAGILDCFKRTATQE 81

Query: 65  GFSRLYKGISSPMLMEAPKRATKFACNDSYQKMF--KDLYGVDKLTQQISILSGSLAGVT 122
           G    ++G ++ ++   P +A  FA  D  + MF  K   G  K     ++ SG  AG  
Sbjct: 82  GVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYAKWFAG-NLASGGAAGAL 140

Query: 123 EACVIVPFELVKIRLQ-DVNS-------KFNGPMEVVFKTIRETGILSLYNGLESTMWRN 174
               +   +  + RL  D  S       +FNG ++V  KT++  G+  LY G   ++   
Sbjct: 141 SLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGI 200

Query: 175 AFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTI---LSVVKSRI 231
             + G YFG+   ++ LL      T       +A  + G+   +   T    L  V+ R+
Sbjct: 201 VVYRGLYFGMYDSLKPLLL-----TGSLEGSFLASFLLGWVVTTGASTCSYPLDTVRRRM 255

Query: 232 QSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIM 285
                  +  G  V KY+  +  L KI + EG  +L+KG    ILR   G G++
Sbjct: 256 M------MTSGQAV-KYDGAFDCLRKIVAAEGVGSLFKGCGANILRGVAGAGVI 302

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 77/193 (39%), Gaps = 26/193 (13%)

Query: 8   FIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGV-AYNGVIDCLGQIVKREGF 66
           F     SG AAG   LL +Y LD  +TR+     S    G   +NG+ID   + +K +G 
Sbjct: 127 FAGNLASGGAAGALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGV 186

Query: 67  SRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACV 126
           + LY+G    ++     R   F   DS + +   L G  + +   S L G +     +  
Sbjct: 187 AGLYRGFLPSVVGIVVYRGLYFGMYDSLKPLL--LTGSLEGSFLASFLLGWVVTTGASTC 244

Query: 127 IVPFELVKIRL-----------------------QDVNSKFNGPMEVVFKTIRETGILSL 163
             P + V+ R+                       + V S F G    + + +   G++S+
Sbjct: 245 SYPLDTVRRRMMMTSGQAVKYDGAFDCLRKIVAAEGVGSLFKGCGANILRGVAGAGVISM 304

Query: 164 YNGLESTMWRNAF 176
           Y+ L+  ++   F
Sbjct: 305 YDQLQMILFGKKF 317

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score = 68.2 bits (165), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 65/284 (22%), Positives = 114/284 (40%), Gaps = 27/284 (9%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71
           FV+G  A    + V  P++++K RMQLQ      +   Y   I  +  I K EG   L K
Sbjct: 26  FVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQK 85

Query: 72  GISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQ-----ISILSGSLAGVTEACV 126
           G+++  + +     ++    +  +     L+  D+   +     +++ SG+ +G+  A +
Sbjct: 86  GLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFSGAASGIIGAVI 145

Query: 127 IVPFELVKIRLQDVN--------SKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWN 178
             P  LVK RLQ  +        + + G    +    +  G+  L+ G+++ + R    +
Sbjct: 146 GSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGS 205

Query: 179 GGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRI--QSGAT 236
                +    + +L K     +     L A TI G    +       V+ +RI  Q G  
Sbjct: 206 SVQLPIYNTAKNILVKNDLMKDGPALHLTASTISG-LGVAVVMNPWDVILTRIYNQKGDL 264

Query: 237 TTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGP 280
                      Y      L K    EG TALYKGF  ++ R+ P
Sbjct: 265 -----------YKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAP 297

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 52/217 (23%), Positives = 91/217 (41%), Gaps = 18/217 (8%)

Query: 88  FACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIVPFELVKIRLQ-------DV 140
            + ++S Q    +     K+++  S ++G LA      V  P EL+KIR+Q         
Sbjct: 1   MSSDNSKQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASA 60

Query: 141 NSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRALL-----PKA 195
              +  P++ +    +  GI  L  GL +        NG   G    IR+ L     P  
Sbjct: 61  AKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQ 120

Query: 196 KTNTEKTTN-DLIAGTIGGYCRYSTEHTILSVVKSRIQSGAT-TTLADGTVVPKYNWTWP 253
           + +  ++   ++ +G   G    +   + L +VK+R+QS +    + + T    Y   W 
Sbjct: 121 EPHKVQSVGVNVFSGAASGIIG-AVIGSPLFLVKTRLQSYSEFIKIGEQT---HYTGVWN 176

Query: 254 SLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFN 290
            L  I+  EG   L++G    ILR G G  + L ++N
Sbjct: 177 GLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYN 213

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score = 67.8 bits (164), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 73/303 (24%), Positives = 121/303 (39%), Gaps = 37/303 (12%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYN-GVIDCLGQIVKREGFSRLY 70
           F++G  AG     V+ P + VK  +Q+Q      S  AYN G+ D +GQ+ K E    L+
Sbjct: 27  FLAGGIAGAISRTVVSPFERVKILLQVQ-----SSTTAYNKGLFDAIGQVYKEENIKGLF 81

Query: 71  KGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVD------KLTQQISILSGSLAGVTEA 124
           +G     +   P  A +F     ++   K ++ VD      +L     + SG+L G    
Sbjct: 82  RGNGLNCIRVFPYSAVQFVV---FEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSV 138

Query: 125 CVIVPFELVKIRL--QDVN------------SKFNGPMEVVFKT-IRETGILSLYNGLES 169
               P +LV+ RL  Q  N            +K  G  +++ K    E GI+ LY G+  
Sbjct: 139 VATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWP 198

Query: 170 TMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIA---GTIGGYCRYSTEHTILSV 226
           T      +    F V  Q++  +P  +       + L     G I G    +  +    +
Sbjct: 199 TSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYP-FDL 257

Query: 227 VKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIML 286
           ++ R Q      +    +   YN  W +L  I   EGF   YKG    + ++ P   +  
Sbjct: 258 LRRRFQ---VLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSW 314

Query: 287 VVF 289
           +V+
Sbjct: 315 LVY 317

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 39/80 (48%)

Query: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR 68
           +Y+   GA +G     + YP D+++ R Q+    G   G  YN V D L  I K EGF  
Sbjct: 235 LYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKG 294

Query: 69  LYKGISSPMLMEAPKRATKF 88
            YKG+++ +    P  A  +
Sbjct: 295 YYKGLTANLFKVVPSTAVSW 314

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 88/203 (43%), Gaps = 15/203 (7%)

Query: 106 KLTQQISILSGSLAGVTEACVIVPFELVKI--RLQDVNSKFN-GPMEVVFKTIRETGILS 162
           K    ++ L+G +AG     V+ PFE VKI  ++Q   + +N G  + + +  +E  I  
Sbjct: 20  KQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKG 79

Query: 163 LYNGLESTMWRNAFWNGGYFGVIFQ-----IRALLPKAKTNTEKTTNDLIAGTIGGYCRY 217
           L+ G      R   ++   F V+F+     I  +  K K         L +G + G C  
Sbjct: 80  LFRGNGLNCIRVFPYSAVQF-VVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSV 138

Query: 218 STEHTILSVVKSR--IQSGATTTLAD--GTVVPKYNWTWPSLFKIYSEE-GFTALYKGFI 272
              +  L +V++R  +Q+   + L+    + + K    W  L K Y+EE G   LY+G  
Sbjct: 139 VATYP-LDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVW 197

Query: 273 PKILRLGPGGGIMLVVFNGMMAF 295
           P  L + P   +   V+  +  F
Sbjct: 198 PTSLGIVPYVALNFAVYEQLKEF 220

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 68.2 bits (165), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 72/288 (25%), Positives = 121/288 (42%), Gaps = 33/288 (11%)

Query: 25  VMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR-LYKGISSPMLMEAPK 83
            M+ LD VKTR Q     G  S V Y  +I     I+  EG  + LY G S  ML   P 
Sbjct: 72  AMHSLDTVKTRQQ-----GAPSTVKYKNMIGAYRTIILEEGLRKGLYGGYSGAMLGSFPS 126

Query: 84  RATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIVPFELVKIRLQDVNSK 143
            A  FA  +  ++     +G+++    ++  +G L     + V VP E++K RLQ +  +
Sbjct: 127 AAIFFATYEYTKRKMIGEWGINETFSHLT--AGFLGDFISSFVYVPSEVLKTRLQ-LQGR 183

Query: 144 FNGPM-----------EVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRALL 192
           +N P            + V   +R  G  +L+ G ++T+ R+  ++G  F    + R L 
Sbjct: 184 YNNPFFRSGYNYKNLTDAVTTIVRREGWPTLFFGYKATLSRDLPFSGLQFAFYEKFRQLA 243

Query: 193 PKAKTNT---EKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQS-------GATTTLADG 242
              +  T   + + ++ I              T L VVK+RIQ+        ++  L   
Sbjct: 244 FAVENKTFDEDLSLSNEIITGAAAGGLAGIITTPLDVVKTRIQTQLPDIPENSSQNLKQQ 303

Query: 243 TVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFN 290
           T+    N     +  +Y  EG   L+ G  P+ +       IML+++ 
Sbjct: 304 TLT---NSITKGMMTVYKTEGLAGLFSGVGPRFIWTSIQSSIMLLLYQ 348

 Score = 28.5 bits (62), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 26/57 (45%), Gaps = 7/57 (12%)

Query: 24  LVMYPLDVVKTRMQLQV-------GSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGI 73
           ++  PLDVVKTR+Q Q+                 N +   +  + K EG + L+ G+
Sbjct: 273 IITTPLDVVKTRIQTQLPDIPENSSQNLKQQTLTNSITKGMMTVYKTEGLAGLFSGV 329

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score = 67.4 bits (163), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 66/286 (23%), Positives = 113/286 (39%), Gaps = 31/286 (10%)

Query: 15  GAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR-LYKGI 73
           G+ AG    ++ YP D VK R+Q Q          +     C+      EG  R  Y+GI
Sbjct: 13  GSIAGAVGKVIEYPFDTVKVRLQTQPAH------MFPTTWSCIKFTYDNEGLWRGFYQGI 66

Query: 74  SSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQIS--ILSGSLAGVTEACVIVPFE 131
            SP+   A + A  F    S+ +  K L  V+ L   +S  + +G+ AG   + V+ P E
Sbjct: 67  GSPLAGAALENAVLFV---SFNQA-KRLLDVESLLSPLSKTVWAGAFAGACASFVLTPVE 122

Query: 132 LVKIRLQDVN-----SKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVIF 186
           L+K +LQ  N     +     +  +   + E G L L+ G   T  R +     +F    
Sbjct: 123 LIKCKLQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAAWFTTYE 182

Query: 187 QIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVP 246
            ++  L   +   + TT +L+A        ++        +KS +Q+     L+  T   
Sbjct: 183 VVKNYLASRRQAEQNTTWELLASGASAGLAFNASIFPADTIKSTMQTD-HIDLSSATR-- 239

Query: 247 KYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGM 292
                     KIY+ +G    Y+G    ++R  P    +   +  +
Sbjct: 240 ----------KIYARQGIAGFYRGLGITLIRAVPANAAIFYTYETL 275

 Score = 43.5 bits (101), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 72/169 (42%), Gaps = 5/169 (2%)

Query: 14  SGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGI 73
           +GA AG     V+ P++++K +  LQV + + +  ++  ++  +  ++   GF  L++G 
Sbjct: 106 AGAFAGACASFVLTPVELIKCK--LQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQ 163

Query: 74  SSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIVPFELV 133
           S   + E+   A  F   +  +         ++ T    + SG+ AG+     I P + +
Sbjct: 164 SGTFIRESGGGAAWFTTYEVVKNYLASRRQAEQNTTWELLASGASAGLAFNASIFPADTI 223

Query: 134 KIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYF 182
           K  +Q  +   +     ++      GI   Y GL  T+ R    N   F
Sbjct: 224 KSTMQTDHIDLSSATRKIYA---RQGIAGFYRGLGITLIRAVPANAAIF 269

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 75/181 (41%), Gaps = 11/181 (6%)

Query: 113 ILSGSLAGVTEACVIVPFELVKIRLQDVNSK-FNGPMEVVFKTIRETGILS-LYNGLEST 170
           IL GS+AG     +  PF+ VK+RLQ   +  F      +  T    G+    Y G+ S 
Sbjct: 10  ILYGSIAGAVGKVIEYPFDTVKVRLQTQPAHMFPTTWSCIKFTYDNEGLWRGFYQGIGSP 69

Query: 171 MWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSR 230
           +   A  N   F    Q + LL   ++     +  + AG   G C  S   T + ++K +
Sbjct: 70  LAGAALENAVLFVSFNQAKRLL-DVESLLSPLSKTVWAGAFAGACA-SFVLTPVELIKCK 127

Query: 231 IQ-SGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVF 289
           +Q S  +TT    T +       P++  + SE GF  L++G     +R   GG      +
Sbjct: 128 LQVSNLSTTKTSHTKI------LPTIKSVLSERGFLGLWQGQSGTFIRESGGGAAWFTTY 181

Query: 290 N 290
            
Sbjct: 182 E 182

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score = 67.4 bits (163), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 71/297 (23%), Positives = 122/297 (41%), Gaps = 28/297 (9%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYN-GVIDCLGQIVKREGFSRLY 70
           F++G  AG     V+ P + VK  +Q+Q      S  AYN G++  + Q+ + EG   L+
Sbjct: 26  FLAGGLAGAVSRTVVSPFERVKILLQVQ-----NSTTAYNQGIVGAVRQVYREEGTPGLF 80

Query: 71  KGISSPMLMEAPKRATKFACNDSYQKMFKDL---YGVDKLTQQISILSGSLAGVTEACVI 127
           +G     +   P  A +F   ++ +K F  +    G ++L     + SG+L G       
Sbjct: 81  RGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLAT 140

Query: 128 VPFELVKIRL--QDVN------------SKFNGPMEVVFKTIRETG-ILSLYNGLESTMW 172
            P +LV+ RL  Q  N            SK  G  +++ +T +E G I  LY G+  T  
Sbjct: 141 YPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSL 200

Query: 173 RNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQ 232
               +    F V  Q +  +P+   NT      L  G + G    +  +    +++ R Q
Sbjct: 201 GVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYP-FDLLRRRFQ 259

Query: 233 SGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVF 289
                 +    +  +Y     +L  I   EGF   YKG    + ++ P   +  +V+
Sbjct: 260 ---VLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVY 313

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 41/87 (47%)

Query: 2   SEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIV 61
           ++  L   Y+   GA +G     V YP D+++ R Q+    G   G  Y  V+D L  I 
Sbjct: 224 TDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIG 283

Query: 62  KREGFSRLYKGISSPMLMEAPKRATKF 88
           K EGF   YKG+++ +    P  A  +
Sbjct: 284 KTEGFRGYYKGLTANLFKVIPSTAVSW 310

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 61/211 (28%), Positives = 85/211 (40%), Gaps = 25/211 (11%)

Query: 106 KLTQQISILSGSLAGVTEACVIVPFELVKIRLQDVNS--KFN-GPMEVVFKTIRETGILS 162
           K    ++ L+G LAG     V+ PFE VKI LQ  NS   +N G +  V +  RE G   
Sbjct: 19  KNDSNVAFLAGGLAGAVSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPG 78

Query: 163 LY--NGLESTMWRNAFWNGGYFGVIFQIRALLPK------AKTNTEKTTN--DLIAGTIG 212
           L+  NGL      N      Y  V F +     K           E+  N   L +G + 
Sbjct: 79  LFRGNGL------NCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALC 132

Query: 213 GYCRYSTEHTILSVVKSR--IQSGATTTLADGTV--VPKYNWTWPSLFKIYSEE-GFTAL 267
           G C     +  L +V++R  IQ+   T L+      + K    W  L + Y EE G   L
Sbjct: 133 GGCSVLATYP-LDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGL 191

Query: 268 YKGFIPKILRLGPGGGIMLVVFNGMMAFFQE 298
           Y+G  P  L + P   +   V+     F  E
Sbjct: 192 YRGVWPTSLGVVPYVALNFAVYEQFKEFMPE 222

>Kwal_26.7653
          Length = 325

 Score = 67.4 bits (163), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 56/210 (26%), Positives = 85/210 (40%), Gaps = 16/210 (7%)

Query: 100 DLYGVDKLTQQISILSGSLAGVTEACVIVPFELVKIRLQ-------DVNSKFNGPMEVVF 152
           D     K+++  S ++G +A      V  P ELVK R+Q       D    +  PM+ + 
Sbjct: 15  DKPAAQKVSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALK 74

Query: 153 KTIRETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRALLPKA---KTNTEKTTN---DL 206
              +  GI  L  GL          NG   G    IR++L K      +  K  N   ++
Sbjct: 75  VIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNV 134

Query: 207 IAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTA 266
           ++G   G    +   + L ++K+R+QS +            Y   W  L  IY  EGF  
Sbjct: 135 VSGATSGIIG-AIMGSPLFLIKTRMQSYSNAIQIGQQT--HYTSIWNGLSSIYRAEGFKG 191

Query: 267 LYKGFIPKILRLGPGGGIMLVVFNGMMAFF 296
           LY+G    ILR G G  + L ++N    F 
Sbjct: 192 LYRGVDAAILRTGAGSSVQLPIYNTAKHFL 221

 Score = 66.2 bits (160), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 65/282 (23%), Positives = 115/282 (40%), Gaps = 23/282 (8%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71
           F++G  A    + V  P+++VKTRMQLQ      +   Y   +  L  I K EG   L K
Sbjct: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQK 87

Query: 72  GISSPMLMEAPKRATKFACNDSYQKMFKDLY--GVDKLTQQ---ISILSGSLAGVTEACV 126
           G+S   + +     ++    +  + +    +   +D    Q   ++++SG+ +G+  A +
Sbjct: 88  GLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIM 147

Query: 127 IVPFELVKIRLQDVNSKFNGPMEVVFKTI--------RETGILSLYNGLESTMWRNAFWN 178
             P  L+K R+Q  ++      +  + +I        R  G   LY G+++ + R    +
Sbjct: 148 GSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGS 207

Query: 179 GGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTT 238
                +    +  L K     E T   L+A T+ G+           V+ +R+ +     
Sbjct: 208 SVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFG-VGVVMNPWDVILTRVYN----- 261

Query: 239 LADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGP 280
              G +   Y        K    EG  ALYKGF  +I R+ P
Sbjct: 262 -QKGNL---YKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAP 299

>Kwal_33.15597
          Length = 305

 Score = 66.2 bits (160), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 74/158 (46%), Gaps = 11/158 (6%)

Query: 25  VMYPLDVVKTRMQLQVGSGTGSGVAYN-GVIDCLGQIVKREGFSRLYKGISSPMLMEAPK 83
            M P+DVVKTR+QL+          YN G+I    QI+  EG   L  G    +L  + +
Sbjct: 30  AMVPIDVVKTRIQLEP-------TVYNKGMISSFKQIISSEGAGALLTGFGPTLLGYSLQ 82

Query: 84  RATKFACNDSYQKMFKDLYGVDKLT---QQISILSGSLAGVTEACVIVPFELVKIRLQDV 140
            + KF   + ++K+F D  G D+       I I S ++A       + P E  +IRL   
Sbjct: 83  GSFKFGGYEVFKKLFIDTLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRIRLVSQ 142

Query: 141 NSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWN 178
            +  NG +    + ++E G+ S YNG    +++   +N
Sbjct: 143 PTFANGLVGGFSRILKEEGLSSFYNGFTPILFKQIPYN 180

 Score = 35.4 bits (80), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 74/174 (42%), Gaps = 20/174 (11%)

Query: 114 LSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKT-IRETGILSLYNGLESTM- 171
           L+G++   T    +VP ++VK R+Q   + +N  M   FK  I   G  +L  G   T+ 
Sbjct: 18  LAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAGALLTGFGPTLL 77

Query: 172 ---WRNAFWNGGY--FGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSV 226
               + +F  GGY  F  +F I  L      N +   N +  G+      +  +  +  +
Sbjct: 78  GYSLQGSFKFGGYEVFKKLF-IDTLGYDQAVNYK---NSIYIGS-AAIAEFFADIALCPL 132

Query: 227 VKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGP 280
             +RI+  +  T A+G V            +I  EEG ++ Y GF P + +  P
Sbjct: 133 EATRIRLVSQPTFANGLV--------GGFSRILKEEGLSSFYNGFTPILFKQIP 178

>Scas_718.24
          Length = 337

 Score = 66.6 bits (161), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 76/303 (25%), Positives = 128/303 (42%), Gaps = 35/303 (11%)

Query: 2   SEKPLP-FIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQ---VGSGTGSGVAYNGVIDCL 57
           +EKP   F   F+ G  +         P++ VK  +Q Q   +  GT     Y G++DC 
Sbjct: 35  TEKPQSNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQNEMLKQGT-LDTKYKGIVDCF 93

Query: 58  GQIVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMF----KDLYGVDKLTQQISI 113
            +  ++EG    ++G ++ ++   P +A  FA  D  + MF    +D YG        ++
Sbjct: 94  RRTAQQEGIISFWRGNTANVIRYFPTQALNFAFKDKIKLMFGFKKEDGYGK---WFAGNL 150

Query: 114 LSGSLAGVTEACVIVPFELVKIRL-QDVNS-------KFNGPMEVVFKTIRETGILSLYN 165
            SG  AG      +   +  + RL  D  S       +FNG ++V  KT++  G+  LY 
Sbjct: 151 ASGGAAGGLSLLFVYSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGLYR 210

Query: 166 GLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTI-- 223
           G   ++     + G YFG+   I+ +L      T       +A  + G+   +   T   
Sbjct: 211 GFLPSVVGIIVYRGLYFGLYDSIKPVLL-----TGSLEGSFLASFLLGWVVTTGASTCSY 265

Query: 224 -LSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGG 282
            L  V+ ++       +  G  V KY   +    KI + EG  +L+KG    ILR   G 
Sbjct: 266 PLDTVRRKMM------MTSGQAV-KYKGAFDCFKKIVAAEGVASLFKGCGANILRGVAGA 318

Query: 283 GIM 285
           G++
Sbjct: 319 GVI 321

>Kwal_56.23011
          Length = 303

 Score = 65.9 bits (159), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 73/294 (24%), Positives = 120/294 (40%), Gaps = 39/294 (13%)

Query: 15  GAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGIS 74
           G   GV+++LV  P D+ K R+Q      T + V        +  +VK EG    YKG  
Sbjct: 30  GTVGGVAQVLVGQPFDITKVRLQTSPVPTTAAQV--------IKSLVKNEGLLAFYKGTL 81

Query: 75  SPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISI----LSGSLAGVTEACVIVPF 130
           +P+       + +F  N++ +K F+   G     Q +++      G ++G   A +  P 
Sbjct: 82  APLAGVGACVSCQFGVNEALKKWFRKKDG--NFDQPLALRQYYACGFVSGTANAFLATPI 139

Query: 131 ELVKIRLQ-----DVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVI 185
           E V+IRLQ        ++++G ++   K +++  ++    G  +T  R +      FG+ 
Sbjct: 140 EHVRIRLQLQTASSSAAEYHGSLDCARKLLKQGALM---RGFTATTLRTSHG----FGIY 192

Query: 186 FQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYS-----TEHTILSVVKSRIQSGATTTLA 240
           F     L   + +      ++ A  +  Y  +S            VVKS +Q       A
Sbjct: 193 FLTYETLIANQAHHGVLRENIPAWKVCVYGAFSGAFFWAMTYPFDVVKSVMQ-------A 245

Query: 241 DGTVVPKYNWTWPSLFK-IYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMM 293
           D    P Y     ++ K IY E G  A  KGF P +LR  P  G     F   M
Sbjct: 246 DKLKNPVYGRNPLAVAKAIYRERGPRAFTKGFTPTMLRSLPVNGATFAAFEITM 299

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 82/194 (42%), Gaps = 17/194 (8%)

Query: 3   EKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVK 62
           ++PL     +  G  +G +   +  P++ V+ R+QLQ  S   S   Y+G +DC  +++K
Sbjct: 113 DQPLALRQYYACGFVSGTANAFLATPIEHVRIRLQLQTAS--SSAAEYHGSLDCARKLLK 170

Query: 63  REGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQIS----ILSGSL 118
           +     L +G ++  L  +      F    +Y+ +  +      L + I      + G+ 
Sbjct: 171 QGA---LMRGFTATTLRTSHGFGIYFL---TYETLIANQAHHGVLRENIPAWKVCVYGAF 224

Query: 119 AGVTEACVIVPFELVKIRLQDVNSKF----NGPMEVVFKTIRETGILSLYNGLESTMWRN 174
           +G     +  PF++VK  +Q    K       P+ V     RE G  +   G   TM R+
Sbjct: 225 SGAFFWAMTYPFDVVKSVMQADKLKNPVYGRNPLAVAKAIYRERGPRAFTKGFTPTMLRS 284

Query: 175 AFWNGGYFGVIFQI 188
              NG  F   F+I
Sbjct: 285 LPVNGATFAA-FEI 297

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/207 (20%), Positives = 83/207 (40%), Gaps = 22/207 (10%)

Query: 96  KMFKDLYGVDKLTQQI-SILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKT 154
           ++  DL       Q +  +  G++ GV +  V  PF++ K+RLQ  +       +V+   
Sbjct: 9   QVVDDLVDTHDFKQALKDVFCGTVGGVAQVLVGQPFDITKVRLQ-TSPVPTTAAQVIKSL 67

Query: 155 IRETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKT-------TNDLI 207
           ++  G+L+ Y G  + +          FGV   ++    K   N ++            +
Sbjct: 68  VKNEGLLAFYKGTLAPLAGVGACVSCQFGVNEALKKWFRKKDGNFDQPLALRQYYACGFV 127

Query: 208 AGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTAL 267
           +GT   +     EH     V+ R+Q    ++ A      +Y+ +     K+  +    AL
Sbjct: 128 SGTANAFLATPIEH-----VRIRLQLQTASSSA-----AEYHGSLDCARKLLKQ---GAL 174

Query: 268 YKGFIPKILRLGPGGGIMLVVFNGMMA 294
            +GF    LR   G GI  + +  ++A
Sbjct: 175 MRGFTATTLRTSHGFGIYFLTYETLIA 201

>Kwal_33.12988
          Length = 303

 Score = 65.9 bits (159), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 71/292 (24%), Positives = 118/292 (40%), Gaps = 33/292 (11%)

Query: 14  SGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGI 73
           +G   G++++LV  P D+ K R+Q      T   V  +        +VK EG    YKG 
Sbjct: 29  AGTTGGIAQVLVGQPFDITKVRLQTSSTPTTALRVVQD--------LVKNEGLRGFYKGT 80

Query: 74  SSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQIS--ILSGSLAGVTEACVIVPFE 131
           + P++      +++F  N++ ++ F         + ++      G ++G   A +  P E
Sbjct: 81  TLPLIGVGLCVSSQFGTNEAMKRYFHKRNNFQSTSLRLPEYYACGFVSGCANAFLATPIE 140

Query: 132 LVKIRLQ-----DVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVIF 186
            V+I LQ       ++++ G M+ + K ++E     L  G   T+ R +      FGV F
Sbjct: 141 HVRILLQVQTKSRADAEYQGAMDCIKKLLKEG---KLMRGFTPTILRTSHG----FGVYF 193

Query: 187 QIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHT-----ILSVVKSRIQSGATTTLAD 241
                +  ++        D+ A  +  Y  +S            V+KS +QS    T   
Sbjct: 194 TSYEAMICSEQRKGIARKDIPAWKLCLYGAFSGSLLWAMVYPFDVIKSVMQSDKLRTPVY 253

Query: 242 GTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMM 293
           GT V      +     IY+E G  A  KGF P +LR  P  G     F   M
Sbjct: 254 GTNV------FQVAKNIYNERGPKAFVKGFGPTMLRSLPVNGATFTAFEMAM 299

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 81/211 (38%), Gaps = 32/211 (15%)

Query: 104 VDKLTQQISI-------LSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIR 156
           VD LT +  I        +G+  G+ +  V  PF++ K+RLQ  +S     + VV   ++
Sbjct: 11  VDDLTDKSDIRRTLKDITAGTTGGIAQVLVGQPFDITKVRLQ-TSSTPTTALRVVQDLVK 69

Query: 157 ETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDL--------IA 208
             G+   Y G    +          FG    ++    K + N + T+  L        ++
Sbjct: 70  NEGLRGFYKGTTLPLIGVGLCVSSQFGTNEAMKRYFHK-RNNFQSTSLRLPEYYACGFVS 128

Query: 209 GTIGGYCRYSTEHT-ILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTAL 267
           G    +     EH  IL  V+++ ++ A           +Y      + K+  E     L
Sbjct: 129 GCANAFLATPIEHVRILLQVQTKSRADA-----------EYQGAMDCIKKLLKE---GKL 174

Query: 268 YKGFIPKILRLGPGGGIMLVVFNGMMAFFQE 298
            +GF P ILR   G G+    +  M+   Q 
Sbjct: 175 MRGFTPTILRTSHGFGVYFTSYEAMICSEQR 205

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score = 65.9 bits (159), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 71/301 (23%), Positives = 118/301 (39%), Gaps = 45/301 (14%)

Query: 15  GAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR-LYKGI 73
           G+ AG    ++ YP D VK R+Q Q     G  V +     C+    K EG  +  ++GI
Sbjct: 20  GSIAGALGKVIEYPFDTVKVRLQTQ-----GRHV-FPDTWSCITYTYKNEGIIKGFFQGI 73

Query: 74  SSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIVPFELV 133
           +SP+   A + A  F   +   K  +    V  LT    ++SG+ AG   + V+ P EL+
Sbjct: 74  ASPLAGAAIENAALFLSYNQCSKFLQHYTNVSDLTN--ILISGAFAGSCASFVLTPVELI 131

Query: 134 KIRLQ---------------DVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWN 178
           K +LQ                V  +    +  +   I+  G + L+ G   T  R +F  
Sbjct: 132 KCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGTFIRESFGG 191

Query: 179 GGYFGVIFQIRALLPKAKTNTE-------KTTNDLIAGTIGGYCRYSTEHTILSVVKSRI 231
             +F     ++  L K++ N E         T +L+A        ++        VKS +
Sbjct: 192 VAWFATYELMKKYL-KSRHNIEDPSLPNDNKTWELLASGASAGLAFNASIFPADTVKSMM 250

Query: 232 QSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNG 291
           Q   T  L   T +           KI+ E+G    Y+G    ++R  P    +  V+  
Sbjct: 251 Q---TEHLGLKTAIK----------KIFVEKGLRGFYRGLGITLIRAIPANATVFYVYET 297

Query: 292 M 292
           +
Sbjct: 298 L 298

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 79/193 (40%), Gaps = 9/193 (4%)

Query: 112 SILSGSLAGVTEACVIVPFELVKIRLQDVNSK-FNGPMEVVFKTIRETGILS-LYNGLES 169
            IL GS+AG     +  PF+ VK+RLQ      F      +  T +  GI+   + G+ S
Sbjct: 16  DILYGSIAGALGKVIEYPFDTVKVRLQTQGRHVFPDTWSCITYTYKNEGIIKGFFQGIAS 75

Query: 170 TMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKS 229
            +   A  N   F    Q    L +  TN    TN LI+G   G C  S   T + ++K 
Sbjct: 76  PLAGAAIENAALFLSYNQCSKFL-QHYTNVSDLTNILISGAFAGSCA-SFVLTPVELIKC 133

Query: 230 RIQSGATTTLADG-----TVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGI 284
           ++Q     +L  G     TV  ++    P++  +    GF  L++G     +R   GG  
Sbjct: 134 KLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGTFIRESFGGVA 193

Query: 285 MLVVFNGMMAFFQ 297
               +  M  + +
Sbjct: 194 WFATYELMKKYLK 206

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 80/177 (45%), Gaps = 19/177 (10%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQ------LQVGSGTGSGVA--YNGVIDCLGQIVKR 63
            +SGA AG     V+ P++++K ++Q      L +G   G+ V   +  +I  +  ++K 
Sbjct: 111 LISGAFAGSCASFVLTPVELIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKN 170

Query: 64  EGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGV-------DKLTQQISILSG 116
            GF  L++G S   + E+      FA  +  +K  K  + +       D  T ++ + SG
Sbjct: 171 RGFIGLWQGQSGTFIRESFGGVAWFATYELMKKYLKSRHNIEDPSLPNDNKTWEL-LASG 229

Query: 117 SLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWR 173
           + AG+     I P + VK  +Q   ++  G    + K   E G+   Y GL  T+ R
Sbjct: 230 ASAGLAFNASIFPADTVKSMMQ---TEHLGLKTAIKKIFVEKGLRGFYRGLGITLIR 283

 Score = 34.7 bits (78), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 40/86 (46%), Gaps = 10/86 (11%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71
             SGA+AG++    ++P D VK+ MQ +          + G+   + +I   +G    Y+
Sbjct: 226 LASGASAGLAFNASIFPADTVKSMMQTE----------HLGLKTAIKKIFVEKGLRGFYR 275

Query: 72  GISSPMLMEAPKRATKFACNDSYQKM 97
           G+   ++   P  AT F   ++  K+
Sbjct: 276 GLGITLIRAIPANATVFYVYETLSKL 301

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 65.9 bits (159), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 70/287 (24%), Positives = 124/287 (43%), Gaps = 10/287 (3%)

Query: 7   PFIYQFVSGAAAGVSELLVMYPLDVVKTRMQ-LQVGSGTGSGVAYNGVIDCLGQIVKREG 65
           P  +Q ++GA AG++E  V++PLD +KTR+Q +   S TG     + ++  L  I  +EG
Sbjct: 17  PLAHQLMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIPSTMLRQLSSISAQEG 76

Query: 66  FSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKD-LYGVDKLTQQISILSGSLAGVTEA 124
              L+KG+ S +L   P  A  FA  +  +    D      K     +  SG+ A +   
Sbjct: 77  SMVLWKGVQSVLLGAGPAHAVYFATYEMVKSFLIDEATSTSKYHFFKTAFSGATATIAAD 136

Query: 125 CVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGV 184
            ++ PF+++K R+Q +N+  +   +   +   + G  + Y+   +T+  N  +    FG+
Sbjct: 137 ALMNPFDVIKQRIQ-LNTNIS-VWDTAKRIYSKEGFQAFYSSYPTTLAINIPFAAFNFGI 194

Query: 185 I-FQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGT 243
                R   P    N     + L  G  G  C   T  T L  +K+ +Q   +  ++   
Sbjct: 195 YDTATRYFNPSGVYN--PFIHCLCGGISGAACAGLT--TPLDCIKTALQVRGSEKVS-ME 249

Query: 244 VVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFN 290
           V  + +    +   IY   G+   + G  P+IL   P   I    + 
Sbjct: 250 VFKQADTFKKATRAIYQVYGWRGFWSGVKPRILANMPATAISWTAYE 296

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 41/95 (43%), Gaps = 9/95 (9%)

Query: 204 NDLIAGTIGGYCRYSTEHTI---LSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYS 260
           + L+AG   G      EH++   L  +K+R+Q+    +   G  +P        L  I +
Sbjct: 20  HQLMAGAFAGIA----EHSVIFPLDALKTRLQAMHAISTTGGQPIPSTMLR--QLSSISA 73

Query: 261 EEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAF 295
           +EG   L+KG    +L  GP   +    +  + +F
Sbjct: 74  QEGSMVLWKGVQSVLLGAGPAHAVYFATYEMVKSF 108

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 65.5 bits (158), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 68/293 (23%), Positives = 123/293 (41%), Gaps = 12/293 (4%)

Query: 7   PFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGF 66
           P   Q ++GA AG+ E  +M+P+D +KTR+Q    +G     A  G+I  + +I   EG 
Sbjct: 22  PLHSQLLAGAFAGIMEHSLMFPIDALKTRVQ---AAGLNKA-ASTGMISQISKISTMEGS 77

Query: 67  SRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACV 126
             L+KG+ S +L   P  A  F   +  +        +       + LSG++A +    +
Sbjct: 78  MALWKGVQSVILGAGPAHAVYFGTYEFCKARLISPEDMQTHQPMKTALSGTIATIAADAL 137

Query: 127 IVPFELVKIRLQ-DVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVI 185
           + PF+ VK RLQ D N +      V  +  +  G  + Y    +T+  N  +    F +I
Sbjct: 138 MNPFDTVKQRLQLDTNLRV---WNVTKQIYQNEGFAAFYYSYPTTLAMNIPFAAFNF-MI 193

Query: 186 FQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVV 245
           ++  +     + +     + L  G  G  C   T  T L  +K+ +Q   + T++   ++
Sbjct: 194 YESASKFFNPQNSYNPLIHCLCGGISGATCAALT--TPLDCIKTVLQVRGSETVSI-EIM 250

Query: 246 PKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFFQE 298
              N    +   I    G+   ++G  P+I+   P   I    +     F  +
Sbjct: 251 KDANTFGRASRAILEVHGWKGFWRGLKPRIVANIPATAISWTAYECAKHFLMK 303

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 65.5 bits (158), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 81/346 (23%), Positives = 136/346 (39%), Gaps = 80/346 (23%)

Query: 11  QFVSGAAAGVSELLVMYPLDVVKTRMQLQ-----------------VGSGT--------- 44
           + +S  A  V   L++ P+DVV+ R+Q Q                 V SG+         
Sbjct: 15  RMLSAGAGSVLTSLILTPMDVVRIRLQQQQMIPDCSCDGAAEVPNAVSSGSKMKTFTNVG 74

Query: 45  ----------------------GSGVAYNGVIDCLGQIVKREGFSRLYKGISSPMLMEAP 82
                                  S + +NG ++   +I   EG + L++GIS  +LM  P
Sbjct: 75  GQNLNNAKIFWESACFQELHCKNSSLKFNGTLEAFTKIASVEGITSLWRGISLTLLMAIP 134

Query: 83  KRATKFACNDSYQKMFKDLYGVDKLTQQIS-ILSGSLAGVTEACVIVPFELVKIRLQDV- 140
                F    S  +  +D+  +      ++ +  G++A V  A  I P ELVK +LQ + 
Sbjct: 135 ANMVYF----SGYEYIRDVSPIASTYPTLNPLFCGAIARVFAATSIAPLELVKTKLQSIP 190

Query: 141 -NSKFNGPMEVVFKTIRETG--------ILSLYNGLESTMWRNAFWNGGYFGV--IFQIR 189
            +SK      +V   + ET           +L+ GLE T+WR+  ++  Y+    + + R
Sbjct: 191 RSSKSTKTWMMVKDLLNETRQEMKMVGPSRALFKGLEITLWRDVPFSAIYWSSYELCKER 250

Query: 190 ALLPKAKTNTEKTT-----NDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTV 244
             L   +  ++        N   +G I G       H    V K+R Q       +D   
Sbjct: 251 LWLDSTRFASKDANWVHFINSFASGCISGMIAAICTHP-FDVGKTRWQISMMNN-SD--- 305

Query: 245 VPKYNWTWPSLFK----IYSEEGFTALYKGFIPKILRLGPGGGIML 286
            PK      ++FK    I+  EG  ALY G   +++++ P   IM+
Sbjct: 306 -PKGGNRSRNMFKFLETIWRTEGLAALYTGLAARVIKIRPSCAIMI 350

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 44/93 (47%), Gaps = 2/93 (2%)

Query: 8   FIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQV--GSGTGSGVAYNGVIDCLGQIVKREG 65
           FI  F SG  +G+   +  +P DV KTR Q+ +   S    G     +   L  I + EG
Sbjct: 268 FINSFASGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLETIWRTEG 327

Query: 66  FSRLYKGISSPMLMEAPKRATKFACNDSYQKMF 98
            + LY G+++ ++   P  A   +  +  +K+F
Sbjct: 328 LAALYTGLAARVIKIRPSCAIMISSYEISKKVF 360

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 80/185 (43%), Gaps = 26/185 (14%)

Query: 7   PFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLG---QIVKR 63
           P +     GA A V     + PL++VKT++Q  +   + S   +  V D L    Q +K 
Sbjct: 157 PTLNPLFCGAIARVFAATSIAPLELVKTKLQ-SIPRSSKSTKTWMMVKDLLNETRQEMKM 215

Query: 64  EGFSR-LYKGISSPMLMEAPKRATKFA----CN-----DSYQKMFKDLYGVDKLTQQISI 113
            G SR L+KG+   +  + P  A  ++    C      DS +   KD   V  +    S 
Sbjct: 216 VGPSRALFKGLEITLWRDVPFSAIYWSSYELCKERLWLDSTRFASKDANWVHFIN---SF 272

Query: 114 LSGSLAGVTEACVIVPFELVKIRLQ-----DVNSKFNGPMEVVFKTI----RETGILSLY 164
            SG ++G+  A    PF++ K R Q     + + K       +FK +    R  G+ +LY
Sbjct: 273 ASGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLETIWRTEGLAALY 332

Query: 165 NGLES 169
            GL +
Sbjct: 333 TGLAA 337

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 65.5 bits (158), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 76/319 (23%), Positives = 134/319 (42%), Gaps = 50/319 (15%)

Query: 7   PFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQV-------------GSGT-----GSGV 48
           P+++ FV+G   G++  +V  P DVVKTR+Q  V             GS T      S +
Sbjct: 50  PWVH-FVAGGIGGMAGAIVTCPFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLL 108

Query: 49  AYNGVIDCLGQIVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLT 108
            +      +G + ++EGF  L+KG+   ++   P R+  F    + + ++       +  
Sbjct: 109 HFKETFGIIGNVYRQEGFRSLFKGLGPNLVGVIPARSINFLTYGTTKDIYSRTLNNGQEA 168

Query: 109 QQISILSGSLAGVTEACVIVPFELVKIRLQDVNS---KFNGPMEVVFKTIRETGILSLYN 165
             I +L+ + AG   + V  P  LVK RLQ   +    +   ++ +   ++  G+L LY 
Sbjct: 169 PWIHLLAAATAGWATSTVTNPIWLVKTRLQLDKAGTKTYKNSLDCIKSVVKNEGVLGLYK 228

Query: 166 GLESTMWRNAF----W-------------NGGYFGVIFQ-IRALLPKAKTNTEKTTNDLI 207
           GL ++   +      W             +   FG I +  ++   K K   +++ +  +
Sbjct: 229 GLSASYLGSVEGILQWILYEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEWCQRSGSAGL 288

Query: 208 AGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTAL 267
           A  +     Y  E     VV++R++   T    +G +  KY     S   I  EEG  ++
Sbjct: 289 AKFVASIVTYPHE-----VVRTRLRQAPT---ENGKL--KYTGLVQSFRVIIKEEGLVSM 338

Query: 268 YKGFIPKILRLGPGGGIML 286
           Y G  P +LR  P   IM 
Sbjct: 339 YSGLTPHLLRTVPNSIIMF 357

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score = 65.1 bits (157), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 75/324 (23%), Positives = 136/324 (41%), Gaps = 60/324 (18%)

Query: 7   PFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQV------------GSGTGSGVA----- 49
           P+++ FV+G   G++  +V  P DVVKTR+Q  V            G    + +A     
Sbjct: 52  PWVH-FVAGGIGGMAGAVVTCPFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGVRH 110

Query: 50  YNGVIDCLGQIVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQ 109
           +      +  + + EGF  L+KG+   ++   P R+  F    + ++++       +   
Sbjct: 111 FKETFGIISNVYRNEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKTLNNGQEAV 170

Query: 110 QISILSGSLAGVTEACVIVPFELVKIRLQ----DVNSKFNGPMEVVFKTIRETGILSLYN 165
            I +++ + AG   +    P  LVK RLQ        K+    + +   +++ GIL LY 
Sbjct: 171 WIHLMAAATAGWATSTATNPIWLVKTRLQLDKAGTTKKYKNSWDCLKNVVQKEGILGLYK 230

Query: 166 GLESTMWRNAFWNGGYFGVI-----FQIRALLPKAK-------TNTEKTTNDLIAGTIGG 213
           GL      +A + G   G++      Q++ ++ +         +  EK+T+D     I  
Sbjct: 231 GL------SASYLGSVEGILQWVLYEQMKHIIKQRSMEKFGNISEVEKSTSD----KIKE 280

Query: 214 YCRYSTEHTIL-----------SVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEE 262
           +C+ S    +             VV++R++      L +G +  KY     S+  I  EE
Sbjct: 281 WCQRSGSAGLAKFVASIITYPHEVVRTRLRQAP---LENGKL--KYTGLVQSIRVIIKEE 335

Query: 263 GFTALYKGFIPKILRLGPGGGIML 286
           G  ++Y G  P +LR  P   IM 
Sbjct: 336 GLASMYGGLTPHLLRTVPNSIIMF 359

>Kwal_23.3529
          Length = 395

 Score = 65.5 bits (158), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 75/285 (26%), Positives = 129/285 (45%), Gaps = 29/285 (10%)

Query: 25  VMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR-LYKGISSPMLMEAPK 83
           VM+ LD VKTR Q     G  +   Y  +I    +I   EG  R LY G ++ ML   P 
Sbjct: 102 VMHSLDTVKTRQQ-----GAPNAPKYRNMISAYQKIFMEEGIRRGLYGGYTAAMLGSFPS 156

Query: 84  RATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAG-VTEACVIVPFELVKIRLQDVNS 142
            A  F   +  ++   D +GV+   + +S L+  L+G +  + V VP E++K RLQ +  
Sbjct: 157 AAIFFGTYELTKRKLIDDWGVN---ETLSHLTAGLSGDLVSSVVYVPSEVLKTRLQ-LQG 212

Query: 143 KFNGPM-----------EVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVIFQIR-- 189
            +N P            + +   +R  G  +L+ G ++T+ R+  ++   F    + R  
Sbjct: 213 CYNNPHFHSGYNYRNLRDAITAIVRLEGWQTLFFGYKATLCRDLPFSAFQFAFYEKFRQW 272

Query: 190 ALLPKAKTNTEKTT--NDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGT--VV 245
           A   + KT ++  +  N+L+ G   G        T + V+K+RIQ+   +T+A  +  +V
Sbjct: 273 AFTLEGKTPSQDLSLLNELLTGAAAGGLAGIIT-TPMDVIKTRIQTQMPSTVASDSTRLV 331

Query: 246 PKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFN 290
              N     L  +Y  EG    + G  P+ +       IML+++ 
Sbjct: 332 RIENSLIKGLTAVYRSEGTLGFFSGVGPRFIWTSIQSSIMLLLYQ 376

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 66/135 (48%), Gaps = 8/135 (5%)

Query: 11  QFVSGAAAGVSELLVMYPLDVVKTRMQLQ---VGSGTGSGVAYNGVIDCLGQIVKREGFS 67
              +G +  +   +V  P +V+KTR+QLQ         SG  Y  + D +  IV+ EG+ 
Sbjct: 183 HLTAGLSGDLVSSVVYVPSEVLKTRLQLQGCYNNPHFHSGYNYRNLRDAITAIVRLEGWQ 242

Query: 68  RLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILS----GSLAGVTE 123
            L+ G  + +  + P  A +FA  + +++    L G    +Q +S+L+    G+ AG   
Sbjct: 243 TLFFGYKATLCRDLPFSAFQFAFYEKFRQWAFTLEGKTP-SQDLSLLNELLTGAAAGGLA 301

Query: 124 ACVIVPFELVKIRLQ 138
             +  P +++K R+Q
Sbjct: 302 GIITTPMDVIKTRIQ 316

 Score = 28.9 bits (63), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 5/55 (9%)

Query: 24  LVMYPLDVVKTRMQLQVGSGTGSGVAY-----NGVIDCLGQIVKREGFSRLYKGI 73
           ++  P+DV+KTR+Q Q+ S   S         N +I  L  + + EG    + G+
Sbjct: 303 IITTPMDVIKTRIQTQMPSTVASDSTRLVRIENSLIKGLTAVYRSEGTLGFFSGV 357

>Kwal_27.12481
          Length = 304

 Score = 64.7 bits (156), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 76/299 (25%), Positives = 123/299 (41%), Gaps = 28/299 (9%)

Query: 2   SEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQ---VGSGTGSGVAYNGVIDCLG 58
           S+K   F   F+ G  +         P++ VK  +Q Q   +  G+     Y G+ +C  
Sbjct: 4   SKKQSNFAVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGS-LDRRYTGIGECFK 62

Query: 59  QIVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMF--KDLYGVDKLTQQISILSG 116
           +    EG +  ++G ++ ++   P +A  FA  D  + MF  K   G  K     ++ SG
Sbjct: 63  RTAANEGIASFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYAKWFAG-NLASG 121

Query: 117 SLAGVTEACVIVPFELVKIRL--------QDVNSKFNGPMEVVFKTIRETGILSLYNGLE 168
             AG      +   +  + RL        +    +FNG ++V  KT+   GI  LY G  
Sbjct: 122 GAAGGLSLMFVYSLDYARTRLAADSKGAKKGGERQFNGLVDVYKKTLASDGIAGLYRGFL 181

Query: 169 STMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLI--AGTIGGYCRYSTEHTILSV 226
            ++     + G YFG    ++ LL           + L+  A T G     ST    L  
Sbjct: 182 PSVVGIVVYRGLYFGGYDSLKPLLLTGSLEGSFLASFLLGWAVTTGA----STASYPLDT 237

Query: 227 VKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIM 285
           V+ R+       +  G  V KYN  + +  KI + EG  +L+KG    ILR   G G++
Sbjct: 238 VRRRMM------MTSGQAV-KYNGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGAGVI 289

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/193 (21%), Positives = 76/193 (39%), Gaps = 26/193 (13%)

Query: 8   FIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQV-GSGTGSGVAYNGVIDCLGQIVKREGF 66
           F     SG AAG   L+ +Y LD  +TR+     G+  G    +NG++D   + +  +G 
Sbjct: 114 FAGNLASGGAAGGLSLMFVYSLDYARTRLAADSKGAKKGGERQFNGLVDVYKKTLASDGI 173

Query: 67  SRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACV 126
           + LY+G    ++     R   F   DS + +   L G  + +   S L G       +  
Sbjct: 174 AGLYRGFLPSVVGIVVYRGLYFGGYDSLKPLL--LTGSLEGSFLASFLLGWAVTTGASTA 231

Query: 127 IVPFELVKIRL-----------------------QDVNSKFNGPMEVVFKTIRETGILSL 163
             P + V+ R+                       + + S F G    + + +   G++S+
Sbjct: 232 SYPLDTVRRRMMMTSGQAVKYNGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGAGVISM 291

Query: 164 YNGLESTMWRNAF 176
           Y+ L+  ++   F
Sbjct: 292 YDQLQMILFGKKF 304

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 76/299 (25%), Positives = 121/299 (40%), Gaps = 22/299 (7%)

Query: 13  VSGAAAGVSELLVMYPLDVVKTRMQLQ-VGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71
           +SGA AG+   +V+ PLDV KTR+Q Q + + T   + Y G I  +  IV+ EG   LYK
Sbjct: 73  ISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRGLYK 132

Query: 72  GISSPMLMEAPKRATKFA----CNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVI 127
           G+   ++   P     F+    C D+ +    +   V      I+      AG     V 
Sbjct: 133 GLVPIIMGYFPTWMIYFSVYEFCKDNLRTNSSNWSFVSHSFSAIT------AGAVSTVVT 186

Query: 128 VPFELVKIRLQ------DVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGY 181
            P  +VK RL          + + G  +   K I + G+ +LY GL  ++         +
Sbjct: 187 NPIWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGVKALYAGLVPSLL-GLLHVAIH 245

Query: 182 FGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLAD 241
           F V  +++    K     E +    I   +      S+   +++ V S       T L  
Sbjct: 246 FPVYERLKVSF-KCYQRDESSNESKI--NLKRLILASSVSKMVASVLSYPHEILRTRLQL 302

Query: 242 GTVVPKYNWTWPSLFKI-YSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFFQEM 299
            + +P +      L KI Y +EG    Y GF   + R  P   I LV F  +  F  ++
Sbjct: 303 KSDLPSHQRRLIPLIKITYIQEGIFGFYSGFGTNLFRTLPASAITLVSFEYVRNFLNKI 361

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 81/175 (46%), Gaps = 12/175 (6%)

Query: 8   FIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFS 67
           F+    S   AG    +V  P+ VVKTR+ LQ   G+ +   Y G  D   +I+ +EG  
Sbjct: 168 FVSHSFSAITAGAVSTVVTNPIWVVKTRLMLQTHIGSNT-THYQGTYDAFKKIINQEGVK 226

Query: 68  RLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVD------KLTQQISILSGSLAGV 121
            LY G+  P L+     A  F   +  +  FK  Y  D      K+  +  IL+ S++ +
Sbjct: 227 ALYAGL-VPSLLGLLHVAIHFPVYERLKVSFK-CYQRDESSNESKINLKRLILASSVSKM 284

Query: 122 TEACVIVPFELVKIRLQ---DVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWR 173
             + +  P E+++ RLQ   D+ S     + ++  T  + GI   Y+G  + ++R
Sbjct: 285 VASVLSYPHEILRTRLQLKSDLPSHQRRLIPLIKITYIQEGIFGFYSGFGTNLFR 339

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 53/191 (27%), Positives = 82/191 (42%), Gaps = 24/191 (12%)

Query: 101 LYGVDKLTQQISILSGSLAGVTEACVIVPFELVKIRLQ--------DVNSKFNGPMEVVF 152
           L+G      +I+ +SG+LAG+    V+ P ++ K RLQ          N  + G +  + 
Sbjct: 60  LFGFTLNDNRINAISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMT 119

Query: 153 KTIRETGILSLYNGLES-TMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTI 211
             +R+ G+  LY GL    M     W   YF V    +  L    +N    ++   A T 
Sbjct: 120 TIVRDEGVRGLYKGLVPIIMGYFPTW-MIYFSVYEFCKDNLRTNSSNWSFVSHSFSAITA 178

Query: 212 GGYCRYSTEHTILSVVKSRI----QSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTAL 267
           G      T    + VVK+R+      G+ TT         Y  T+ +  KI ++EG  AL
Sbjct: 179 GAVSTVVTNP--IWVVKTRLMLQTHIGSNTT--------HYQGTYDAFKKIINQEGVKAL 228

Query: 268 YKGFIPKILRL 278
           Y G +P +L L
Sbjct: 229 YAGLVPSLLGL 239

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 73/304 (24%), Positives = 122/304 (40%), Gaps = 39/304 (12%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYN-GVIDCLGQIVKREGFSRLY 70
           F++G  AG     V+ P + VK  +Q+Q      S  +YN G+   + Q+   EG   L+
Sbjct: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQ-----SSTTSYNRGIFSSIRQVYHEEGTKGLF 80

Query: 71  KGISSPMLMEAPKRATKFACNDSYQKMFKDLYG---VDKLTQQISILSGSLAGVTEACVI 127
           +G     +   P  A +F   ++ +K    + G    ++LT    + SG+L G       
Sbjct: 81  RGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVAT 140

Query: 128 VPFELVKIRL--QDVN------------SKFNGPMEVVFKTIR-ETGILSLYNGLESTMW 172
            P +L+K RL  Q  N            SK  G  +++ +T R E G+  LY G+  T  
Sbjct: 141 YPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLYRGVWPTSL 200

Query: 173 RNAFWNGGYFGVIFQIRAL-------LPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILS 225
               +    F V  Q+R          P  K+N  K T   I+G +     Y        
Sbjct: 201 GVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYP-----FD 255

Query: 226 VVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIM 285
           +++ R Q      +    +  +Y   W +L  I   EG +  YKG    + ++ P   + 
Sbjct: 256 LLRRRFQ---VLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVS 312

Query: 286 LVVF 289
            +V+
Sbjct: 313 WLVY 316

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 84/203 (41%), Gaps = 15/203 (7%)

Query: 106 KLTQQISILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIR----ETGIL 161
           K    I+ L+G +AG     V+ PFE VKI LQ V S        +F +IR    E G  
Sbjct: 19  KQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQ-VQSSTTSYNRGIFSSIRQVYHEEGTK 77

Query: 162 SLYNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNT--EKTTND--LIAGTIGGYCRY 217
            L+ G      R   ++   F V    +  L     N   E+ TN   L +G + G C  
Sbjct: 78  GLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSV 137

Query: 218 STEHTILSVVKSR--IQSGATTTL--ADGTVVPKYNWTWPSLFKIYS-EEGFTALYKGFI 272
              +  L ++K+R  IQ+   ++L  +    + K    W  L + Y  E G   LY+G  
Sbjct: 138 VATYP-LDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLYRGVW 196

Query: 273 PKILRLGPGGGIMLVVFNGMMAF 295
           P  L + P   +   V+  +  F
Sbjct: 197 PTSLGVVPYVALNFAVYEQLREF 219

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 81/318 (25%), Positives = 129/318 (40%), Gaps = 50/318 (15%)

Query: 7   PFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGF 66
           P  +  VSG   G      M+ LD VKTR Q     G  +   Y  +I     I   EG 
Sbjct: 52  PIWHCVVSGGIGGKIGDSAMHSLDTVKTRQQ-----GAPNVKKYRNMISAYRTIWLEEGV 106

Query: 67  SR-LYKGISSPMLMEAPKRATKFACNDSYQK-MFKDLYGVDKLTQQISILSGSLAGVTEA 124
            R LY G  + ML   P  A  F   +  ++ M +D    D +T    + +G L     +
Sbjct: 107 RRGLYGGYMAAMLGSFPSAAIFFGTYEYTKRTMIEDWQINDTITH---LSAGFLGDFISS 163

Query: 125 CVIVPFELVKIRLQDVNSKFNGPM-----------EVVFKTIRETGILSLYNGLESTMWR 173
            V VP E++K RLQ +  +FN P              +   I+E G  SL+ G ++T+ R
Sbjct: 164 FVYVPSEVLKTRLQ-LQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGFRSLFFGYKATLAR 222

Query: 174 NAFWNGGYFGVIFQIRALLPKAKTNTEKT-----TNDLIAGTI-GGYCRYSTEHTILSVV 227
           +  ++   F    + R L  K +    +       N+++ G   GG     T  T + VV
Sbjct: 223 DLPFSALQFAFYEKFRQLAFKIEQKDGRDGELSIPNEILTGACAGGLAGIIT--TPMDVV 280

Query: 228 KSRIQSGATTTLADGTVVPKYNWTWP----------------SLFKIYSEEGFTALYKGF 271
           K+R+Q+    + ++ +    Y+ T P                SL  +Y  EG    + G 
Sbjct: 281 KTRVQTQQPPSQSNKS----YSVTHPHVTNGRPAALSNSISLSLRTVYQSEGVLGFFSGV 336

Query: 272 IPKILRLGPGGGIMLVVF 289
            P+ +       IML+++
Sbjct: 337 GPRFVWTSVQSSIMLLLY 354

>AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH]
           (1500683..1501609) [927 bp, 308 aa]
          Length = 308

 Score = 63.2 bits (152), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 81/170 (47%), Gaps = 12/170 (7%)

Query: 25  VMYPLDVVKTRMQLQVGSGTGSGVAYN-GVIDCLGQIVKREGFSRLYKGISSPMLMEAPK 83
            M P+DVVKTR+QL+        + Y+ G++    +IV  EG + L  G    +L  + +
Sbjct: 32  AMVPIDVVKTRIQLEP-------LKYSSGMVGSFRKIVGEEGAAALLTGFGPTLLGYSMQ 84

Query: 84  RATKFACNDSYQKMFKDLYGVDKLTQ---QISILSGSLAGVTEACVIVPFELVKIRLQDV 140
            A KF   + ++K F D  G +   Q    I I S ++A       + P E  +IRL   
Sbjct: 85  GAFKFGGYEVFKKAFVDALGYETACQYRTPIYIGSAAIAEFFADIALCPLEATRIRLVSQ 144

Query: 141 NSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRA 190
            +  NG +    + ++E GI S YNG    +++   +N   F V+F+  A
Sbjct: 145 PTFANGLVGGFARILKEEGIGSFYNGFTPILFKQIPYNIAKF-VVFEHAA 193

 Score = 34.7 bits (78), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 73/182 (40%), Gaps = 16/182 (8%)

Query: 114 LSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVF-KTIRETGILSLYNGLESTMW 172
           L+G++        +VP ++VK R+Q    K++  M   F K + E G  +L  G   T+ 
Sbjct: 20  LAGAIGCGATHSAMVPIDVVKTRIQLEPLKYSSGMVGSFRKIVGEEGAAALLTGFGPTLL 79

Query: 173 ----RNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVK 228
               + AF  GGY   +F+ +A +      T       I         +  +  +  +  
Sbjct: 80  GYSMQGAFKFGGY--EVFK-KAFVDALGYETACQYRTPIYIGSAAIAEFFADIALCPLEA 136

Query: 229 SRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVV 288
           +RI+  +  T A+G V            +I  EEG  + Y GF P + +  P      VV
Sbjct: 137 TRIRLVSQPTFANGLV--------GGFARILKEEGIGSFYNGFTPILFKQIPYNIAKFVV 188

Query: 289 FN 290
           F 
Sbjct: 189 FE 190

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score = 63.5 bits (153), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 67/288 (23%), Positives = 119/288 (41%), Gaps = 20/288 (6%)

Query: 13  VSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKG 72
           +SGA AG    + + PLDV KTR+Q Q          Y G++  L  IV+ EG   LYKG
Sbjct: 82  LSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKG 141

Query: 73  ISSPMLMEAPKRATKFACNDSYQKMFKDLY-GVDKLTQQISILSGSLAGVTEACVIVPFE 131
           +   +L   P     F+  +  +K F  ++   D + Q  + ++   AG     +  P  
Sbjct: 142 LVPIVLGYFPTWMIYFSVYEFSKKFFHGIFPQFDFVAQSCAAIT---AGAASTTLTNPIW 198

Query: 132 LVKIRLQ------DVNSKFNGPMEVVFKTIRETGILSLYNGLEST---MWRNAFWNGGYF 182
           +VK RL       +  + + G  +   K   + G  +LY GL  +   ++  A     Y 
Sbjct: 199 VVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLLGLFHVAIHFPIYE 258

Query: 183 GVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADG 242
            +  +      +  TN+      ++A ++      +  +    ++++R+Q    + + D 
Sbjct: 259 DLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYP-HEILRTRMQ--LKSDIPDS 315

Query: 243 TVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFN 290
                    +P +   Y++EG    Y GF   ++R  P   I LV F 
Sbjct: 316 I----QRRLFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSFE 359

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 77/174 (44%), Gaps = 11/174 (6%)

Query: 8   FIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFS 67
           F+ Q  +   AG +   +  P+ VVKTR+ LQ   G      Y G  D   ++  +EGF 
Sbjct: 176 FVAQSCAAITAGAASTTLTNPIWVVKTRLMLQSNLGEHP-THYKGTFDAFRKLFYQEGFK 234

Query: 68  RLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQIS----ILSGSLAGVTE 123
            LY G+  P L+     A  F   +  +  F   Y  +  T  I+    I++ S++ +  
Sbjct: 235 ALYAGL-VPSLLGLFHVAIHFPIYEDLKVRFH-CYSRENNTNSINLQRLIMASSVSKMIA 292

Query: 124 ACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRET----GILSLYNGLESTMWR 173
           + V  P E+++ R+Q  +   +     +F  I+ T    G+   Y+G  + + R
Sbjct: 293 SAVTYPHEILRTRMQLKSDIPDSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVR 346

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 79/192 (41%), Gaps = 41/192 (21%)

Query: 108 TQQISILSGSLAGVTEACVIVPFELVKIRLQD--VNSKFNGP-----MEVVFKTIRETGI 160
           + QI+ LSG+ AG      + P ++ K RLQ   + ++F  P     M  +   +R+ G 
Sbjct: 76  STQITALSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGP 135

Query: 161 LSLYNGLESTMWRNAFWNGGYFG---VIFQI--------RALLPKAKTNTEKTTNDLIAG 209
             LY GL   +        GYF    + F +          + P+          D +A 
Sbjct: 136 RGLYKGLVPIVL-------GYFPTWMIYFSVYEFSKKFFHGIFPQF---------DFVAQ 179

Query: 210 TIGGYCRYSTEHTILS---VVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTA 266
           +       +   T+ +   VVK+R+   +      G     Y  T+ +  K++ +EGF A
Sbjct: 180 SCAAITAGAASTTLTNPIWVVKTRLMLQSNL----GEHPTHYKGTFDAFRKLFYQEGFKA 235

Query: 267 LYKGFIPKILRL 278
           LY G +P +L L
Sbjct: 236 LYAGLVPSLLGL 247

 Score = 32.3 bits (72), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 32/74 (43%), Gaps = 3/74 (4%)

Query: 224 LSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGG 283
           L V K+R+Q+    T  +    P Y     +L  I  +EG   LYKG +P +L   P   
Sbjct: 98  LDVAKTRLQAQGLQTRFEN---PYYRGIMGTLSTIVRDEGPRGLYKGLVPIVLGYFPTWM 154

Query: 284 IMLVVFNGMMAFFQ 297
           I   V+     FF 
Sbjct: 155 IYFSVYEFSKKFFH 168

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score = 63.2 bits (152), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 63/284 (22%), Positives = 116/284 (40%), Gaps = 27/284 (9%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71
           F++G  A    + V  P ++VKTRMQLQ      +   Y      LG I K EG   L +
Sbjct: 27  FIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNPFQALGVIFKNEGVKGLQR 86

Query: 72  GISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQ-----ISILSGSLAGVTEACV 126
           G+ S  + +     ++    +  + +    +  +    +     +++ +G+ +G+  A V
Sbjct: 87  GLVSAYVYQIGLNGSRLGFYEPIRTVLNKTFFPESDPHKLQNVAVNVTAGATSGIIGAIV 146

Query: 127 IVPFELVKIRLQDVNSKFNGPMEVVFKTI--------RETGILSLYNGLESTMWRNAFWN 178
             P  LVK R+Q  ++      +  + ++        ++ G+L L+ G+++ + R    +
Sbjct: 147 GSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKEGVLGLFRGVDAAILRTGAGS 206

Query: 179 GGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRI--QSGAT 236
                +    +  L +     E T   L++ T+ G            VV +R+  Q G T
Sbjct: 207 SVQLPIYNTTKNFLLQNDIMKEGTALHLLSSTVTGLG-VGIVMNPWDVVLTRVYNQKGNT 265

Query: 237 TTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGP 280
                      Y      +FK    EG  ALYKGF  ++ R+ P
Sbjct: 266 -----------YKGPIDCMFKTIKIEGIGALYKGFGAQLFRIAP 298

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 55/206 (26%), Positives = 88/206 (42%), Gaps = 18/206 (8%)

Query: 105 DKLTQQISILSGSLAGVTEACVIVPFELVKIRLQ------DVNSK-FNGPMEVVFKTIRE 157
            K+++  S ++G LA      V  PFELVK R+Q        N + +  P + +    + 
Sbjct: 19  QKVSKVGSFIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNPFQALGVIFKN 78

Query: 158 TGILSLYNGLESTMWRNAFWNGGYFGVIFQIRALLPKA---KTNTEKTTN---DLIAGTI 211
            G+  L  GL S        NG   G    IR +L K    +++  K  N   ++ AG  
Sbjct: 79  EGVKGLQRGLVSAYVYQIGLNGSRLGFYEPIRTVLNKTFFPESDPHKLQNVAVNVTAGAT 138

Query: 212 GGYCRYSTEHTILSVVKSRIQSGATT-TLADGTVVPKYNWTWPSLFKIYSEEGFTALYKG 270
            G    +   + L +VK+R+QS +    + + T    Y      L  I+ +EG   L++G
Sbjct: 139 SGIIG-AIVGSPLFLVKTRMQSYSNAIKIGEQT---HYTSMSNGLATIFKKEGVLGLFRG 194

Query: 271 FIPKILRLGPGGGIMLVVFNGMMAFF 296
               ILR G G  + L ++N    F 
Sbjct: 195 VDAAILRTGAGSSVQLPIYNTTKNFL 220

>Kwal_27.12081
          Length = 369

 Score = 63.2 bits (152), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 85/185 (45%), Gaps = 22/185 (11%)

Query: 7   PFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGF 66
           P+I+  +S A AG +      P+ ++KTR+QL      G    Y    DCL  I+++EGF
Sbjct: 167 PWIH-LISAATAGWATSTATNPIWLIKTRLQL---DKAGHTRQYKNSWDCLKHIIQKEGF 222

Query: 67  SRLYKGISSP-----------MLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILS 115
             LYKG+S+            +L E  K+  K    + +  + +      +  ++    S
Sbjct: 223 FGLYKGLSASYLGSVEGILQWLLYEQMKQMIKMRSIEKFGHISEGEKNTSEKIKEWCQRS 282

Query: 116 GS--LAGVTEACVIVPFELVKIR-----LQDVNSKFNGPMEVVFKTIRETGILSLYNGLE 168
           GS  LA    + V  P E+V+ R     L++   K+ G ++     I+E G+ S+Y GL 
Sbjct: 283 GSAGLAKFLASIVTYPHEVVRTRLRQAPLENDKLKYTGLIQSFRVIIKEEGLASMYGGLT 342

Query: 169 STMWR 173
             + R
Sbjct: 343 PHLLR 347

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 72/322 (22%), Positives = 134/322 (41%), Gaps = 59/322 (18%)

Query: 7   PFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDC---------- 56
           P+++ FV+G A G++  +V  P DVVKTR+Q  V   T + +++N   +           
Sbjct: 52  PWVH-FVAGGAGGMAGAIVTCPFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRE 110

Query: 57  ----LGQIVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQIS 112
               +  + K EGF  L+KG+   ++   P R+  F    + ++++   +   +    I 
Sbjct: 111 TFGIISNLYKLEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKQIYSRAFNNGEEAPWIH 170

Query: 113 ILSGSLAGVTEACVIVPFELVKIRLQ----DVNSKFNGPMEVVFKTIRETGILSLYNGLE 168
           ++S + AG   +    P  L+K RLQ        ++    + +   I++ G   LY GL 
Sbjct: 171 LISAATAGWATSTATNPIWLIKTRLQLDKAGHTRQYKNSWDCLKHIIQKEGFFGLYKGL- 229

Query: 169 STMWRNAFWNGGYFGVI-----------FQIRAL-----LPKAKTNTEKTTNDL------ 206
                +A + G   G++            ++R++     + + + NT +   +       
Sbjct: 230 -----SASYLGSVEGILQWLLYEQMKQMIKMRSIEKFGHISEGEKNTSEKIKEWCQRSGS 284

Query: 207 --IAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGF 264
             +A  +     Y  E     VV++R++      L +  +  KY     S   I  EEG 
Sbjct: 285 AGLAKFLASIVTYPHE-----VVRTRLRQAP---LENDKL--KYTGLIQSFRVIIKEEGL 334

Query: 265 TALYKGFIPKILRLGPGGGIML 286
            ++Y G  P +LR  P   IM 
Sbjct: 335 ASMYGGLTPHLLRTVPNSIIMF 356

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 43/88 (48%), Gaps = 5/88 (5%)

Query: 17  AAGVSELL---VMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGI 73
           +AG+++ L   V YP +VV+TR  L+        + Y G+I     I+K EG + +Y G+
Sbjct: 284 SAGLAKFLASIVTYPHEVVRTR--LRQAPLENDKLKYTGLIQSFRVIIKEEGLASMYGGL 341

Query: 74  SSPMLMEAPKRATKFACNDSYQKMFKDL 101
           +  +L   P     F   +   K+  D+
Sbjct: 342 TPHLLRTVPNSIIMFGTWELVIKLLSDV 369

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score = 62.8 bits (151), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 66/284 (23%), Positives = 116/284 (40%), Gaps = 27/284 (9%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71
           F +G  A    + V  P++VVK RMQLQ      +   Y      +G + + EG   L K
Sbjct: 22  FTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQK 81

Query: 72  GISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQ-----ISILSGSLAGVTEACV 126
           G+ +  + +     ++    +  + +    +  D+ + +     I++ +G+ +G+  A +
Sbjct: 82  GLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVM 141

Query: 127 IVPFELVKIRLQDVNSKFNGPMEVVF-------KTIRET-GILSLYNGLESTMWRNAFWN 178
             P  LVK RLQ  ++      +  +       KTI  T G+  L+ G+++ + R    +
Sbjct: 142 GSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGS 201

Query: 179 GGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRI--QSGAT 236
                +    +  L +     +  +  L A TI G    +       V+ +RI  Q G  
Sbjct: 202 SVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISG-LGVAVVMNPWDVILTRIYNQKGDL 260

Query: 237 TTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGP 280
                      Y      L K    EG TALYKGF  ++ R+GP
Sbjct: 261 -----------YKGPIDCLVKTVKIEGITALYKGFEAQVFRIGP 293

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 92/216 (42%), Gaps = 26/216 (12%)

Query: 103 GVDKL----TQQISILSGSLAGVTEACVIV----PFELVKIRLQ------DVNSK-FNGP 147
           G DK+     Q++S      AG   AC+ V    P E+VKIR+Q        N + +  P
Sbjct: 4   GEDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNP 63

Query: 148 MEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRALL-----PKAKTNTEKT 202
            + +    R  GI  L  GL +        NG   G    IRA++     P  +++  ++
Sbjct: 64  FQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQS 123

Query: 203 TN-DLIAGTIGGYCRYSTEHTILSVVKSRIQSGATT-TLADGTVVPKYNWTWPSLFKIYS 260
              ++ AG   G    +   + L +VK+R+QS +    + + T    Y   W  L  IY 
Sbjct: 124 VGINVFAGAASGIIG-AVMGSPLFLVKTRLQSYSNAIKIGEQT---HYTGVWNGLKTIYM 179

Query: 261 EEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFF 296
            EG   L++G    ILR G G  + L ++N    F 
Sbjct: 180 TEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFL 215

>Sklu_2117.2 YDL198C, Contig c2117 3737-4633
          Length = 298

 Score = 62.8 bits (151), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 69/275 (25%), Positives = 119/275 (43%), Gaps = 25/275 (9%)

Query: 16  AAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVI--DCLGQIVKREGFSRLYKGI 73
           A+AG+ E+ V +P+D +  R+ +   +  GS    N VI  +   + + +  F+ L+ G+
Sbjct: 17  ASAGILEIGVFHPVDTISKRL-MSNHTKIGSSSQLNSVIFREHAAEPLSKRVFT-LFPGL 74

Query: 74  SSPMLMEAPKRATKFA--------CNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEAC 125
                 +  +R  K+          N +++  F + +G        S  +GS+ G+ E  
Sbjct: 75  GYAATYKILQRVYKYGGQPFANEFLNRNFKADFDNTFGEKTGKALRSATAGSMIGIGE-I 133

Query: 126 VIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVI 185
           V++P +++KI+ Q     F G   V  K +++ G L LY G   T  RNA  +   FG  
Sbjct: 134 VLLPLDVLKIKRQTNPEAFKGRGFV--KILKDEG-LGLYRGWGWTAARNAPGSFALFGGN 190

Query: 186 FQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVV 245
              +  +   K  ++ T +     +I G          L V+K+RIQ+        G  +
Sbjct: 191 AFAKEYILGLKDYSQATWSQNFVSSIVGASASLIISAPLDVIKTRIQNKNFENPESGFTI 250

Query: 246 PKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGP 280
            K              EGF+A +KG  PK+L  GP
Sbjct: 251 VK---------NTLKNEGFSAFFKGLTPKLLTTGP 276

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 43/91 (47%), Gaps = 6/91 (6%)

Query: 11  QFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLY 70
            FVS      + L++  PLDV+KTR+Q +      SG         +   +K EGFS  +
Sbjct: 211 NFVSSIVGASASLIISAPLDVIKTRIQNKNFENPESG------FTIVKNTLKNEGFSAFF 264

Query: 71  KGISSPMLMEAPKRATKFACNDSYQKMFKDL 101
           KG++  +L   PK    FA   +   +F +L
Sbjct: 265 KGLTPKLLTTGPKLVFSFALAQTLIPVFDNL 295

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score = 62.8 bits (151), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 78/310 (25%), Positives = 122/310 (39%), Gaps = 42/310 (13%)

Query: 13  VSGAAAGVSELLVMYPLDVVKTRMQLQ-VGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71
           +SGA +G    +++ P DV KTR+Q Q + + T     Y G       I K EG + LYK
Sbjct: 43  ISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFKDEGAAGLYK 102

Query: 72  GISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIVPFE 131
           G+   +L   P     F+  D  +K   D++         S  S   AG        P  
Sbjct: 103 GLQPTVLGYIPTLMIYFSVYDFCRKYSVDIFPHSPFLSNAS--SAITAGAISTVATNPIW 160

Query: 132 LVKIRLQ------DVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVI 185
           +VK RL         ++ + G ++   K I++ G  +LY GL   +        G   V 
Sbjct: 161 VVKTRLMLQTGIGKYSTHYKGTIDTFRKIIQQEGAKALYAGLVPALL-------GMLNVA 213

Query: 186 FQ--------IR-ALLPKAKTNTEKTTND---LIAGTIGGYCRYSTEHTILSVVKSRIQ- 232
            Q        IR         +T+ T+++   LI  ++      ST      ++++R+Q 
Sbjct: 214 IQFPLYENLKIRFGYSESTDVSTDVTSSNFQKLILASMLSKMVASTVTYPHEILRTRMQL 273

Query: 233 SGATTTLADGTVVPKYNWTWPSLFKI-YSEEGFTALYKGFIPKILRLGPGGGIMLVVFN- 290
                      ++P        L KI Y +EGF   Y GF   ++R  P   + LV F  
Sbjct: 274 KSDLPNTVQRHLLP--------LIKITYRQEGFAGFYSGFATNLVRTVPAAVVTLVSFEY 325

Query: 291 ---GMMAFFQ 297
               +  FFQ
Sbjct: 326 SKKYLTTFFQ 335

 Score = 58.9 bits (141), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 81/177 (45%), Gaps = 12/177 (6%)

Query: 7   PFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGF 66
           PF+    S   AG    +   P+ VVKTR+ LQ G G  S   Y G ID   +I+++EG 
Sbjct: 137 PFLSNASSAITAGAISTVATNPIWVVKTRLMLQTGIGKYS-THYKGTIDTFRKIIQQEGA 195

Query: 67  SRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQIS------ILSGSLAG 120
             LY G+  P L+     A +F   ++ +  F      D  T   S      IL+  L+ 
Sbjct: 196 KALYAGL-VPALLGMLNVAIQFPLYENLKIRFGYSESTDVSTDVTSSNFQKLILASMLSK 254

Query: 121 VTEACVIVPFELVKIRLQ---DV-NSKFNGPMEVVFKTIRETGILSLYNGLESTMWR 173
           +  + V  P E+++ R+Q   D+ N+     + ++  T R+ G    Y+G  + + R
Sbjct: 255 MVASTVTYPHEILRTRMQLKSDLPNTVQRHLLPLIKITYRQEGFAGFYSGFATNLVR 311

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 79/199 (39%), Gaps = 62/199 (31%)

Query: 110 QISILSGSLAGVTEACVIVPFELVKIRLQDVNSK-----------FNGPMEVVFKTIRET 158
           +++ +SG+L+G   A ++ PF++ K RLQ    +           F G    +FK   + 
Sbjct: 39  RVAAISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFK---DE 95

Query: 159 GILSLYNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCR-Y 217
           G   LY GL+ T+        GY   +                    +I  ++  +CR Y
Sbjct: 96  GAAGLYKGLQPTVL-------GYIPTL--------------------MIYFSVYDFCRKY 128

Query: 218 STE---HT-ILSVVKSRIQSGATTTLAD----------------GTVVPKYNWTWPSLFK 257
           S +   H+  LS   S I +GA +T+A                 G     Y  T  +  K
Sbjct: 129 SVDIFPHSPFLSNASSAITAGAISTVATNPIWVVKTRLMLQTGIGKYSTHYKGTIDTFRK 188

Query: 258 IYSEEGFTALYKGFIPKIL 276
           I  +EG  ALY G +P +L
Sbjct: 189 IIQQEGAKALYAGLVPALL 207

>Kwal_0.232
          Length = 274

 Score = 62.4 bits (150), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 76/299 (25%), Positives = 128/299 (42%), Gaps = 53/299 (17%)

Query: 8   FIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFS 67
           FI   ++GAAAG S  L  +P+D +KTR+Q         G   NG            G+ 
Sbjct: 6   FITSLLAGAAAGTSTDLFFFPIDTLKTRLQ------AAGGFFANG------------GYL 47

Query: 68  RLYKGISSPMLMEAPKRATKFACND---SYQK-MFKDLY-GVDKLTQQISILSGSLAGVT 122
            +Y+G+ S ++  AP  +  F   D   SY + +F +L    D++ +  + +  S AG  
Sbjct: 48  GVYRGLGSAVVASAPSASLFFVTYDGMKSYSRPIFNNLITSSDQVAETATHMFSSSAGEI 107

Query: 123 EACVI-VPFELVKIRLQDVNSKFNGPMEVVFKTIRE---TGI-LSLYNGLESTMWRNAFW 177
            AC++ VP E++K R Q    K +  ++ + K ++     GI  +LY G  +T+ R    
Sbjct: 108 AACMVRVPAEVIKQRTQ--THKSDSSLQTLKKLLQNENGEGIRRNLYRGWSTTVMREI-- 163

Query: 178 NGGYFGVIFQIRALLPK------AKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRI 231
              +  + F +   L K       +               GG    +T  T L V+K+R+
Sbjct: 164 --PFTCIQFPLYEFLKKQWAISGGREQVAPWQGAFCGCVAGGIAAATT--TPLDVLKTRL 219

Query: 232 QSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFN 290
                  +   T VP  +       +IY+ EG+   + G  P+ + +  GG I L V+ 
Sbjct: 220 -------MLSHTSVPVLHLA----RQIYATEGWKVFFSGVGPRTVWISAGGAIFLGVYE 267

>Kwal_55.20868
          Length = 380

 Score = 63.2 bits (152), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 72/300 (24%), Positives = 120/300 (40%), Gaps = 18/300 (6%)

Query: 13  VSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKG 72
           +SGA AG    + + PLDV KTR+Q Q G  +     Y G++  L  I++ EG   LYKG
Sbjct: 80  LSGAMAGFLAGVTVCPLDVAKTRLQAQ-GLHSNPSNYYKGILGTLTTIIRDEGARGLYKG 138

Query: 73  ISSPMLMEAPKRATKFACNDSYQKMFKDLY-GVDKLTQQISILSGSLAGVTEACVIVPFE 131
           +   ++   P     F+  +  +K++  ++   D ++   S L+   AG     +  P  
Sbjct: 139 LVPIIMGYFPTWMIYFSVYERSKKLYPRIFPSFDFISHSASALT---AGTVSTILTNPVW 195

Query: 132 LVKIRLQ---DVN---SKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVI 185
           +VK RL     VN   + +    +   K     G+ + Y GL  ++    F    +F + 
Sbjct: 196 VVKTRLMLQTHVNKNSTHYTSTFDAFHKMYTTEGLRTFYAGLLPSLL-GLFHVAIHFPIY 254

Query: 186 FQIRALL---PKAKTNTEKTTN--DLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLA 240
            +++  L   P      +   N   LI  +       ST      ++++R+Q  A  T  
Sbjct: 255 EKLKVWLHCTPSMSRTEDHNLNLARLIIASSASKMVASTLTYPHEILRTRMQLKAYPTDP 314

Query: 241 DGTVVPKYNWTWPSLFK-IYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFFQEM 299
              +          L K  Y  EG    Y GF   + R  P   I LV F     +  ++
Sbjct: 315 LAALQKTSRHGLIRLIKHTYKSEGLRGFYSGFTANLARTLPASAITLVSFEYFRKYLTKL 374

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 82/183 (44%), Gaps = 28/183 (15%)

Query: 110 QISILSGSLAGVTEACVIVPFELVKIRLQ------DVNSKFNGPMEVVFKTIRETGILSL 163
           +I+ LSG++AG      + P ++ K RLQ      + ++ + G +  +   IR+ G   L
Sbjct: 76  EITALSGAMAGFLAGVTVCPLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDEGARGL 135

Query: 164 YNGLEST-MWRNAFWNGGYFGVIFQIRALLPKAKTNTE---KTTNDLIAGTIGGYCRYST 219
           Y GL    M     W   YF V  + + L P+   + +    + + L AGT+        
Sbjct: 136 YKGLVPIIMGYFPTW-MIYFSVYERSKKLYPRIFPSFDFISHSASALTAGTVS------- 187

Query: 220 EHTILS----VVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKI 275
             TIL+    VVK+R+    T    + T    Y  T+ +  K+Y+ EG    Y G +P +
Sbjct: 188 --TILTNPVWVVKTRLML-QTHVNKNST---HYTSTFDAFHKMYTTEGLRTFYAGLLPSL 241

Query: 276 LRL 278
           L L
Sbjct: 242 LGL 244

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 74/180 (41%), Gaps = 15/180 (8%)

Query: 8   FIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFS 67
           FI    S   AG    ++  P+ VVKTR+ LQ      S   Y    D   ++   EG  
Sbjct: 173 FISHSASALTAGTVSTILTNPVWVVKTRLMLQTHVNKNS-THYTSTFDAFHKMYTTEGLR 231

Query: 68  RLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQIS--------ILSGSLA 119
             Y G+  P L+     A  F     Y+K+   L+    +++           I++ S +
Sbjct: 232 TFYAGL-LPSLLGLFHVAIHFPI---YEKLKVWLHCTPSMSRTEDHNLNLARLIIASSAS 287

Query: 120 GVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNG 179
            +  + +  P E+++ R+Q + +    P+  + KT R  G++ L      +     F++G
Sbjct: 288 KMVASTLTYPHEILRTRMQ-LKAYPTDPLAALQKTSRH-GLIRLIKHTYKSEGLRGFYSG 345

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score = 62.8 bits (151), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 72/305 (23%), Positives = 136/305 (44%), Gaps = 26/305 (8%)

Query: 7   PFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGF 66
           P   + +SG  AG    +  +PLD+VK R+QL   +    G  Y  V+  + +  K+  F
Sbjct: 7   PVQKEMISGLTAGTITTVSTHPLDLVKVRLQLLATNKKPQG--YYDVVKRIVKDSKQHSF 64

Query: 67  SR-LYKGISSPMLMEAPK--------RATK---FACNDSYQKMFKDLYGVDK-LTQQISI 113
            R  Y+G+   +L  +          RA+K   F   ++  K F +    DK +T  + +
Sbjct: 65  FRETYRGLGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKEMTSLMYL 124

Query: 114 LSGSLAGVTEACVIVPFELVKIRLQD---VNSK-FNGPMEVVFKTIRETGILSLYNGLES 169
           L+ +++GV  + +  P  ++K R+     V+S+ +   ++ + K  R  G+   + GL  
Sbjct: 125 LAAAMSGVATSVLTNPIWVIKTRIMSTSFVDSRSYRSTVDGIKKLYRIEGLAGFWRGLVP 184

Query: 170 TMWRNAFWNGGYFGVIFQIRALLPKAK-TNTEKTTNDLIAGTIGGYCRYSTEHTI--LSV 226
           +++        YF V   ++     AK  + +K  ++L   TI    +  +   +  L +
Sbjct: 185 SLF-GVSQGAIYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITITSLSKMVSVTAVYPLQL 243

Query: 227 VKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIML 286
           +KS +QS   +T+ +     +    W  +  IY  +G T LYKG +  ++R  P   I  
Sbjct: 244 LKSNLQSFEVSTVINPKTSHR---VWKLITTIYVRDGVTGLYKGLLANLIRAVPSTCITF 300

Query: 287 VVFNG 291
            V+  
Sbjct: 301 CVYEN 305

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 83/182 (45%), Gaps = 14/182 (7%)

Query: 2   SEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIV 61
           ++K +  +   ++ A +GV+  ++  P+ V+KTR+   + +      +Y   +D + ++ 
Sbjct: 114 NDKEMTSLMYLLAAAMSGVATSVLTNPIWVIKTRI---MSTSFVDSRSYRSTVDGIKKLY 170

Query: 62  KREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVD---KLTQQISILSGSL 118
           + EG +  ++G+  P L    + A  F   D+ +  +     VD   KL+    I   SL
Sbjct: 171 RIEGLAGFWRGL-VPSLFGVSQGAIYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITITSL 229

Query: 119 AGVTEACVIVPFELVKIRLQD------VNSKFNGPMEVVFKTIR-ETGILSLYNGLESTM 171
           + +     + P +L+K  LQ       +N K +  +  +  TI    G+  LY GL + +
Sbjct: 230 SKMVSVTAVYPLQLLKSNLQSFEVSTVINPKTSHRVWKLITTIYVRDGVTGLYKGLLANL 289

Query: 172 WR 173
            R
Sbjct: 290 IR 291

 Score = 28.9 bits (63), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 16/72 (22%), Positives = 36/72 (50%), Gaps = 2/72 (2%)

Query: 26  MYPLDVVKTRMQ-LQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGISSPMLMEAPKR 84
           +YPL ++K+ +Q  +V +      ++  V   +  I  R+G + LYKG+ + ++   P  
Sbjct: 238 VYPLQLLKSNLQSFEVSTVINPKTSHR-VWKLITTIYVRDGVTGLYKGLLANLIRAVPST 296

Query: 85  ATKFACNDSYQK 96
              F   ++++ 
Sbjct: 297 CITFCVYENFRH 308

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score = 62.4 bits (150), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 99/227 (43%), Gaps = 23/227 (10%)

Query: 26  MYPLDVVKTRMQLQVGSGTGSGVAYN-GVIDCLGQIVKREGFSRLYKGISSPMLMEAPKR 84
           M P+DVVKTR+QL+          YN G++    QI+  EG   L  G    +L  + + 
Sbjct: 35  MVPIDVVKTRIQLEP-------TVYNKGMVGSFKQIIAGEGAGALLTGFGPTLLGYSIQG 87

Query: 85  ATKFACNDSYQKMFKDLYGVDKLTQ---QISILSGSLAGVTEACVIVPFELVKIRLQDVN 141
           A KF   + ++K F D  G D  ++    + + S ++A       + P E  +IRL    
Sbjct: 88  AFKFGGYEVFKKFFIDNLGYDTASRYKNSVYMGSAAMAEFLADIALCPLEATRIRLVSQP 147

Query: 142 SKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRALL------PKA 195
              NG +    + ++E GI S Y+G    +++   +N   F ++F+  +        PK 
Sbjct: 148 QFANGLVGGFSRILKEEGIGSFYSGFTPILFKQIPYNIAKF-LVFERASEFYYGFAGPKE 206

Query: 196 KTNTEKTT-----NDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATT 237
           K ++  TT     + L AG          +  +  V K++   G +T
Sbjct: 207 KLSSTSTTLLNLLSGLTAGLAAAIVSQPADTLLSKVNKTKKAPGQST 253

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 75/188 (39%), Gaps = 16/188 (8%)

Query: 114 LSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTI-RETGILSLYNGLESTMW 172
           L+G++   +    +VP ++VK R+Q   + +N  M   FK I    G  +L  G   T+ 
Sbjct: 22  LAGAIGCGSTHSSMVPIDVVKTRIQLEPTVYNKGMVGSFKQIIAGEGAGALLTGFGPTLL 81

Query: 173 ----RNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVK 228
               + AF  GGY   +F+   +         +  N +  G+      +  +  +  +  
Sbjct: 82  GYSIQGAFKFGGY--EVFKKFFIDNLGYDTASRYKNSVYMGS-AAMAEFLADIALCPLEA 138

Query: 229 SRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVV 288
           +RI+  +    A+G V            +I  EEG  + Y GF P + +  P      +V
Sbjct: 139 TRIRLVSQPQFANGLV--------GGFSRILKEEGIGSFYSGFTPILFKQIPYNIAKFLV 190

Query: 289 FNGMMAFF 296
           F     F+
Sbjct: 191 FERASEFY 198

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 62.8 bits (151), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 74/305 (24%), Positives = 123/305 (40%), Gaps = 65/305 (21%)

Query: 28  PLDVVKTRMQLQVGSG-------TGSGVAYNGVID------CLGQIVKREGFSRLYKGIS 74
           P DVVKTR+Q  V  G         + V Y G++        +  +  +EGF  L+KG+ 
Sbjct: 69  PFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKGLG 128

Query: 75  SPMLMEAPKRATKF----ACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIVPF 130
             ++   P R+  F       D+  ++  D     +    I  L+G+ AG   +    P 
Sbjct: 129 PNLVGVIPARSINFFTYGVTKDTASRLLND----GQEAPWIHFLAGATAGWATSTATNPI 184

Query: 131 ELVKIRLQ-----DVNS-KFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFG- 183
            LVK RLQ     D  S ++    + +   +R  GIL LY GL ++          Y G 
Sbjct: 185 WLVKTRLQLDKAADGRSRRYKNSWDCLKGVMRNEGILGLYKGLSAS----------YLGS 234

Query: 184 -------VIFQIRALLPKAKTNTE----KTTNDLIAGTIGGYCRYSTE-------HTILS 225
                  V+++    + + ++  E       N      +  +C+ S          +IL+
Sbjct: 235 VESILQWVLYEQMKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSGSAGAAKLFASILT 294

Query: 226 ----VVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPG 281
               VV++R++        +G +  KY   + S   I  EEGF ++Y G  P ++R  P 
Sbjct: 295 YPHEVVRTRLRQAPK---ENGKL--KYTGLFQSFSLIIKEEGFASMYSGLTPHLMRTVPN 349

Query: 282 GGIML 286
             IM 
Sbjct: 350 SIIMF 354

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 82/185 (44%), Gaps = 20/185 (10%)

Query: 7   PFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGF 66
           P+I+ F++GA AG +      P+ +VKTR+QL   +  G    Y    DCL  +++ EG 
Sbjct: 163 PWIH-FLAGATAGWATSTATNPIWLVKTRLQLD-KAADGRSRRYKNSWDCLKGVMRNEGI 220

Query: 67  SRLYKGISSPMLMEAPK-------RATKFACNDSYQKMFKDLYGVDKLT----QQISILS 115
             LYKG+S+  L               K        + F D+   +K T    ++    S
Sbjct: 221 LGLYKGLSASYLGSVESILQWVLYEQMKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRS 280

Query: 116 GS--LAGVTEACVIVPFELVKIRLQDVNS-----KFNGPMEVVFKTIRETGILSLYNGLE 168
           GS   A +  + +  P E+V+ RL+         K+ G  +     I+E G  S+Y+GL 
Sbjct: 281 GSAGAAKLFASILTYPHEVVRTRLRQAPKENGKLKYTGLFQSFSLIIKEEGFASMYSGLT 340

Query: 169 STMWR 173
             + R
Sbjct: 341 PHLMR 345

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 38/75 (50%), Gaps = 2/75 (2%)

Query: 14  SGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGI 73
           S  AA +   ++ YP +VV+TR++ Q     G  + Y G+      I+K EGF+ +Y G+
Sbjct: 282 SAGAAKLFASILTYPHEVVRTRLR-QAPKENGK-LKYTGLFQSFSLIIKEEGFASMYSGL 339

Query: 74  SSPMLMEAPKRATKF 88
           +  ++   P     F
Sbjct: 340 TPHLMRTVPNSIIMF 354

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 62.4 bits (150), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 83/329 (25%), Positives = 133/329 (40%), Gaps = 61/329 (18%)

Query: 13  VSGAAAGVSELLVMYPLDVVKTRMQLQ-----------VGS--GTGSGVAYNGVIDCLGQ 59
           +SGA AG    +++ PLDV KTR+Q Q           VGS   T  G  Y+G+   L  
Sbjct: 108 LSGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSGIWGTLTT 167

Query: 60  IVKREGFSRLYKGISSPMLMEAPKRATKFA----CNDSYQKMFKDLYGVDKLTQQISILS 115
           IV+ E    LYKGI   +L   P     F+    C  SY + F +    + L+  +S L+
Sbjct: 168 IVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCKLSYPRYFNN---SEFLSHSMSALT 224

Query: 116 GSLAGVTEACVIVPFELVKIRLQDVNSK-------FNGPMEVVFKTIRETGILSLYNGLE 168
              AG     +  P  +VK RL   + K       +   ++   K  +  GI S Y+GL 
Sbjct: 225 ---AGAISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIKSFYSGLI 281

Query: 169 STMWRNAFWNGGYFGVIFQIRALL---PKAKTNTEK-------------TTN----DLIA 208
            +++        +F V  +++ +L   P  + N E              +TN     LI 
Sbjct: 282 PSLF-GLLHVAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTTGSTNFQLGRLIV 340

Query: 209 GTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALY 268
            + G     ST      ++++R+Q  +    +  +++             Y++EG    Y
Sbjct: 341 ASCGSKMIASTLTYPHEILRTRLQLKSDMKPSIKSIIR----------TTYAKEGIRGFY 390

Query: 269 KGFIPKILRLGPGGGIMLVVFNGMMAFFQ 297
            GF+  + R  P   I LV F      F+
Sbjct: 391 SGFLTNMFRTVPASAITLVSFEYFRKHFK 419

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 78/191 (40%), Gaps = 29/191 (15%)

Query: 110 QISILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPME-------------------- 149
           +I+ LSG+LAG     ++ P ++ K RLQ    + NGP+                     
Sbjct: 104 EITALSGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSGIWG 163

Query: 150 VVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAG 209
            +   +R+  I  LY G+   +         YF V  + +   P+   N+E  ++ + A 
Sbjct: 164 TLTTIVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCKLSYPRYFNNSEFLSHSMSAL 223

Query: 210 TIGGYCRYSTEHTILSVVKSR--IQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTAL 267
           T G     +T    + VVK+R  +QSG          +  Y  T  +  KIY  EG  + 
Sbjct: 224 TAGAIS--TTLTNPIWVVKTRLMLQSGKNI-----KGMTHYKNTLDAFIKIYKVEGIKSF 276

Query: 268 YKGFIPKILRL 278
           Y G IP +  L
Sbjct: 277 YSGLIPSLFGL 287

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 71/187 (37%), Gaps = 23/187 (12%)

Query: 8   FIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFS 67
           F+   +S   AG     +  P+ VVKTR+ LQ G        Y   +D   +I K EG  
Sbjct: 215 FLSHSMSALTAGAISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIK 274

Query: 68  RLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGS----LAGVTE 123
             Y G+  P L      A  F   +  +K+    Y   +  Q+   ++G+      G T 
Sbjct: 275 SFYSGL-IPSLFGLLHVAIHFPVYEKLKKVLH-CYPSGRPNQETMNVNGNSNPQTTGSTN 332

Query: 124 -----------------ACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNG 166
                            + +  P E+++ RLQ  +        ++  T  + GI   Y+G
Sbjct: 333 FQLGRLIVASCGSKMIASTLTYPHEILRTRLQLKSDMKPSIKSIIRTTYAKEGIRGFYSG 392

Query: 167 LESTMWR 173
             + M+R
Sbjct: 393 FLTNMFR 399

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 61.6 bits (148), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 73/307 (23%), Positives = 132/307 (42%), Gaps = 47/307 (15%)

Query: 1   MSEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQI 60
           MSEK + + + +  G AAG+  ++  +PLD+ K R+Q        + +    ++  L  I
Sbjct: 1   MSEKQVKYPWWY--GGAAGIFAVMNTHPLDLTKVRLQ-------AAPIPKPTIVQMLRSI 51

Query: 61  VKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQ-----ISILS 115
           +K EG   LY G+S+ +L +      +F   D+ +   + +   DKLT        S++S
Sbjct: 52  LKNEGIVGLYAGLSASLLRQCTYTTARFGMYDALK---EHVIPRDKLTNMWYLLGASMVS 108

Query: 116 GSLAGVTEACVIVPFELVKIRLQ-------DVNSKFNGPMEVVFKTIRETGILSLY-NGL 167
           G+L G+         +L+ IR+Q       D    +   ++ + K  +  G  SL+  G 
Sbjct: 109 GALGGLAGNFA----DLINIRMQNDSALPLDKRRNYKNAIDGMVKIYKAEGAKSLFLTGW 164

Query: 168 ESTMWRNAFWNGGYFGVIFQIRA-LLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSV 226
           +  M R               +  L+ K   + +K +  L +  + G+   +T  +   V
Sbjct: 165 KPNMVRGVLMTASQVVTYDMFKNFLVTKYNMDPKKNSTHLTSSLLAGFVA-TTVCSPADV 223

Query: 227 VKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSE----EGFTALYKGFIPKILRLGPGG 282
           +K        T + +    P +N    S FKI  E    EG + +++G++P   RL P  
Sbjct: 224 IK--------TIVMNAHKKPGHNHD--SSFKILMEAINKEGPSFMFRGWVPSFTRLAP-- 271

Query: 283 GIMLVVF 289
             ML+ F
Sbjct: 272 FTMLIFF 278

>Scas_582.7
          Length = 329

 Score = 62.0 bits (149), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 71/291 (24%), Positives = 120/291 (41%), Gaps = 8/291 (2%)

Query: 7   PFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGF 66
           P  +Q ++GA AG+ E   M+P+D +KTR+Q     GT        +I  + +I   EG 
Sbjct: 35  PLSHQLLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQ--TSTSIIKQISKISTMEGS 92

Query: 67  SRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISI-LSGSLAGVTEAC 125
             L+KG+ S +L   P  A  FA  + + K         +  Q I + +SG+ A V    
Sbjct: 93  LALWKGVQSVILGAGPAHAVYFATYE-FTKAHLIPDSQRETHQPIKVAVSGATATVASDF 151

Query: 126 VIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVI 185
            + PF+ +K R+Q  + K      V  K     G+ + Y    +T+  N  +    F +I
Sbjct: 152 FMNPFDTIKQRMQISDLKKEKVYNVAKKIYNLEGLSAFYYSYPTTIAMNIPFAAFNF-MI 210

Query: 186 FQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVV 245
           ++  +       +     + L  G  G      T  T L  +K+ IQ   ++ ++   V+
Sbjct: 211 YESASKFFNPLHHYNPLIHCLCGGISGAIAAAVT--TPLDCIKTVIQIRGSSVVS-LEVM 267

Query: 246 PKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFF 296
            K N    +   I    G+   ++G  P+IL   P   I    +     F 
Sbjct: 268 KKANTFKKATSAILMVYGWKGFWRGLQPRILANMPATAISWTAYECAKHFL 318

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 41/195 (21%), Positives = 76/195 (38%), Gaps = 21/195 (10%)

Query: 113 ILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRE-------TGILSLYN 165
           +L+G+ AG+ E   + P + +K R+Q   +K  G  +     I++        G L+L+ 
Sbjct: 40  LLAGAFAGIMEHSTMFPIDALKTRIQSTTTK--GTEQTSTSIIKQISKISTMEGSLALWK 97

Query: 166 GLESTMWRNAFWNGGYFGVI-FQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTIL 224
           G++S +      +  YF    F    L+P ++  T +     ++G               
Sbjct: 98  GVQSVILGAGPAHAVYFATYEFTKAHLIPDSQRETHQPIKVAVSGATATVAS-DFFMNPF 156

Query: 225 SVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGI 284
             +K R+Q      ++D      YN       KIY+ EG +A Y  +   I    P    
Sbjct: 157 DTIKQRMQ------ISDLKKEKVYNVAK----KIYNLEGLSAFYYSYPTTIAMNIPFAAF 206

Query: 285 MLVVFNGMMAFFQEM 299
             +++     FF  +
Sbjct: 207 NFMIYESASKFFNPL 221

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 66/275 (24%), Positives = 111/275 (40%), Gaps = 31/275 (11%)

Query: 28  PLDVVKTRMQ-----LQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGISSPMLMEAP 82
           P++ VK  MQ     L+ GS       Y G++DC  +    EG    ++G ++ +L   P
Sbjct: 33  PIERVKLLMQNQEEMLKQGS---LDTRYKGILDCFKRTATHEGIVSFWRGNTANVLRYFP 89

Query: 83  KRATKFACNDSYQKMFKDLYGVDKLTQQIS--ILSGSLAGVTEACVIVPFELVKIRL--- 137
            +A  FA  D  + +       D   +  +  + SG  AG      +   +  + RL   
Sbjct: 90  TQALNFAFKDKIKSLLSYDRERDGYAKWFAGNLFSGGAAGGLSLLFVYSLDYARTRLAAD 149

Query: 138 -----QDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRALL 192
                     +FNG ++V  KT++  G+L LY G   ++     + G YFG+    + +L
Sbjct: 150 ARGSKSTSQRQFNGLLDVYKKTLKTDGLLGLYRGFVPSVLGIIVYRGLYFGLYDSFKPVL 209

Query: 193 PKAKTNTEKTTNDLIAG--TIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNW 250
                      + L+    T+G     ST    L  V+ R+   +  T+       KY+ 
Sbjct: 210 LTGALEGSFVASFLLGWVITMGA----STASYPLDTVRRRMMMTSGQTI-------KYDG 258

Query: 251 TWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIM 285
               L KI  +EG  +L+KG    I R     G++
Sbjct: 259 ALDCLRKIVQKEGAYSLFKGCGANIFRGVAAAGVI 293

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 83/193 (43%), Gaps = 26/193 (13%)

Query: 8   FIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQV-GSGTGSGVAYNGVIDCLGQIVKREGF 66
           F     SG AAG   LL +Y LD  +TR+     GS + S   +NG++D   + +K +G 
Sbjct: 118 FAGNLFSGGAAGGLSLLFVYSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGL 177

Query: 67  SRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACV 126
             LY+G    +L     R   F   DS++ +   L G  + +   S L G +  +  +  
Sbjct: 178 LGLYRGFVPSVLGIIVYRGLYFGLYDSFKPVL--LTGALEGSFVASFLLGWVITMGASTA 235

Query: 127 IVPFELVKIRLQDVNS---KFNGPMEV--------------------VFKTIRETGILSL 163
             P + V+ R+   +    K++G ++                     +F+ +   G++SL
Sbjct: 236 SYPLDTVRRRMMMTSGQTIKYDGALDCLRKIVQKEGAYSLFKGCGANIFRGVAAAGVISL 295

Query: 164 YNGLESTMWRNAF 176
           Y+ L+  M+   F
Sbjct: 296 YDQLQLIMFGKKF 308

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 66/269 (24%), Positives = 114/269 (42%), Gaps = 37/269 (13%)

Query: 26  MYPLDVVKTRMQLQVGSGTGSGVAYN-GVIDCLGQIVKREGFSRLYKGISSPMLMEAPKR 84
           M P+DVVKTR+QL+          YN G++    +I+  EG   L  G    +L  + + 
Sbjct: 31  MVPIDVVKTRIQLEP-------TVYNKGMVGSFRKIIAEEGAGALLTGFGPTLLGYSIQG 83

Query: 85  ATKFACNDSYQKMFKDLYGVD---KLTQQISILSGSLAGVTEACVIVPFELVKIRLQDVN 141
           A KF   + ++K F D  G D   +    + I S + A       + P E  +IRL    
Sbjct: 84  AFKFGGYEVFKKFFIDTLGYDTAARYKNSVYIGSAAAAEFLADIALCPLEATRIRLVSQP 143

Query: 142 SKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRA------LLPKA 195
           +  NG +    + ++E G+ S Y+G    +++   +N   F ++F+ RA      L P  
Sbjct: 144 TFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKF-LVFE-RASELYFSLAPPK 201

Query: 196 KT--NTEKTTNDLIAGTIGGYCRYSTEH---TILSVVKSRIQSGATTTLADGTVVPKYNW 250
            T   T  T  +L++G   G           T+LS V    ++   +T+           
Sbjct: 202 DTLSQTSLTAINLLSGLTAGLAAAIVSQPADTLLSKVNKTSKAPGQSTVG---------- 251

Query: 251 TWPSLFKIYSEEGFTALYKGFIPKILRLG 279
               LF++  + GF   + G   +++ +G
Sbjct: 252 ---LLFQLAKQLGFVGSFAGLPTRLVMVG 277

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 80/194 (41%), Gaps = 21/194 (10%)

Query: 14  SGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGI 73
           S AAA     + + PL+  + R+  Q           NG++    +I+K EG    Y G 
Sbjct: 117 SAAAAEFLADIALCPLEATRIRLVSQP-------TFANGLVGGFSRILKEEGVGSFYSGF 169

Query: 74  SSPMLMEAPKRATKFACNDSYQKMF------KDLYGVDKLTQQISILSGSLAGVTEACVI 127
           +  +  + P    KF   +   +++      KD      LT  I++LSG  AG+  A V 
Sbjct: 170 TPILFKQIPYNIAKFLVFERASELYFSLAPPKDTLSQTSLT-AINLLSGLTAGLAAAIVS 228

Query: 128 VPFELVKIRLQDVNSKFNGPME----VVFKTIRETGILSLYNGLESTMWRNAFWNGGYFG 183
            P + +   L  VN     P +    ++F+  ++ G +  + GL + +          FG
Sbjct: 229 QPADTL---LSKVNKTSKAPGQSTVGLLFQLAKQLGFVGSFAGLPTRLVMVGTLTSLQFG 285

Query: 184 VIFQIRALLPKAKT 197
           +  Q++  L  A T
Sbjct: 286 IYGQLKKSLGCAPT 299

 Score = 35.0 bits (79), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 72/172 (41%), Gaps = 16/172 (9%)

Query: 114 LSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVF-KTIRETGILSLYNGLESTMW 172
           L+G++   +    +VP ++VK R+Q   + +N  M   F K I E G  +L  G   T+ 
Sbjct: 18  LAGAIGCGSTHSSMVPIDVVKTRIQLEPTVYNKGMVGSFRKIIAEEGAGALLTGFGPTLL 77

Query: 173 ----RNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVK 228
               + AF  GGY   +F+   +         +  N +  G+      +  +  +  +  
Sbjct: 78  GYSIQGAFKFGGY--EVFKKFFIDTLGYDTAARYKNSVYIGSAAA-AEFLADIALCPLEA 134

Query: 229 SRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGP 280
           +RI+  +  T A+G V            +I  EEG  + Y GF P + +  P
Sbjct: 135 TRIRLVSQPTFANGLV--------GGFSRILKEEGVGSFYSGFTPILFKQIP 178

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/294 (21%), Positives = 118/294 (40%), Gaps = 22/294 (7%)

Query: 7   PFIYQFVSGAAAGVSELLVMYPLDVVKTRMQ-------------LQVGSGTGSGVAYNGV 53
           P  YQ ++GA AG+ E  +M+P+D +KTRMQ                      G     +
Sbjct: 19  PLSYQLIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGAGTL 78

Query: 54  IDCLGQIVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISI 113
           +  + +I   EG   L++G+ S ++   P  A  FA  +  ++   D    +      + 
Sbjct: 79  LQQISRISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKEQLIDAKDFNTHQPLKTA 138

Query: 114 LSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPM-EVVFKTIRETGILSLYNGLESTMW 172
           +SG  A V    ++ PF+ +K RLQ  +   +  M  + F   +  G ++ +    +T+ 
Sbjct: 139 VSGVAATVAADALMNPFDTIKQRLQLQSKSSDSSMWRMAFNIYKNEGPMAFFYSYPTTLA 198

Query: 173 RNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKS--R 230
            N  +    F VI++                + L  G  G  C   T  T L  +K+  +
Sbjct: 199 MNIPFAALNF-VIYESSTKFFNPTNAYNPWIHCLCGGIAGATCAAVT--TPLDCIKTVLQ 255

Query: 231 IQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGI 284
           I+   T  +        +     ++++ Y  +GF   ++G  P+++   P   I
Sbjct: 256 IRGSDTVHVESFKTANTFKKAAQAIWQSYGWKGF---WRGLQPRVISNIPATAI 306

 Score = 32.3 bits (72), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 39/206 (18%), Positives = 78/206 (37%), Gaps = 33/206 (16%)

Query: 113 ILSGSLAGVTEACVIVPFELVKIRLQDVNS--------------------KFNGPMEVVF 152
           +++G+ AG+ E  ++ P + +K R+Q V+                          ++ + 
Sbjct: 24  LIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGAGTLLQQIS 83

Query: 153 KTIRETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKT-NTEKTTNDLIAGTI 211
           +     G L+L+ G++S +      +  YF      +  L  AK  NT +     ++G +
Sbjct: 84  RISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKEQLIDAKDFNTHQPLKTAVSG-V 142

Query: 212 GGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGF 271
                          +K R+Q  + ++  D ++       W   F IY  EG  A +  +
Sbjct: 143 AATVAADALMNPFDTIKQRLQLQSKSS--DSSM-------WRMAFNIYKNEGPMAFFYSY 193

Query: 272 IPKILRLG-PGGGIMLVVFNGMMAFF 296
            P  L +  P   +  V++     FF
Sbjct: 194 -PTTLAMNIPFAALNFVIYESSTKFF 218

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 74/286 (25%), Positives = 126/286 (44%), Gaps = 30/286 (10%)

Query: 25  VMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR-LYKGISSPMLMEAPK 83
           VM+ LD VKTR Q     G    V Y  +I     +   EG  R LY G  + ML   P 
Sbjct: 70  VMHSLDTVKTRQQ-----GAPGEVKYRHMISAYRTLALEEGVRRGLYGGYGAAMLGSFPS 124

Query: 84  RATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIVPFELVKIRLQ----- 138
            A  F   +  ++   + + + +    ++  +G L  +  + V VP E++K RLQ     
Sbjct: 125 AAVFFGTYEWVKRQMINEWQIHETYSHLA--AGFLGDLFSSVVYVPSEVLKTRLQLQGCY 182

Query: 139 ---DVNSKFN--GPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRA--- 190
                 S +N  G  + V   +R  G+ +L+ G ++T+ R+  ++   F    + R    
Sbjct: 183 NNRHFQSGYNYRGLSDAVRTIVRTEGVSALFFGYKATLSRDLPFSALQFAFYERFRKWAF 242

Query: 191 LLPKAKTNTEKT-TNDLIAG-TIGGYCRYSTEHTILSVVKSRIQS---GATTTLADGTVV 245
           LL +   +   + T +++ G + GG     T  T L VVK+RIQ+   G+  T  D +  
Sbjct: 243 LLERKPVDGHLSFTAEVVTGASAGGLAGIIT--TPLDVVKTRIQTQPRGSAGT-PDASAP 299

Query: 246 PKYNWT-WPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFN 290
            + N + + SL  +   EG    + G  P+ +       IML+++ 
Sbjct: 300 ARLNGSIFRSLLVVLRYEGLGGAFSGVGPRFIWTSIQSSIMLLLYQ 345

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 62/121 (51%), Gaps = 6/121 (4%)

Query: 24  LVMYPLDVVKTRMQLQ---VGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGISSPMLME 80
           +V  P +V+KTR+QLQ         SG  Y G+ D +  IV+ EG S L+ G  + +  +
Sbjct: 164 VVYVPSEVLKTRLQLQGCYNNRHFQSGYNYRGLSDAVRTIVRTEGVSALFFGYKATLSRD 223

Query: 81  APKRATKFACNDSYQK--MFKDLYGVD-KLTQQISILSGSLAGVTEACVIVPFELVKIRL 137
            P  A +FA  + ++K     +   VD  L+    +++G+ AG     +  P ++VK R+
Sbjct: 224 LPFSALQFAFYERFRKWAFLLERKPVDGHLSFTAEVVTGASAGGLAGIITTPLDVVKTRI 283

Query: 138 Q 138
           Q
Sbjct: 284 Q 284

 Score = 35.0 bits (79), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 38/74 (51%), Gaps = 6/74 (8%)

Query: 6   LPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVA-----YNGVI-DCLGQ 59
           L F  + V+GA+AG    ++  PLDVVKTR+Q Q     G+  A      NG I   L  
Sbjct: 253 LSFTAEVVTGASAGGLAGIITTPLDVVKTRIQTQPRGSAGTPDASAPARLNGSIFRSLLV 312

Query: 60  IVKREGFSRLYKGI 73
           +++ EG    + G+
Sbjct: 313 VLRYEGLGGAFSGV 326

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 82/310 (26%), Positives = 136/310 (43%), Gaps = 37/310 (11%)

Query: 7   PFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGF 66
           P  + F++G   G+     M+ LD VKTR Q     G  +   Y  ++     +   EGF
Sbjct: 52  PIWHCFLAGGVGGIIGDSAMHSLDTVKTRQQ-----GAPNVHKYKHMLQAYRTMFIEEGF 106

Query: 67  SR-LYKGISSPMLMEAPKRATKFACND-SYQKMFKDLYGVDKLTQQISILSGSLAGVTEA 124
            R LY G  + ML   P  A  F+  + + + M  D +  D  +    + +G L     +
Sbjct: 107 RRGLYGGYCAAMLGSFPSAAIFFSTYEFTKRTMINDYHLNDTFSH---LTAGFLGDFFSS 163

Query: 125 CVIVPFELVKIRLQ--------DVNSKFN-GPMEVVFKTI-RETGILSLYNGLESTMWRN 174
            V VP E++K RLQ          NS +N   +     TI R  G+ +L+ G ++T+ R+
Sbjct: 164 FVYVPSEVLKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVAALFFGYKATLARD 223

Query: 175 AFWNGGYFGVIFQIR--ALLPKAKT---NTEKTTNDLIAGTI-GGYCRYSTEHTILSVVK 228
             ++   F    + R  A L + K    +    +N+++ G   GG     T  T L VVK
Sbjct: 224 LPFSALQFAFYEKFRQWAFLLEGKDIYKHDLSISNEIVTGACAGGLAGILT--TPLDVVK 281

Query: 229 SRIQSGATTTLADGTVVPKYNWTWP-----SLFK----IYSEEGFTALYKGFIPKILRLG 279
           +R+Q+   + +   T     N + P     S+FK    +Y+ EGF   + G  P+ +   
Sbjct: 282 TRVQTQLPSQIDISTDTKIKNVSKPVTLTNSIFKSLRTVYTSEGFFGFFSGVGPRFVWTS 341

Query: 280 PGGGIMLVVF 289
               IML+++
Sbjct: 342 VQSSIMLLLY 351

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 65/294 (22%), Positives = 115/294 (39%), Gaps = 15/294 (5%)

Query: 13  VSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKG 72
           ++G+ +GV   +   P+D VK R QLQ          Y G+   +  I+K EG   L+KG
Sbjct: 23  IAGSVSGVFARMATAPMDTVKIRYQLQPVQED----KYKGIASTVRTIMKEEGLRALWKG 78

Query: 73  ISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILS-GSLAGVTEACVIVPFE 131
                 M     A +F     +  ++   +   + +QQ   L+ G+LAG+T + V  P +
Sbjct: 79  NIPATAMYVVYGAVQFGSYSWFNNVWSAKF--PRFSQQGQTLTVGALAGMTSSVVSYPLD 136

Query: 132 LVKIRL-QDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRA 190
           L++ RL  +  S      E   +     G+   + G+ + M          F     +  
Sbjct: 137 LLRTRLIANRTSHRTSVAEECRQMWLNEGVRGFFTGISTAMTTVTLSTAIMFLTYETVNI 196

Query: 191 LLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVP---- 246
           +    +           +G I G+   +    I   ++ R+Q   +      T  P    
Sbjct: 197 VCENHEKEFWSRPVSASSGIIAGFVSKTMVFPI-DTLRRRMQVMNSKRTVHFTKFPAVYH 255

Query: 247 --KYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFFQE 298
             +Y  +   ++KI  +EG +ALY+G    + +  P   I L V+   M  F  
Sbjct: 256 EYRYKSSTAIIYKILRQEGVSALYRGLTMGLCKSVPTTAISLFVYERTMDLFDH 309

 Score = 33.5 bits (75), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query: 112 SILSGSLAGVTEACVIVPFELVKIR--LQDVN-SKFNGPMEVVFKTIRETGILSLYNG 166
           S+++GS++GV       P + VKIR  LQ V   K+ G    V   ++E G+ +L+ G
Sbjct: 21  SVIAGSVSGVFARMATAPMDTVKIRYQLQPVQEDKYKGIASTVRTIMKEEGLRALWKG 78

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 74/303 (24%), Positives = 125/303 (41%), Gaps = 36/303 (11%)

Query: 2   SEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQ---VGSGTGSGVAYNGVIDCLG 58
            +K   F   F+ G  +         P++ VK  +Q Q   +  G+     Y G+++C  
Sbjct: 4   DKKQSNFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGS-LDRRYTGIVECFK 62

Query: 59  QIVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSL 118
           +    EG +  ++G ++ ++   P +A  FA  D  + MF    G  K        +G+L
Sbjct: 63  RTAADEGVASFWRGNTANVIRYFPTQALNFAFKDKIKAMF----GFKKEEGYAKWFAGNL 118

Query: 119 AGVTEACV-----IVPFELVKIRL-QDVNS-------KFNGPMEVVFKTIRETGILSLYN 165
           A    A       +   +  + RL  D  S       +FNG ++V  KT+   G+  LY 
Sbjct: 119 ASGGLAGGLSLLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGVAGLYR 178

Query: 166 GLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYC---RYSTEHT 222
           G   ++     + G YFG+   ++ LL      T    N  +A  + G+      ST   
Sbjct: 179 GFLPSVVGIVVYRGLYFGLYDSLKPLLL-----TGSLENSFLASFLLGWAVTTGASTASY 233

Query: 223 ILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGG 282
            L  V+ R+       +  G  V KY+  + +  KI + EG  +L+KG    ILR   G 
Sbjct: 234 PLDTVRRRMM------MTSGQAV-KYDGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGA 286

Query: 283 GIM 285
           G++
Sbjct: 287 GVI 289

 Score = 32.0 bits (71), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 34/175 (19%), Positives = 67/175 (38%), Gaps = 26/175 (14%)

Query: 26  MYPLDVVKTRMQLQVGSGTGSG-VAYNGVIDCLGQIVKREGFSRLYKGISSPMLMEAPKR 84
           +Y LD  +TR+     S    G   +NG++D   + +  +G + LY+G    ++     R
Sbjct: 132 VYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGVAGLYRGFLPSVVGIVVYR 191

Query: 85  ATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIVPFELVKIRL------- 137
              F   DS + +   L G  + +   S L G       +    P + V+ R+       
Sbjct: 192 GLYFGLYDSLKPLL--LTGSLENSFLASFLLGWAVTTGASTASYPLDTVRRRMMMTSGQA 249

Query: 138 ----------------QDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAF 176
                           + + S F G    + + +   G++S+Y+ L+  ++   F
Sbjct: 250 VKYDGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGAGVISMYDQLQVILFGKTF 304

 Score = 29.3 bits (64), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 37/193 (19%), Positives = 74/193 (38%), Gaps = 22/193 (11%)

Query: 111 ISILSGSLAGVTEACVIVPFELVKIRLQD---------VNSKFNGPMEVVFKTIRETGIL 161
           I  L G ++         P E VK+ +Q+         ++ ++ G +E   +T  + G+ 
Sbjct: 12  IDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIVECFKRTAADEGVA 71

Query: 162 SLYNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEH 221
           S + G  + + R        F    +I+A+    K   E+      AG +          
Sbjct: 72  SFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKK---EEGYAKWFAGNLASGGLAGGLS 128

Query: 222 T--ILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLG 279
              + S+  +R +  A +  A      ++N       K  + +G   LY+GF+P +    
Sbjct: 129 LLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGVAGLYRGFLPSV---- 184

Query: 280 PGGGIMLVVFNGM 292
               + +VV+ G+
Sbjct: 185 ----VGIVVYRGL 193

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 59.7 bits (143), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 71/275 (25%), Positives = 113/275 (41%), Gaps = 25/275 (9%)

Query: 16  AAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVI--DCLGQIVKREGFSRLYKGI 73
           A+AG+ E+ V +P+D +  R+ +   +   S    N VI  D   + + R   S L+ G+
Sbjct: 18  ASAGILEIGVFHPVDTISKRL-MSNHTKIASTSQLNSVIFRDFASEPLGRRLLS-LFPGL 75

Query: 74  SSPMLMEAPKRATKFA--------CNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEAC 125
                 +  +R  K+          N +++  F   +G        S  +GSL G+ E  
Sbjct: 76  GYAAAYKILQRVYKYGGQPFANEFLNKNFKGDFDQAFGEKTGKALRSATAGSLIGIGE-I 134

Query: 126 VIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVI 185
           V++P +++KI+ Q     F G      K I++ G   LY G   T  RNA  +   FG  
Sbjct: 135 VLLPLDVLKIKRQTNPESFKG--RGFLKIIKDEG-FGLYRGWGWTAARNAPGSFALFGGN 191

Query: 186 FQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVV 245
              +  +   K   + T +     +I G          L V+K+RIQ+        G  +
Sbjct: 192 AFAKEYILGLKDYGQATWSQNFVSSIVGASASLIVSAPLDVIKTRIQNRNFDNPESGFKI 251

Query: 246 PKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGP 280
            K              EGFTA +KG  PK+L  GP
Sbjct: 252 IK---------NTLKNEGFTAFFKGLTPKLLTTGP 277

 Score = 46.6 bits (109), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 43/91 (47%), Gaps = 6/91 (6%)

Query: 11  QFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLY 70
            FVS      + L+V  PLDV+KTR+Q +      SG         +   +K EGF+  +
Sbjct: 212 NFVSSIVGASASLIVSAPLDVIKTRIQNRNFDNPESG------FKIIKNTLKNEGFTAFF 265

Query: 71  KGISSPMLMEAPKRATKFACNDSYQKMFKDL 101
           KG++  +L   PK    FA   +   +F +L
Sbjct: 266 KGLTPKLLTTGPKLVFSFALAQTLIPIFDNL 296

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score = 59.7 bits (143), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 74/279 (26%), Positives = 116/279 (41%), Gaps = 31/279 (11%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRL-- 69
             +GA  GV  +L  +P D++K R Q    SGT      + V   L +   + G S +  
Sbjct: 51  LAAGAVGGVCAVLTGHPFDLLKVRCQSNQASGT-----VDAVRKILVEARAQSGLSAVNM 105

Query: 70  ----YKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEAC 125
               YKG+  P+L   P  A  F   D  +K+        KLT      +G ++ +    
Sbjct: 106 MRGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTWNDNSGKLTTAQLATAGFISAIPTTL 165

Query: 126 VIVPFELVKIRLQDVNSKFNGPMEVVFKTIRET-GILSLYNGLESTMWRNAFWNGGYFGV 184
           V+ P E VK+ LQ   ++ N  +    K I  T G+ SL+ G  +T+ R+   +  YF  
Sbjct: 166 VMAPTERVKVVLQ---TQSNHSLGSAAKHILATGGVRSLFRGSLATLARDGPGSALYFAS 222

Query: 185 IFQIRALL-PKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGAT-TTLADG 242
               +A L  ++ TN     N  +AG + G   +     I   +K+ +QS  T  T+ + 
Sbjct: 223 YEATKAYLNARSGTNELSIKNVCLAGGMAGVSMWVGVFPI-DTIKTELQSSNTRQTMMEA 281

Query: 243 TVVPKYNWTWPSLFKIYSEE-GFTALYKGFIPKILRLGP 280
           T             KIY+   G    + G  P +LR  P
Sbjct: 282 T------------RKIYNTRGGIKGFFPGIGPALLRSFP 308

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 71/170 (41%), Gaps = 11/170 (6%)

Query: 14  SGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGI 73
           +G  + +   LVM P + VK  +Q Q     GS   +         I+   G   L++G 
Sbjct: 155 AGFISAIPTTLVMAPTERVKVVLQTQSNHSLGSAAKH---------ILATGGVRSLFRGS 205

Query: 74  SSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIVPFELV 133
            + +  + P  A  FA  ++ +       G ++L+ +   L+G +AGV+    + P + +
Sbjct: 206 LATLARDGPGSALYFASYEATKAYLNARSGTNELSIKNVCLAGGMAGVSMWVGVFPIDTI 265

Query: 134 KIRLQDVNSKFNGPMEVVFKTIR-ETGILSLYNGLESTMWRNAFWNGGYF 182
           K  LQ  N++    ME   K      GI   + G+   + R+   N   F
Sbjct: 266 KTELQSSNTR-QTMMEATRKIYNTRGGIKGFFPGIGPALLRSFPANAATF 314

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 38/86 (44%), Gaps = 15/86 (17%)

Query: 201 KTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYS 260
           +    L AG +GG C   T H    ++K R QS      A GTV    +     L +  +
Sbjct: 46  ENAKSLAAGAVGGVCAVLTGHP-FDLLKVRCQSNQ----ASGTV----DAVRKILVEARA 96

Query: 261 EEGFTAL------YKGFIPKILRLGP 280
           + G +A+      YKG IP +L + P
Sbjct: 97  QSGLSAVNMMRGFYKGVIPPLLGVTP 122

 Score = 28.9 bits (63), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 38/88 (43%), Gaps = 9/88 (10%)

Query: 13  VSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVK-REGFSRLYK 71
           ++G  AGVS  + ++P+D +KT +Q        S      +++   +I   R G    + 
Sbjct: 246 LAGGMAGVSMWVGVFPIDTIKTELQ--------SSNTRQTMMEATRKIYNTRGGIKGFFP 297

Query: 72  GISSPMLMEAPKRATKFACNDSYQKMFK 99
           GI   +L   P  A  F   +    +FK
Sbjct: 298 GIGPALLRSFPANAATFLGVELTHSLFK 325

 Score = 28.1 bits (61), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 35/68 (51%), Gaps = 5/68 (7%)

Query: 112 SILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTM 171
           S+ +G++ GV       PF+L+K+R Q  +++ +G ++ V K + E    S   GL +  
Sbjct: 50  SLAAGAVGGVCAVLTGHPFDLLKVRCQ--SNQASGTVDAVRKILVEARAQS---GLSAVN 104

Query: 172 WRNAFWNG 179
               F+ G
Sbjct: 105 MMRGFYKG 112

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score = 59.7 bits (143), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 71/157 (45%), Gaps = 11/157 (7%)

Query: 26  MYPLDVVKTRMQLQVGSGTGSGVAYN-GVIDCLGQIVKREGFSRLYKGISSPMLMEAPKR 84
           M P+DVVKTR+QL+          YN G++    QI+  EG   L  G    +L  + + 
Sbjct: 31  MVPIDVVKTRIQLEP-------TVYNKGMVSSFKQIISSEGAGALLTGFGPTLLGYSLQG 83

Query: 85  ATKFACNDSYQKMFKDLYGVDKLTQ---QISILSGSLAGVTEACVIVPFELVKIRLQDVN 141
           + KF   + ++K+  D  G D        I I S ++A       + P E  +IRL    
Sbjct: 84  SFKFGGYELFKKLAIDNMGYDNAVNYKNTIYIGSAAIAEFFADIALCPLEATRIRLVSQP 143

Query: 142 SKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWN 178
           +  NG      + ++E G+ S YNG    +++   +N
Sbjct: 144 TFANGLFGGFSRILKEEGVGSFYNGFTPILFKQIPYN 180

 Score = 35.0 bits (79), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 75/173 (43%), Gaps = 18/173 (10%)

Query: 114 LSGSL-AGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTI-RETGILSLYNGLESTM 171
           L+G++  G+T +  +VP ++VK R+Q   + +N  M   FK I    G  +L  G   T+
Sbjct: 18  LAGAIGCGITHSS-MVPIDVVKTRIQLEPTVYNKGMVSSFKQIISSEGAGALLTGFGPTL 76

Query: 172 W----RNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVV 227
                + +F  GGY   +F+  A+      N     N +  G+      +  +  +  + 
Sbjct: 77  LGYSLQGSFKFGGY--ELFKKLAIDNMGYDNAVNYKNTIYIGS-AAIAEFFADIALCPLE 133

Query: 228 KSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGP 280
            +RI+  +  T A+G         +    +I  EEG  + Y GF P + +  P
Sbjct: 134 ATRIRLVSQPTFANGL--------FGGFSRILKEEGVGSFYNGFTPILFKQIP 178

>Kwal_27.11626
          Length = 299

 Score = 59.3 bits (142), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 69/282 (24%), Positives = 118/282 (41%), Gaps = 25/282 (8%)

Query: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVI--DCLGQIVKREGF 66
           I + +  A+AG+ E+ V +P+D V  R+ +   +   S    N VI  +  G+ + +  F
Sbjct: 10  IARVLGSASAGILEIGVFHPVDTVSKRL-MSNHTKISSSAQLNSVIFREHAGEALGKRLF 68

Query: 67  SRLYKGISSPMLMEAPKRATKFA--------CNDSYQKMFKDLYGVDKLTQQISILSGSL 118
           + L+ G+      +  +R  K+          N +++  F + +G        S  +GSL
Sbjct: 69  T-LFPGLGYAASYKILQRVYKYGGQPFANEFLNKNFKADFDNAFGEKTGKALRSATAGSL 127

Query: 119 AGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWN 178
            G+ E  V++P +++KI+ Q     F G      K +++ G   LY G   T  RNA  +
Sbjct: 128 IGIGE-IVLLPLDVLKIKRQTNPESFKG--RGFIKILKDEG-FGLYRGWGWTAARNAPGS 183

Query: 179 GGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTT 238
              FG     +  +   K  +  T +     +I G          L V+K+RIQ+     
Sbjct: 184 FALFGGNAFAKEYILGLKDYSSATWSQNFVSSIVGASASLIVSAPLDVIKTRIQNRHFDN 243

Query: 239 LADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGP 280
              G  + +              EG TA +KG  PK+L  GP
Sbjct: 244 PESGFRIVQ---------NTLKNEGITAFFKGLTPKLLTTGP 276

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 41/93 (44%), Gaps = 6/93 (6%)

Query: 11  QFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLY 70
            FVS      + L+V  PLDV+KTR+Q +      SG         +   +K EG +  +
Sbjct: 211 NFVSSIVGASASLIVSAPLDVIKTRIQNRHFDNPESG------FRIVQNTLKNEGITAFF 264

Query: 71  KGISSPMLMEAPKRATKFACNDSYQKMFKDLYG 103
           KG++  +L   PK    FA   S    F  + G
Sbjct: 265 KGLTPKLLTTGPKLVFSFALAQSLIPAFDKMLG 297

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 59.3 bits (142), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 74/284 (26%), Positives = 117/284 (41%), Gaps = 37/284 (13%)

Query: 13  VSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR---- 68
           V  A+AG+ E+ V +P+D +  R+       T +          L  +V RE  S+    
Sbjct: 14  VGSASAGILEIGVFHPVDTISKRLMSNHTKITNA--------QQLNDVVFREHASKPFGQ 65

Query: 69  ----LYKGISSPMLMEAPKRATKFA----CNDSYQKMFK-DLYGV--DKLTQQI-SILSG 116
               L+ G+      +  +R  K+      N+   K FK D  G   +K  + + S  +G
Sbjct: 66  RLFTLFPGLGYAATYKIFQRVYKYGGQPFANEFLNKHFKADFDGAFGEKTGKALRSATAG 125

Query: 117 SLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAF 176
           SL G+ E  V++P +++KI+ Q     F G      + +R+ G + LY G   T  RNA 
Sbjct: 126 SLIGIGE-IVLLPLDVLKIKRQTNPESFRG--RGFLRILRDEG-MGLYRGWGWTAARNAP 181

Query: 177 WNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGAT 236
            +   FG     +  +   K  ++ T       +I G          L V+K+RIQS   
Sbjct: 182 GSFALFGGNAFAKEYILGLKDYSQATWGQNFVSSIFGASASLIVSAPLDVIKTRIQSRNF 241

Query: 237 TTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGP 280
            +   G  + K              EG TA +KG  PK+L  GP
Sbjct: 242 ESAESGFTIVK---------NTLKNEGATAFFKGLTPKLLTTGP 276

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 42/91 (46%), Gaps = 6/91 (6%)

Query: 11  QFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLY 70
            FVS      + L+V  PLDV+KTR+Q +      SG         +   +K EG +  +
Sbjct: 211 NFVSSIFGASASLIVSAPLDVIKTRIQSRNFESAESG------FTIVKNTLKNEGATAFF 264

Query: 71  KGISSPMLMEAPKRATKFACNDSYQKMFKDL 101
           KG++  +L   PK    FA   +   MF ++
Sbjct: 265 KGLTPKLLTTGPKLVFSFAIAQTLIPMFDNM 295

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 58.9 bits (141), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 72/304 (23%), Positives = 121/304 (39%), Gaps = 50/304 (16%)

Query: 8   FIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFS 67
           FI   VSGAAAG S  L  +P+D +KTR+Q +       G   NG            G+ 
Sbjct: 6   FIASLVSGAAAGTSTDLAFFPIDTLKTRLQAK------GGFFANG------------GYK 47

Query: 68  RLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGV------DKLTQQISILSGSLAGV 121
            +Y+G+ S ++  AP  +  F   DS +   + + G       D+    +S +  S  G 
Sbjct: 48  GVYRGLGSAVVASAPSASLFFVAYDSMKCWSRPVIGQLLPKGEDQTADTLSHMVSSSFGE 107

Query: 122 TEACVI-VPFELVKIRLQDVNSKFNGPMEVVFKTIR-ETG---ILSLYNGLESTMWRNAF 176
             AC++ VP E++K R Q    + N  ++ +   +R E G     +LY G  +T+ R   
Sbjct: 108 ISACMVRVPAEVIKQRTQ--THRTNSSLQTLQALLRNENGEGLRRNLYRGWSTTIMREIP 165

Query: 177 WNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRI----Q 232
           +    F +   ++    + +                     +   T L V+K+RI    +
Sbjct: 166 FTCIQFPLYEYMKKRWAEVQGKERAAPWQGSVCGCIAGGIAAAATTPLDVLKTRIMLHHK 225

Query: 233 SGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGM 292
           S +   LA                 +  EEG    + G  P+ + +  GG I L V+  +
Sbjct: 226 SVSALHLAK---------------TMLQEEGVKVFFSGVGPRTMWISAGGAIFLGVYETV 270

Query: 293 MAFF 296
            + F
Sbjct: 271 HSLF 274

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 74/307 (24%), Positives = 121/307 (39%), Gaps = 37/307 (12%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVA-----------YNGVIDCLGQI 60
            V+G   GV  +L  +P D++K R Q      T   V+            NG +     +
Sbjct: 25  LVAGGVGGVCAVLTGHPFDLIKVRCQSNQAKSTMDAVSIILKEARSLSTVNGSLTT--SL 82

Query: 61  VKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKM--FKDLYGVDKLTQQISILSGSL 118
             +      YKG+  P++   P  A  F   D  +++  +K        T Q++  +G +
Sbjct: 83  FFKNSVKGFYKGVIPPLIGVTPIFAVSFWGYDIGKRLVTWKQASDAPLTTAQMAT-AGFI 141

Query: 119 AGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRET-GILSLYNGLESTMWRNAFW 177
           + +    V  P E +K+ LQ  NS+F G      K I  T G+ SL+NG  +T+ R+   
Sbjct: 142 SAIPTTLVTAPTERIKVVLQ-TNSEFKGSFIKAAKHIVSTGGVKSLFNGSLATLARDGPG 200

Query: 178 NGGYFGVIFQIRALLPKAKTNTEKT----TNDLIAGTIGGYCRYSTEHTILSVVKSRIQS 233
           +  YF      +A L K+    +K      N  +AG I G   +     I   +K+R+Q 
Sbjct: 201 SALYFASYELSKAFLNKSVAKKDKDEVNLANVCLAGGIAGMSMWLVVFPI-DTIKTRLQV 259

Query: 234 GAT-TTLADGTVVPKYNWTWPSLFKIYSEE-GFTALYKGFIPKILRLGPGGGIMLVVFNG 291
             T  ++   T              IY +  G    + G  P +LR  P      +    
Sbjct: 260 ATTPISMVQATK------------DIYIQRGGIKGFFPGLGPALLRSFPANAATFLGVEL 307

Query: 292 MMAFFQE 298
             AFF++
Sbjct: 308 THAFFKK 314

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 3/83 (3%)

Query: 112 SILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNG-LEST 170
           ++++G + GV       PF+L+K+R Q   +K    M+ V   ++E   LS  NG L ++
Sbjct: 24  ALVAGGVGGVCAVLTGHPFDLIKVRCQSNQAK--STMDAVSIILKEARSLSTVNGSLTTS 81

Query: 171 MWRNAFWNGGYFGVIFQIRALLP 193
           ++      G Y GVI  +  + P
Sbjct: 82  LFFKNSVKGFYKGVIPPLIGVTP 104

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 76/344 (22%), Positives = 139/344 (40%), Gaps = 86/344 (25%)

Query: 7   PFIY-QFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREG 65
           P +Y   ++G+AA V +  + +P + +KT  QL       +  A+N     +   VK   
Sbjct: 6   PSLYSNLLAGSAAAVFQTTLSHPFEFLKTGQQLH--RSLPNAEAFN-----MFHHVKS-- 56

Query: 66  FSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILS-GSLAGVTEA 124
               + G S+  +    K AT+FA  D   ++ KD    +     + +++ GS+ G  E+
Sbjct: 57  ---YFAGCSALNIGILLKTATRFATFDKACQLLKDPENPEAPVSGLRLIAAGSITGFMES 113

Query: 125 CVIVPFELVKIRL----------------------------------------------Q 138
            +I+PFE +K R+                                              +
Sbjct: 114 MLIIPFENIKTRMIENALILSNRYQEEVETGGKDKPRSKSVNNMETKEQIRPKLYKQVKK 173

Query: 139 DVNSKFN-------GPMEVVFKTIRE----TGILSLYNGLESTMWRNAFWNGGYFGVIFQ 187
           ++N ++         P   +F T+RE     G  + + G   T++R      G   V F 
Sbjct: 174 EINPRYEKFLYYEKHPSTNIFTTVREMVQTRGFTTFFQGSMPTIFRQV----GNSAVRFT 229

Query: 188 IRALLPKAKTNTEKTTNDLIAGTIGGY--CRYSTEHTILSVVKSRIQSGATTTLADGTVV 245
               L K   +  K  ++  A  IG +  C        + VVK+R+QS  T +L      
Sbjct: 230 TYTTL-KQMISPNKPLSEYYAFGIGVFSSCAVVALTQPIDVVKTRMQSKYTWSL------ 282

Query: 246 PKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVF 289
             Y  +   +++ + EEG T+L+KG++P++ ++G  GG+   V+
Sbjct: 283 --YRNSLNCVYRTFIEEGLTSLWKGWVPRLFKVGLSGGVSFGVY 324

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 5/69 (7%)

Query: 4   KPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKR 63
           KPL   Y F  G  +  + + +  P+DVVKTRMQ +      +   Y   ++C+ +    
Sbjct: 242 KPLSEYYAFGIGVFSSCAVVALTQPIDVVKTRMQSKY-----TWSLYRNSLNCVYRTFIE 296

Query: 64  EGFSRLYKG 72
           EG + L+KG
Sbjct: 297 EGLTSLWKG 305

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 75/164 (45%), Gaps = 19/164 (11%)

Query: 28  PLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGISSP----------- 76
           P+ ++KTR+QL   +G  S   Y    DCL  +++ EGF+ LYKG+S+            
Sbjct: 195 PIWLIKTRVQLD-KAGKTSVRQYKNSWDCLKSVIRNEGFTGLYKGLSASYLGSVEGILQW 253

Query: 77  MLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGS--LAGVTEACVIVPFELVK 134
           +L E  KR  K    + +    +      +  ++    SGS  LA    +    P E+V+
Sbjct: 254 LLYEQMKRLIKERSIEKFGYQAEGTKSTSEKVKEWCQRSGSAGLAKFVASIATYPHEVVR 313

Query: 135 IRLQDV-----NSKFNGPMEVVFKTIRETGILSLYNGLESTMWR 173
            RL+         K+ G ++     I+E G+ S+Y+GL   + R
Sbjct: 314 TRLRQTPKENGKRKYTGLVQSFKVIIKEEGLFSMYSGLTPHLMR 357

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 77/327 (23%), Positives = 133/327 (40%), Gaps = 59/327 (18%)

Query: 7   PFIYQFVSGAAAGVSELLVMYPLDVVKTRMQ------------LQVGSGTGSGVAYNGVI 54
           P+++ FV+G   G++  +V  P D+VKTR+Q            + +  G+    + N VI
Sbjct: 52  PWVH-FVAGGIGGMAGAVVTCPFDLVKTRLQSDIFLKAYKSQAVNISKGSTRPKSINYVI 110

Query: 55  DC----------LGQIVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGV 104
                       +G + K+EGF  L+KG+   ++   P R+  F    + + M+   +  
Sbjct: 111 QAGTHFKETLGIIGNVYKQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDMYAKAFNN 170

Query: 105 DKLTQQISILSGSLAGVTEACVIVPFELVKIRLQ-DVNSK-----FNGPMEVVFKTIRET 158
            + T  I +++ + AG   A    P  L+K R+Q D   K     +    + +   IR  
Sbjct: 171 GQETPMIHLMAAATAGWATATATNPIWLIKTRVQLDKAGKTSVRQYKNSWDCLKSVIRNE 230

Query: 159 GILSLYNGLESTMWRNAFWNGGYFGVI-----FQIRALLPK------------AKTNTEK 201
           G   LY GL      +A + G   G++      Q++ L+ +             K+ +EK
Sbjct: 231 GFTGLYKGL------SASYLGSVEGILQWLLYEQMKRLIKERSIEKFGYQAEGTKSTSEK 284

Query: 202 TTNDLIAGTIGGYCRY--STEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIY 259
                      G  ++  S       VV++R++    T   +G    KY     S   I 
Sbjct: 285 VKEWCQRSGSAGLAKFVASIATYPHEVVRTRLRQ---TPKENGK--RKYTGLVQSFKVII 339

Query: 260 SEEGFTALYKGFIPKILRLGPGGGIML 286
            EEG  ++Y G  P ++R  P   IM 
Sbjct: 340 KEEGLFSMYSGLTPHLMRTVPNSIIMF 366

 Score = 33.9 bits (76), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 37/81 (45%), Gaps = 2/81 (2%)

Query: 2   SEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIV 61
           SEK   +  +  S   A     +  YP +VV+TR++ Q     G    Y G++     I+
Sbjct: 282 SEKVKEWCQRSGSAGLAKFVASIATYPHEVVRTRLR-QTPKENGKR-KYTGLVQSFKVII 339

Query: 62  KREGFSRLYKGISSPMLMEAP 82
           K EG   +Y G++  ++   P
Sbjct: 340 KEEGLFSMYSGLTPHLMRTVP 360

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score = 55.5 bits (132), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 82/181 (45%), Gaps = 30/181 (16%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYN-GVIDCLGQIVKREGFSRLY 70
           F++G  AG     V+ P + VK  +Q+Q      S  AYN G+I+ +GQ+ K EG + L+
Sbjct: 15  FIAGGVAGAVSRTVVSPFERVKILLQVQ-----SSTSAYNHGIINAVGQVYKEEGVAGLF 69

Query: 71  KGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISIL------SGSLAGVTEA 124
           +G     +   P  A +F     Y+   K ++ VD    +  +L      +G+L G    
Sbjct: 70  RGNGLNCVRIFPYSAVQFVV---YEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSV 126

Query: 125 CVIVPFELVKIRL--QDVN------------SKFNGPMEVVFKTIRET-GILSLYNGLES 169
               P +LV+ RL  Q  N            +K  G  E++ KT +E  GI  LY G+  
Sbjct: 127 LATYPLDLVRTRLSIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEEGGIRGLYRGIYP 186

Query: 170 T 170
           T
Sbjct: 187 T 187

 Score = 43.1 bits (100), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 81/190 (42%), Gaps = 21/190 (11%)

Query: 100 DLYGVDKLTQQISILSGSLAGVTEACVIVPFELVKI--RLQDVNSKFN-GPMEVVFKTIR 156
           DL  + K    I+ ++G +AG     V+ PFE VKI  ++Q   S +N G +  V +  +
Sbjct: 2   DLKQLAKQESSIAFIAGGVAGAVSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYK 61

Query: 157 ETGILSLYNGLESTMWRNAFWNGGYFGV-------IFQIRALLPKAK-TNTEKTTNDLIA 208
           E G+  L+ G      R   ++   F V       IF +   + K +  N ++ +   + 
Sbjct: 62  EEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALC 121

Query: 209 GTIGGYCRYSTEHTILSVVKSR--IQSGATTTLADGTV--VPKYNWTWPSLFKIYSEE-G 263
           G +     Y      L +V++R  IQ+     L+      + K    W  L K + EE G
Sbjct: 122 GGMSVLATYP-----LDLVRTRLSIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEEGG 176

Query: 264 FTALYKGFIP 273
              LY+G  P
Sbjct: 177 IRGLYRGIYP 186

>Scas_721.129
          Length = 323

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 59/206 (28%), Positives = 88/206 (42%), Gaps = 22/206 (10%)

Query: 109 QQISILSGSLAGVTEACVIV----PFELVKIRLQ------DVNSK-FNGPMEVVFKTIRE 157
           Q++S     +AG   AC+ V    P ELVKIR+Q       V  K +  P++ +    R 
Sbjct: 17  QKVSKFGSFIAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNPIQGMGVIFRN 76

Query: 158 TGILSLYNGLESTMWRNAFWNGGYFGVIFQIRALL-----PKAKTNT-EKTTNDLIAGTI 211
            GI  L  GL +        NG   G    IR  L     P  +++  +K + ++ AG  
Sbjct: 77  EGIRGLQKGLVAAYIYQIGLNGSRLGFYEPIRNALNSTFYPNEESHKIQKVSINVAAGAS 136

Query: 212 GGYCRYSTEHTILSVVKSRIQS-GATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKG 270
            G    +   + L +VK+R+QS      + + T    Y   W  L  I   EGF  L++G
Sbjct: 137 SGIIG-AVIGSPLFLVKTRMQSYSDAIKIGEQT---HYRNVWNGLSTIARTEGFKGLFRG 192

Query: 271 FIPKILRLGPGGGIMLVVFNGMMAFF 296
               ILR G G  + L ++N    F 
Sbjct: 193 IDAAILRTGAGSSVQLPIYNTAKNFL 218

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 63/284 (22%), Positives = 112/284 (39%), Gaps = 27/284 (9%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71
           F++G  A    +    P+++VK RMQLQ          Y   I  +G I + EG   L K
Sbjct: 25  FIAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNPIQGMGVIFRNEGIRGLQK 84

Query: 72  GISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQ-----ISILSGSLAGVTEACV 126
           G+ +  + +     ++    +  +      +  ++ + +     I++ +G+ +G+  A +
Sbjct: 85  GLVAAYIYQIGLNGSRLGFYEPIRNALNSTFYPNEESHKIQKVSINVAAGASSGIIGAVI 144

Query: 127 IVPFELVKIRLQDVNSKFNGPMEVVFKTI--------RETGILSLYNGLESTMWRNAFWN 178
             P  LVK R+Q  +       +  ++ +        R  G   L+ G+++ + R    +
Sbjct: 145 GSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIARTEGFKGLFRGIDAAILRTGAGS 204

Query: 179 GGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRI--QSGAT 236
                +    +  L K     +     L A TI G    +       V+ +RI  Q G  
Sbjct: 205 SVQLPIYNTAKNFLLKNDLMKDGPGLHLTASTISGLG-VAVVMNPWDVILTRIYNQKG-- 261

Query: 237 TTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGP 280
             L  G V            K    EG +ALYKGF  +ILR+ P
Sbjct: 262 -NLYKGPV--------DCFVKTVRTEGISALYKGFQAQILRIAP 296

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score = 56.6 bits (135), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 56/291 (19%), Positives = 118/291 (40%), Gaps = 33/291 (11%)

Query: 1   MSEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQI 60
           MS  P P  Y +  G   G+   +  +PLD+ K R+Q        +      ++    QI
Sbjct: 1   MSSAPEPVKYPWWYGGFGGIVACVATHPLDLAKVRLQT-------APAPKPTLVRMASQI 53

Query: 61  VKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMF--KDLYGVDKLTQQISILSGSL 118
           ++ EG   LY G+++ +L +      +F   D  ++ +  K+           S+ SG++
Sbjct: 54  LRNEGVPGLYSGLTAAILRQCTYTTARFGVYDFVKERYIPKEYLNSMLYLLPCSMFSGAV 113

Query: 119 AGVTEACVIVPFELVKIRLQDVNS-------KFNGPMEVVFKTIRETGILSLYNGLESTM 171
            G+    +  P ++V IR+Q+ +S        +    + ++K     G+  L+ G +  +
Sbjct: 114 GGL----IGNPADVVNIRMQNDSSLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNL 169

Query: 172 WRNAFWNGGYFGVIFQIRA--LLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKS 229
            R          V + I    L+     + +  +    +  + G    +T  +   V+K+
Sbjct: 170 VRGILMTSSQV-VTYDIAKNYLVQNVGLDKDNKSTHFASSLLAGLVA-TTVCSPADVIKT 227

Query: 230 RIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGP 280
           R+ +    +      +         L     +EG + +++G++P  +RLGP
Sbjct: 228 RVMNAHKHSHDSAVRI---------LLDAVKQEGPSFMFRGWLPSFVRLGP 269

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 70/301 (23%), Positives = 128/301 (42%), Gaps = 55/301 (18%)

Query: 10  YQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRL 69
           Y +  G AAG+   +V +PLD+ K R+Q        + +    +   L  I+  EG   L
Sbjct: 15  YPWWYGGAAGIFATMVTHPLDLAKVRLQ-------AAPMPKPTLFRMLESILANEGVVGL 67

Query: 70  YKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQ-----ISILSGSLAGVTEA 124
           Y G+S+ +L +      +F    +Y  + +++   ++LT        S+ SG++ G+   
Sbjct: 68  YSGLSAAVLRQCTYTTVRFG---AYDLLKENVIPREQLTNMAYLLPCSMFSGAIGGLAGN 124

Query: 125 CVIVPFELVKIRLQDVNS-------KFNGPMEVVFKTIR-ETGILSLYNGLESTMWRNAF 176
                 ++V IR+Q+ ++        +   ++ V+K  R E G+ +L+ G +  M R   
Sbjct: 125 FA----DVVNIRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGIL 180

Query: 177 WNGGYFGVIFQI--RALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSG 234
                  V + +    L+ K   +  K    L A  + G    +T  +   V+K+RI +G
Sbjct: 181 MTASQV-VTYDVFKNYLVTKLDFDASKNYTHLTASLLAGLVA-TTVCSPADVMKTRIMNG 238

Query: 235 ------ATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVV 288
                 A   LAD                   +EG + +++G++P   RLGP    ML+ 
Sbjct: 239 SGDHQPALKILADAV----------------RKEGPSFMFRGWLPSFTRLGP--FTMLIF 280

Query: 289 F 289
           F
Sbjct: 281 F 281

>Kwal_23.3965
          Length = 307

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 80/170 (47%), Gaps = 10/170 (5%)

Query: 4   KPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKR 63
           + +P     V+G  +G+S  +V  PLD +K R+QLQ+ +       Y G++    ++V++
Sbjct: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEA----QYGGILVTFKRLVRQ 65

Query: 64  EGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISI-LSGSLAGVT 122
           EG   L+KG    M M     +T+F    SY  +   L    +L  QI   + G+L+G  
Sbjct: 66  EGVRALWKGNVPAMAMYILYGSTQFT---SY-AILNKLLSKSQLPAQIHTGMVGALSGTC 121

Query: 123 EACVIVPFELVKIRLQDVNSKFNGPMEVVFKTI-RETGILSLYNGLESTM 171
            A    P ++++ R    +S+    M    + I R  G    + G+ S++
Sbjct: 122 SAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGVSSSI 171

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/190 (21%), Positives = 80/190 (42%), Gaps = 15/190 (7%)

Query: 112 SILSGSLAGVTEACVIVPFELVKIRLQD--VNSKFNGPMEVVFKT-IRETGILSLYNGLE 168
           S+++G L+G++   V  P + +KIRLQ    N    G + V FK  +R+ G+ +L+ G  
Sbjct: 17  SLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNV 76

Query: 169 STMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVK 228
             M     +    F     +  LL K++   +  T   + G + G C     +    V++
Sbjct: 77  PAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTG--MVGALSGTCSAIASYPC-DVLR 133

Query: 229 SRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVV 288
           +R  +  +  L+      +         +I+  EGF   +KG    I+ +      +L  
Sbjct: 134 TRFIANHSRELSTMLSTAQ---------EIWRHEGFRGFFKGVSSSIVSIAVATSSILAT 184

Query: 289 FNGMMAFFQE 298
           +  +  F ++
Sbjct: 185 YESVKIFCEQ 194

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/189 (22%), Positives = 83/189 (43%), Gaps = 31/189 (16%)

Query: 1   MSEKPLPF-IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQ 59
           +S+  LP  I+  + GA +G    +  YP DV++TR               + ++    +
Sbjct: 100 LSKSQLPAQIHTGMVGALSGTCSAIASYPCDVLRTRFI------ANHSRELSTMLSTAQE 153

Query: 60  IVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGS-- 117
           I + EGF   +KG+SS ++  A   ++  A  +S  K+F +    D+ +  I +L  S  
Sbjct: 154 IWRHEGFRGFFKGVSSSIVSIAVATSSILATYESV-KIFCEQRP-DRDSSVIQLLESSAS 211

Query: 118 -LAGVTEACVIVPFELVKIRLQDVN-SKFNGP------------------MEVVFKTIRE 157
            +AG+    ++ P + V+ R Q ++  +   P                  + +    + +
Sbjct: 212 VIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEK 271

Query: 158 TGILSLYNG 166
            G+L+LY+G
Sbjct: 272 EGLLALYHG 280

>Scas_667.4
          Length = 308

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 72/299 (24%), Positives = 124/299 (41%), Gaps = 30/299 (10%)

Query: 3   EKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQ---VGSGTGSGVAYNGVIDCLGQ 59
           +K   F   F+ G  +         P++ VK  +Q Q   +  G+     Y G+I+C  +
Sbjct: 8   KKESNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDS-KYKGIIECFQR 66

Query: 60  IVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKM--FKDLYGVDKLTQQISILSGS 117
             K EG    ++G ++ ++   P +A  FA  D  + M  FK   G  K     ++ SG 
Sbjct: 67  TAKTEGIIAFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYGKWFAG-NLASGG 125

Query: 118 LAGVTEACVIVPFELVKIRL-QDVNS-------KFNGPMEVVFKTIRETGILSLYNGLES 169
            AG      +   +  + RL  D  S       ++ G ++V  +T+   G+  LY G   
Sbjct: 126 AAGGLSLLFVYSLDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATDGMAGLYRGFLP 185

Query: 170 TMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGY---CRYSTEHTILSV 226
           ++     + G YFG+     +L P   T +       +A  + G+      ST    L  
Sbjct: 186 SVVGIIVYRGLYFGL---YDSLKPAVLTGS--LEGSFLASFLLGWIVTTGASTASYPLDT 240

Query: 227 VKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIM 285
           V+ R+       +  G  V KY+  +    K+ + EG ++L+KG    ILR   G G++
Sbjct: 241 VRRRMM------MTSGQAV-KYDGAFDCFRKVVAAEGVSSLFKGCGANILRGVAGAGVI 292

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 75/193 (38%), Gaps = 26/193 (13%)

Query: 8   FIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGT-GSGVAYNGVIDCLGQIVKREGF 66
           F     SG AAG   LL +Y LD  +TR+     S   G    Y G+ID   Q +  +G 
Sbjct: 117 FAGNLASGGAAGGLSLLFVYSLDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATDGM 176

Query: 67  SRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACV 126
           + LY+G    ++     R   F   DS +     L G  + +   S L G +     +  
Sbjct: 177 AGLYRGFLPSVVGIIVYRGLYFGLYDSLKPAV--LTGSLEGSFLASFLLGWIVTTGASTA 234

Query: 127 IVPFELVKIRL-----------------------QDVNSKFNGPMEVVFKTIRETGILSL 163
             P + V+ R+                       + V+S F G    + + +   G++S+
Sbjct: 235 SYPLDTVRRRMMMTSGQAVKYDGAFDCFRKVVAAEGVSSLFKGCGANILRGVAGAGVISM 294

Query: 164 YNGLESTMWRNAF 176
           Y+ L+  M+   F
Sbjct: 295 YDQLQMIMFGKKF 307

>CAGL0D04774g complement(467712..468680) similar to tr|Q06497
           Saccharomyces cerevisiae YPR128c, start by similarity
          Length = 322

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 72/303 (23%), Positives = 116/303 (38%), Gaps = 69/303 (22%)

Query: 14  SGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVA-----YNGVIDCLGQIVKREGFSR 68
           +GA A       +YPLD+ KT +Q Q      SG +     Y  VIDC+ +I K+ GF  
Sbjct: 9   TGAVASSLAATTVYPLDLAKTLIQTQ-HKNADSGDSKEEEKYKNVIDCIIKIFKKRGFLG 67

Query: 69  LYKGISSPMLMEAPKRATKFACNDSY-----------------QKMFKDLYGVDKLTQQI 111
           LY+G+++ +       A  F  N  Y                 +   KD     +L+   
Sbjct: 68  LYQGLATNV-------AANFVQNFIYFFWYSLIRSNYFVFKAGRLQLKDDSKFIELSTIE 120

Query: 112 SILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTM 171
            +  G  AG     V  P  ++  R Q      +  ++ V K I E          ES  
Sbjct: 121 ELALGMSAGAMTQVVTNPISVISTRQQLTKDGEDASLKAVIKQIYE----------ESNG 170

Query: 172 WRNAFWNGGYFGVIF------------QIRALLPKAK--TNTEKTTNDLIAGTIGGYCRY 217
              AFW G    ++             ++++++  AK  + ++K +  L AG        
Sbjct: 171 DLTAFWKGFKVALVLSTNPAITYGSYQKLKSMILTAKGLSGSQKISTQLSAG-------- 222

Query: 218 STEHTILSVVKSRIQSGATTTLADGTVV-----PKYNWTWPSLFKIYSEEGFTALYKGFI 272
             E+ +L +    I +  T  L    +       K+      L  IY  EGF +L+KG I
Sbjct: 223 --ENFLLGMFSKMISTFVTQPLIVAKITLQGKGSKFKTFQEVLQHIYQNEGFLSLWKGVI 280

Query: 273 PKI 275
           P++
Sbjct: 281 PQV 283

>Scas_662.12
          Length = 308

 Score = 53.9 bits (128), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 69/303 (22%), Positives = 130/303 (42%), Gaps = 27/303 (8%)

Query: 7   PFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGV-AYNGVIDCLGQIVKREG 65
           P   + +SG +AG    L+++PLD++K R+QL   + T      Y  +I+ L    K+ G
Sbjct: 6   PIQKEIISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNSKKMG 65

Query: 66  --------FSRLYKGISSPMLMEAPKRATKFAC-NDSYQKMFKDLYGVDKLTQQISILSG 116
                       Y+G+   +L  A   +  F   N +   MF++ Y  +  T  I + SG
Sbjct: 66  SQGPIYNLIKESYRGLPINLLGNAVAWSLYFTIYNSTKDYMFQNNYLHNNNT-TIFLTSG 124

Query: 117 SLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVV---FKT-IRETGILSLYNGLESTMW 172
            ++G++   +  P  ++K R+   +       + +   FK+ + + G  +++ GL  ++ 
Sbjct: 125 LISGISTTLLTNPLWVIKTRIMSTSRHHKDSYKSIRHGFKSLLTKEGPKAIWMGLLPSLL 184

Query: 173 RNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSV-----V 227
                 G  + +I+    L      N  K  N      I      S   +++SV     +
Sbjct: 185 --GVSQGAIYFMIYDNLKLHFNVNLNKSKKDNANANLKIVLISSLSKMLSVMSVYPFQLL 242

Query: 228 KSRIQSGATTTLADGTVVPKYNWTWPSLF-KIYSEEGFTALYKGFIPKILRLGPGGGIML 286
           KS +Q+  + T      +P+ ++ + +L  KIY + G   LYKG    +LR  P   I  
Sbjct: 243 KSNLQTFRSVT----NNIPQNDYHFITLIRKIYRDNGIKGLYKGLSANLLRAIPSTCITF 298

Query: 287 VVF 289
            ++
Sbjct: 299 CIY 301

 Score = 28.5 bits (62), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 17/76 (22%), Positives = 35/76 (46%), Gaps = 4/76 (5%)

Query: 22  ELLVMYPLDVVKTRMQLQVGSGTGSGVAYNG--VIDCLGQIVKREGFSRLYKGISSPMLM 79
            ++ +YP  ++K+   LQ      + +  N    I  + +I +  G   LYKG+S+ +L 
Sbjct: 232 SVMSVYPFQLLKS--NLQTFRSVTNNIPQNDYHFITLIRKIYRDNGIKGLYKGLSANLLR 289

Query: 80  EAPKRATKFACNDSYQ 95
             P     F   ++++
Sbjct: 290 AIPSTCITFCIYENFK 305

>Scas_714.18
          Length = 305

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 90/231 (38%), Gaps = 37/231 (16%)

Query: 11  QFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREG-FSRL 69
           + ++G+ AG     + YP D VK R+Q Q          +     C+    + EG     
Sbjct: 15  EILAGSIAGAIGKFIEYPFDTVKVRLQTQ------EAYMFPSTWSCIKYTYENEGILEGF 68

Query: 70  YKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISIL-SGSLAGVTEACVIV 128
           Y+GI SP++  A + A  F    +Y +    L    + +  + IL S   AG   + V+ 
Sbjct: 69  YQGIESPLIGAALENAILFL---AYNQCSSFLNAFTEFSAFLIILISAGFAGSCASFVLT 125

Query: 129 PFELVKIRLQDVNSKFN----------------------GPMEVVFKT----IRETGILS 162
           P EL+K +LQ  N  ++                      G    +  T    I+E G+  
Sbjct: 126 PVELIKCKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRHTRIIPTIKSIIKEKGLFG 185

Query: 163 LYNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGG 213
           L+ G  ST  R +  +  +F     ++  L   K+    T   LI+G   G
Sbjct: 186 LWQGQSSTFIRESIGSVVWFATYELMKQTLRDPKSEVNTTWQLLISGATAG 236

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 46/90 (51%), Gaps = 13/90 (14%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71
            +SGA AG++    ++P D VK+ MQ +          +  +++ +  I++R+G +  Y+
Sbjct: 229 LISGATAGLAFNGSVFPADTVKSIMQTE----------HLALMETVRSILERDGVAGFYR 278

Query: 72  GISSPMLMEAPKRATKFACNDSYQKMFKDL 101
           G+   +L   P  A  F    +Y+K+ K L
Sbjct: 279 GLGITLLRAVPSNAAVFY---TYEKLSKIL 305

 Score = 35.4 bits (80), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 53/122 (43%), Gaps = 4/122 (3%)

Query: 113 ILSGSLAGVTEACVIVPFELVKIRLQDVNS-KFNGPMEVVFKTIRETGILS-LYNGLEST 170
           IL+GS+AG     +  PF+ VK+RLQ   +  F      +  T    GIL   Y G+ES 
Sbjct: 16  ILAGSIAGAIGKFIEYPFDTVKVRLQTQEAYMFPSTWSCIKYTYENEGILEGFYQGIESP 75

Query: 171 MWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSR 230
           +   A  N   F    Q  + L  A T        LI+    G C  S   T + ++K +
Sbjct: 76  LIGAALENAILFLAYNQCSSFL-NAFTEFSAFLIILISAGFAGSCA-SFVLTPVELIKCK 133

Query: 231 IQ 232
           +Q
Sbjct: 134 LQ 135

>Kwal_14.2210
          Length = 315

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 70/302 (23%), Positives = 117/302 (38%), Gaps = 25/302 (8%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYN-GVIDCLGQIVKREGFSRLY 70
           F +G  AG     V+ P + VK  +Q+Q      S  AYN G+   + Q+   EG   L 
Sbjct: 21  FCAGGIAGAVSRTVVSPFERVKILLQVQ-----SSTHAYNHGLFRAVKQVYLEEGVPGLL 75

Query: 71  KGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIVPF 130
           +G     +   P  A +F   +  +K +        +     ++SG+L G        P 
Sbjct: 76  RGNGLNCIRIFPYSAVQFLVYEFCKKQWFQQNPDTVVLNWHRLVSGALCGGCSVLATYPL 135

Query: 131 ELVKIRL--QDVN-SKFN-----------GPMEVVFKT-IRETGILSLYNGLESTMWRNA 175
           +LV+ RL  Q  N ++ +           G  E++ KT  +E GI  LY G+  T     
Sbjct: 136 DLVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQEGGIFGLYRGVWPTSIGVV 195

Query: 176 FWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGA 235
            +    F V  Q+R  +P +      +   L  G I G    +  +    +++ R Q   
Sbjct: 196 PYVALNFAVYEQLREYIPASFDPASASLYKLSIGAISGGVAQTITYP-FDLLRRRFQ--- 251

Query: 236 TTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAF 295
              +    +   Y     +L  I   EGF   YKG    + ++ P   +  VV+  +  +
Sbjct: 252 VLAMGQSELGFHYKSVPDALITIGRTEGFKGYYKGLTANLFKVVPSTAVSWVVYETVRDY 311

Query: 296 FQ 297
            Q
Sbjct: 312 MQ 313

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 78/180 (43%), Gaps = 18/180 (10%)

Query: 10  YQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGS-------GTGSGVAYNGVIDCLGQIVK 62
           ++ VSGA  G   +L  YPLD+V+TR+ +Q  +          S     GV + L +   
Sbjct: 116 HRLVSGALCGGCSVLATYPLDLVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYT 175

Query: 63  RE-GFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILS-GSLAG 120
           +E G   LY+G+    +   P  A  FA  +  ++     +  D  +  +  LS G+++G
Sbjct: 176 QEGGIFGLYRGVWPTSIGVVPYVALNFAVYEQLREYIPASF--DPASASLYKLSIGAISG 233

Query: 121 VTEACVIVPFELVKIRLQ-------DVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWR 173
                +  PF+L++ R Q       ++   +    + +    R  G    Y GL + +++
Sbjct: 234 GVAQTITYPFDLLRRRFQVLAMGQSELGFHYKSVPDALITIGRTEGFKGYYKGLTANLFK 293

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 43/93 (46%)

Query: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR 68
           +Y+   GA +G     + YP D+++ R Q+     +  G  Y  V D L  I + EGF  
Sbjct: 223 LYKLSIGAISGGVAQTITYPFDLLRRRFQVLAMGQSELGFHYKSVPDALITIGRTEGFKG 282

Query: 69  LYKGISSPMLMEAPKRATKFACNDSYQKMFKDL 101
            YKG+++ +    P  A  +   ++ +   + L
Sbjct: 283 YYKGLTANLFKVVPSTAVSWVVYETVRDYMQLL 315

 Score = 35.0 bits (79), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 76/195 (38%), Gaps = 12/195 (6%)

Query: 111 ISILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLEST 170
           I+  +G +AG     V+ PFE VKI LQ V S  +     +F+ +++  +     GL   
Sbjct: 19  IAFCAGGIAGAVSRTVVSPFERVKILLQ-VQSSTHAYNHGLFRAVKQVYLEEGVPGLLRG 77

Query: 171 MWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTT-----NDLIAGTIGGYCRYSTEHTILS 225
              N      Y  V F +     K        T     + L++G + G C     +  L 
Sbjct: 78  NGLNCIRIFPYSAVQFLVYEFCKKQWFQQNPDTVVLNWHRLVSGALCGGCSVLATYP-LD 136

Query: 226 VVKSR--IQSGATTTLADGTVVPKYN--WTWPSLFKIYSEE-GFTALYKGFIPKILRLGP 280
           +V++R  IQ+     L              W  L K Y++E G   LY+G  P  + + P
Sbjct: 137 LVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQEGGIFGLYRGVWPTSIGVVP 196

Query: 281 GGGIMLVVFNGMMAF 295
              +   V+  +  +
Sbjct: 197 YVALNFAVYEQLREY 211

>Scas_669.6
          Length = 373

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 80/298 (26%), Positives = 122/298 (40%), Gaps = 45/298 (15%)

Query: 26  MYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR-LYKGISSPMLMEAPKR 84
           M+ LD VKTR Q     G      Y  +      I   EG +R LY G  + ML   P  
Sbjct: 69  MHSLDTVKTRQQ-----GAPMTPKYKNMTTAYRTIFLEEGIARGLYGGYFAAMLGSFPSA 123

Query: 85  ATKFACND-SYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIVPFELVKIRLQDVNSK 143
           A  F   +   +KM  DL G +     +S  +G L     + V VP E++K RLQ +  +
Sbjct: 124 AIFFGTYEWCKRKMIGDL-GFNDTVSHLS--AGLLGDFVSSFVYVPSEVLKTRLQ-LQGR 179

Query: 144 FNGP----------MEVVFKTIRET-GILSLYNGLESTMWRNAFWNGGYFGVIFQIRALL 192
            N P          +    + I  T G+ +L+ G ++T+ R+  ++   FG   + R   
Sbjct: 180 VNNPFFQSGYNYRSLRTAIRIIVNTEGVKALFFGYKATLARDLPFSALQFGFYEKFRQTA 239

Query: 193 PK-AKTNTEKTT----NDLIAGTI-GGYCRYSTEHTILSVVKSRIQS--------GATTT 238
            K  K +  K      N++  G I GG     T  T + V+K+R+Q+         ATT 
Sbjct: 240 FKLEKKDITKHNLSIPNEIFTGAIAGGLAGIIT--TPMDVIKTRLQTQQADINPNSATTV 297

Query: 239 LADGTVVPK-------YNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVF 289
            A      K        N  + SL  +Y  EG    + G  P+ +       IML+++
Sbjct: 298 GAISAKTNKKSRPIVLSNSIFRSLKLVYQSEGVIGFFSGVGPRFVWTSVQSSIMLLLY 355

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 57/129 (44%), Gaps = 7/129 (5%)

Query: 24  LVMYPLDVVKTRMQLQVGSGT---GSGVAYNGVIDCLGQIVKREGFSRLYKGISSPMLME 80
            V  P +V+KTR+QLQ         SG  Y  +   +  IV  EG   L+ G  + +  +
Sbjct: 162 FVYVPSEVLKTRLQLQGRVNNPFFQSGYNYRSLRTAIRIIVNTEGVKALFFGYKATLARD 221

Query: 81  APKRATKFACNDSYQKMFKDLYGVDKLTQQISI----LSGSLAGVTEACVIVPFELVKIR 136
            P  A +F   + +++    L   D     +SI     +G++AG     +  P +++K R
Sbjct: 222 LPFSALQFGFYEKFRQTAFKLEKKDITKHNLSIPNEIFTGAIAGGLAGIITTPMDVIKTR 281

Query: 137 LQDVNSKFN 145
           LQ   +  N
Sbjct: 282 LQTQQADIN 290

 Score = 28.5 bits (62), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (65%)

Query: 11  QFVSGAAAGVSELLVMYPLDVVKTRMQLQ 39
           +  +GA AG    ++  P+DV+KTR+Q Q
Sbjct: 257 EIFTGAIAGGLAGIITTPMDVIKTRLQTQ 285

>Kwal_23.4731
          Length = 314

 Score = 53.1 bits (126), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 76/319 (23%), Positives = 131/319 (41%), Gaps = 41/319 (12%)

Query: 1   MSEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQI 60
           M+    P   + ++G AAG    +  +PLD+VK R+QL V +    G  Y  VI  + + 
Sbjct: 6   MASDFTPLQREIIAGLAAGTLTTIATHPLDLVKLRLQLLVNTTHSHG--YKEVIKTIIRD 63

Query: 61  VKREG--FSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDL---YGVDKL---TQ--- 109
            K +   F   Y+G+   ++  +      F       +  KD+   YGV ++   TQ   
Sbjct: 64  SKADSNVFREAYRGLGVNLIGNSIAWGLYFGL----YRFTKDMVYRYGVAQMKTPTQSSF 119

Query: 110 --------QISILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRET--- 158
                    + + S +L+G+  A +  P  ++K R+   +S+ +   +  +  IR+    
Sbjct: 120 QKDKAMGPSLYLASAALSGLGTAILTNPIWVIKTRIMSTSSQASERYKTTWDGIRKVYAH 179

Query: 159 -GILSLYNGLESTMWRNAFWNGG-YFGVIFQIRA--LLPKAKTNTEKTTN-DLIAGTIGG 213
            G    + GL  +++  A   G  YF +   +R      +  T  EK  N + IA T   
Sbjct: 180 EGFSGFWRGLVPSLFGVA--QGAIYFTIYDSLRHQYFARRGITEDEKMGNLENIAITSVS 237

Query: 214 YCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIP 273
                T      ++KS +QS A     D      Y + W  +  I+ +EG   LYKG   
Sbjct: 238 KMLSVTAVYPFQLLKSNLQSFAAVEKRDS-----YRF-WNLVKSIHQKEGLQGLYKGLSA 291

Query: 274 KILRLGPGGGIMLVVFNGM 292
            +LR  P   I   ++  +
Sbjct: 292 NLLRAIPSTCITFCIYENL 310

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 67/244 (27%), Positives = 108/244 (44%), Gaps = 23/244 (9%)

Query: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR 68
           I  FV+G   GV  +   +P D++K R   Q G    +  A   +I      VK   F+ 
Sbjct: 36  IKSFVAGGVGGVCAVFTGHPFDLIKVR--CQNGQANSTVHAITNIIKEAKTQVKGTLFTN 93

Query: 69  ----LYKGISSPMLMEAPKRATKFACNDSYQKM--FKDLY-GVDKLTQQISILSGSLAGV 121
                YKG+  P+L   P  A  F   D  +K+  F +   G ++LT      +G ++ +
Sbjct: 94  SVKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQGGSNELTMGQMAAAGFISAI 153

Query: 122 TEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTI-RETGILSLYNGLESTMWRNAFWNGG 180
               V  P E VK+ LQ  +SK  G      KTI +E GI SL+ G  +T+ R+   +  
Sbjct: 154 PTTLVTAPTERVKVVLQ-TSSK--GSFIQAAKTIVKEGGIASLFKGSLATLARDGPGSAL 210

Query: 181 YFGVIFQI-----RALLPKAKTNTEKTTNDL---IAGTIGGYCRYSTEHTILSVVKSRIQ 232
           YF   ++I      +  P+     ++  N L   +AG I G   +     I   +K+++Q
Sbjct: 211 YFAS-YEISKNYLNSRQPRQDAGKDEPVNILNVCLAGGIAGMSMWLAVFPI-DTIKTKLQ 268

Query: 233 SGAT 236
           + +T
Sbjct: 269 ASST 272

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 76/179 (42%), Gaps = 23/179 (12%)

Query: 16  AAAG----VSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71
           AAAG    +   LV  P + VK  +Q    S  GS       I     IVK  G + L+K
Sbjct: 145 AAAGFISAIPTTLVTAPTERVKVVLQT---SSKGS------FIQAAKTIVKEGGIASLFK 195

Query: 72  GISSPMLMEAPKRATKFAC-----NDSYQKMFKDLYGVDKLTQQISI-LSGSLAGVTEAC 125
           G  + +  + P  A  FA      N    +  +   G D+    +++ L+G +AG++   
Sbjct: 196 GSLATLARDGPGSALYFASYEISKNYLNSRQPRQDAGKDEPVNILNVCLAGGIAGMSMWL 255

Query: 126 VIVPFELVKIRLQDVNSKFNGPMEVVFKTI--RETGILSLYNGLESTMWRNAFWNGGYF 182
            + P + +K +LQ  +++ N  M    K I  +  GI   + GL   + R+   N   F
Sbjct: 256 AVFPIDTIKTKLQASSTRQN--MLSATKEIYLQRGGIKGFFPGLGPALLRSFPANAATF 312

 Score = 35.4 bits (80), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 24/102 (23%), Positives = 46/102 (45%), Gaps = 8/102 (7%)

Query: 3   EKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVK 62
           ++P+  +   ++G  AG+S  L ++P+D +KT++Q        S    N +       ++
Sbjct: 234 DEPVNILNVCLAGGIAGMSMWLAVFPIDTIKTKLQ-------ASSTRQNMLSATKEIYLQ 286

Query: 63  REGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGV 104
           R G    + G+   +L   P  A  F   +    +FK  YG+
Sbjct: 287 RGGIKGFFPGLGPALLRSFPANAATFLGVEMTHSLFKK-YGI 327

 Score = 32.3 bits (72), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 74/193 (38%), Gaps = 30/193 (15%)

Query: 112 SILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTM 171
           S ++G + GV       PF+L+K+R Q  N + N  +  +   I+E         ++ T+
Sbjct: 38  SFVAGGVGGVCAVFTGHPFDLIKVRCQ--NGQANSTVHAITNIIKEA-----KTQVKGTL 90

Query: 172 WRNAFWNGGYFGVIFQIRALLP-------------KAKT--NTEKTTNDLIAGTIGGYCR 216
           + N+   G Y GVI  +  + P             K  T  N +  +N+L  G +     
Sbjct: 91  FTNSV-KGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQGGSNELTMGQMAAAGF 149

Query: 217 YSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKIL 276
            S   T L    +        T + G+ +            I  E G  +L+KG +  + 
Sbjct: 150 ISAIPTTLVTAPTERVKVVLQTSSKGSFIQAAK-------TIVKEGGIASLFKGSLATLA 202

Query: 277 RLGPGGGIMLVVF 289
           R GPG  +    +
Sbjct: 203 RDGPGSALYFASY 215

 Score = 31.2 bits (69), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 40/91 (43%), Gaps = 7/91 (7%)

Query: 193 PKAKTN-TEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGA--TTTLADGTVVPKYN 249
           P  K+N   +     +AG +GG C   T H    ++K R Q+G   +T  A   ++ +  
Sbjct: 25  PPIKSNPVRENIKSFVAGGVGGVCAVFTGHP-FDLIKVRCQNGQANSTVHAITNIIKEAK 83

Query: 250 WTWPSLFKIYSEEGFTALYKGFIPKILRLGP 280
                     S +GF   YKG IP +L + P
Sbjct: 84  TQVKGTLFTNSVKGF---YKGVIPPLLGVTP 111

>Kwal_23.2913
          Length = 320

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 64/288 (22%), Positives = 113/288 (39%), Gaps = 39/288 (13%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREG------ 65
             +G   GV  +L  +P D++K R Q    SGT      + +   L +   + G      
Sbjct: 32  LAAGGVGGVCAVLTGHPFDLLKVRCQSNQASGT-----LDAISRVLHEAKSKSGPLPLNQ 86

Query: 66  FSRLYKGISSPMLMEAPKRATKFACNDSYQKM-------FKDLYG----VDKLTQQISIL 114
               Y+G+  P+L   P  A  F   D  +++         D+ G    +  LT     L
Sbjct: 87  IKGFYRGVIPPLLGVTPIFAVSFWGYDVGKRLVTWGSNPVTDIAGSSSKLTPLTTSQLAL 146

Query: 115 SGSLAGVTEACVIVPFELVKIRLQDVNS-KFNGPMEVVFKTIRETGILSLYNGLESTMWR 173
           +G  + +    +  P E VK+ LQ   S  F G    +   IRE G+ SL+ G  +T+ R
Sbjct: 147 AGFFSAIPTTLITAPTERVKVVLQTSESGSFLGAARTL---IREGGVRSLFQGTLATLAR 203

Query: 174 NAFWNGGYFGVIFQIRALLPKAK-TNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQ 232
           +   +  YF      +  L + + T+     +  +AG + G   +     I   +K+++Q
Sbjct: 204 DGPGSALYFASYEVSKRFLSRNQDTDALSVVSICVAGGVAGMSMWIGVFPI-DTIKTKLQ 262

Query: 233 SGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGP 280
           S +           +      +  +IY+  G    + G  P ++R  P
Sbjct: 263 SSS-----------RSQSMVQAAREIYTRAGLRGFFPGLGPALMRSFP 299

 Score = 35.0 bits (79), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 38/183 (20%), Positives = 76/183 (41%), Gaps = 11/183 (6%)

Query: 5   PLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKRE 64
           PL      ++G  + +   L+  P + VK  +Q    SG+  G A          +++  
Sbjct: 138 PLTTSQLALAGFFSAIPTTLITAPTERVKVVLQTSE-SGSFLGAART--------LIREG 188

Query: 65  GFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEA 124
           G   L++G  + +  + P  A  FA  +  ++        D L+     ++G +AG++  
Sbjct: 189 GVRSLFQGTLATLARDGPGSALYFASYEVSKRFLSRNQDTDALSVVSICVAGGVAGMSMW 248

Query: 125 CVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYF-G 183
             + P + +K +LQ  +S+    ++   +     G+   + GL   + R+   N   F G
Sbjct: 249 IGVFPIDTIKTKLQS-SSRSQSMVQAAREIYTRAGLRGFFPGLGPALMRSFPANAATFLG 307

Query: 184 VIF 186
           V F
Sbjct: 308 VEF 310

>Scas_673.17
          Length = 314

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 72/157 (45%), Gaps = 11/157 (7%)

Query: 26  MYPLDVVKTRMQLQVGSGTGSGVAYN-GVIDCLGQIVKREGFSRLYKGISSPMLMEAPKR 84
           + P+DVVKTR+QL+          YN G++    +I+  EG   L  G    +L  + + 
Sbjct: 38  LVPVDVVKTRIQLEP-------TVYNKGMVGSFKKIIADEGAGALLTGFGPTLLGYSVQG 90

Query: 85  ATKFACNDSYQKMFKDLYGVDKLTQ---QISILSGSLAGVTEACVIVPFELVKIRLQDVN 141
           A KF   + ++K+  D  G +        + + S ++A       + P E  +IRL    
Sbjct: 91  AFKFGGYEVFKKLSIDTIGYENAVHYKNSVYMGSAAVAEFLADIALCPLEATRIRLVSQP 150

Query: 142 SKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWN 178
           +  NG +    + ++E G+ S Y+G    +++   +N
Sbjct: 151 TFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYN 187

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 70/167 (41%), Gaps = 22/167 (13%)

Query: 17  AAGVSELLV---MYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGI 73
           +A V+E L    + PL+  + R+  Q           NG++    +I+K EG    Y G 
Sbjct: 124 SAAVAEFLADIALCPLEATRIRLVSQP-------TFANGLVGGFSRILKEEGVGSFYSGF 176

Query: 74  SSPMLMEAPKRATKFACNDSYQKMFKDLYGV-----DKLTQQISILSGSLAGVTEACVIV 128
           +  +  + P    KF   +   +++  + G      D     I++LSG  AG   A V  
Sbjct: 177 TPILFKQIPYNIAKFLVFERASEVYYGIVGAKETLSDMTNTGINLLSGLTAGFAAAFVSQ 236

Query: 129 PFELVKIRLQDVNSKFNGPME----VVFKTIRETGILSLYNGLESTM 171
           P + +   L  VN     P +    ++ +  ++ G++  + GL + +
Sbjct: 237 PADTL---LSKVNKTKKAPGQSTIGLLAQLAKQLGVIGSFAGLPTRL 280

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 73/172 (42%), Gaps = 16/172 (9%)

Query: 114 LSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKT-IRETGILSLYNGLESTMW 172
           L+G++   T    +VP ++VK R+Q   + +N  M   FK  I + G  +L  G   T+ 
Sbjct: 25  LAGAIGCGTTHSSLVPVDVVKTRIQLEPTVYNKGMVGSFKKIIADEGAGALLTGFGPTLL 84

Query: 173 ----RNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVK 228
               + AF  GGY   +F+  ++      N     N +  G+      +  +  +  +  
Sbjct: 85  GYSVQGAFKFGGY--EVFKKLSIDTIGYENAVHYKNSVYMGS-AAVAEFLADIALCPLEA 141

Query: 229 SRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGP 280
           +RI+  +  T A+G V            +I  EEG  + Y GF P + +  P
Sbjct: 142 TRIRLVSQPTFANGLV--------GGFSRILKEEGVGSFYSGFTPILFKQIP 185

>Scas_702.10
          Length = 302

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/292 (22%), Positives = 124/292 (42%), Gaps = 33/292 (11%)

Query: 1   MSEKPLPFI-YQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQ 59
           M++ P   I Y +  G AAG+   ++ +PLD+ K R+Q        + +    +   L  
Sbjct: 1   MTDSPTKQIKYPWWYGGAAGIFACVMTHPLDLAKVRLQ-------AAPLPKPTLGRMLTT 53

Query: 60  IVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSL- 118
           I++ E    LY G+S+ +L +      +F    +Y  M ++L     +   + +L  S+ 
Sbjct: 54  ILRNENVMGLYSGLSAAVLRQCTYTTVRFG---AYDLMKENLIPQGHINDMVYLLPCSMF 110

Query: 119 AGVTEACVIVPFELVKIRLQ-------DVNSKFNGPMEVVFKT-IRETGILSLYNGLEST 170
           +G     V    ++V IR+Q       ++   +   ++ V+K  + E GI +L  G +  
Sbjct: 111 SGAIGGLVGNFADVVNIRMQNDSALKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKPN 170

Query: 171 MWRNAFWNGGYFGVIFQI--RALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVK 228
           M R          V + +    L+ K   + +K +  L A  + G    +T  +   V+K
Sbjct: 171 MVRGVLMTASQV-VTYDVFKNYLVTKLSFDPKKNSTHLSASLLAGLVA-TTICSPADVIK 228

Query: 229 SRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGP 280
           +RI +   T       +         L     +EG + +++G++P   RLGP
Sbjct: 229 TRIMNAHKTESESAIKI---------LTSAIKKEGPSFMFRGWLPIFTRLGP 271

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 74/330 (22%), Positives = 132/330 (40%), Gaps = 67/330 (20%)

Query: 7   PFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGT---------------------- 44
           P+++ F++G   G++  +V  P D+VKTR+Q  +                          
Sbjct: 56  PWVH-FLAGGIGGMAGAVVTCPFDLVKTRLQSDIYQNMYKSQAEALMMNTTRPRIVNLTL 114

Query: 45  GSGVAYNGVIDCLGQIVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGV 104
            +   +   +  +G + ++EGF  L+KG+   ++   P R+  F    + + ++   +  
Sbjct: 115 QAATHFKETVSIIGNVYRQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDIYSKAFNN 174

Query: 105 DKLTQQISILSGSLAGVTEACVIVPFELVKIRLQ-DVNSK---FNGPMEVVFKTIRETGI 160
            +    I +++ + AG   A    P  +VK R+Q D   K   +    + +   +R  GI
Sbjct: 175 GQEAPWIHLMAAATAGWATATATNPIWMVKTRVQLDKAGKTRTYKNSYDCLKSILRNEGI 234

Query: 161 LSLYNGLESTMWRNAFWNGGYFGVI-----FQIRALLPK-------AKTNTEKTTNDLI- 207
             LY GL      +A + G   G++      Q++ L+ K       A   +  TT D I 
Sbjct: 235 YGLYRGL------SASYLGSVEGILQWLLYEQLKHLIKKRSIEKFGAHDESTMTTTDKIK 288

Query: 208 -----------AGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLF 256
                      A  +     Y  E     VV++R++    + L +G V  KY     S  
Sbjct: 289 QWCQRSGGAGLAKFMASIVTYPHE-----VVRTRLRQ---SPLENGKV--KYTGLVQSFR 338

Query: 257 KIYSEEGFTALYKGFIPKILRLGPGGGIML 286
            I  EEG  ++Y G  P ++R  P   IM 
Sbjct: 339 VIIKEEGLASMYSGLTPHLMRTVPNSIIMF 368

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 37/78 (47%), Gaps = 2/78 (2%)

Query: 24  LVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGISSPMLMEAPK 83
           +V YP +VV+TR  L+        V Y G++     I+K EG + +Y G++  ++   P 
Sbjct: 306 IVTYPHEVVRTR--LRQSPLENGKVKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVPN 363

Query: 84  RATKFACNDSYQKMFKDL 101
               F   +   K+  D+
Sbjct: 364 SIIMFGTWEVVIKLLSDI 381

>Scas_715.45
          Length = 305

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 59/281 (20%), Positives = 115/281 (40%), Gaps = 31/281 (11%)

Query: 28  PLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGISSPMLMEAPKRATK 87
           PLD++K R+Q+           Y      + QI+K+EG  +L+ G+ +  +  + + A K
Sbjct: 36  PLDLIKCRLQVD-------PTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGK 88

Query: 88  FACNDSYQKMF-----KDLYGVDKLTQQISILSGSLAGVTEACVIVPFELVKIRLQDVNS 142
           +   + +++++     KD     K    I +LS + A      ++ PFE +K++ Q    
Sbjct: 89  YGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTTMP 148

Query: 143 KF-NGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFG----VIFQIRALLPKAKT 197
            + N  +E   K   + G+   Y G+     R   +    F     ++  I A LP  K+
Sbjct: 149 PWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKS 208

Query: 198 NT---EKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPS 254
                ++ +   + G + G       H    V+ S+I +      +             +
Sbjct: 209 EMSALQQISVSFVGGYMAGILCAIVSHPA-DVMVSKINNERKVNESMNV----------A 257

Query: 255 LFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAF 295
           L +IYS  GF  L+ G   +IL +G       ++++   A+
Sbjct: 258 LKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAY 298

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 33/161 (20%), Positives = 58/161 (36%), Gaps = 18/161 (11%)

Query: 127 IVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVIF 186
           + P +L+K RLQ   + +      + + +++ G+  L+ G+ +T    +    G +G   
Sbjct: 34  VTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYE 93

Query: 187 QIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSG-------ATTTL 239
             + L        E T             +Y T   +LS   +   +        A    
Sbjct: 94  LFKRLYSTHLVKDEATAY-----------KYRTSIYLLSSATAEFFADIMLCPFEAIKVK 142

Query: 240 ADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGP 280
              T+ P  N       K+Y++EG    YKG  P   R  P
Sbjct: 143 QQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIP 183

 Score = 28.1 bits (61), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 39/84 (46%), Gaps = 7/84 (8%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71
           FV G  AG+   +V +P DV+ +++  +        VA       L +I  R GF  L+ 
Sbjct: 220 FVGGYMAGILCAIVSHPADVMVSKINNERKVNESMNVA-------LKRIYSRIGFVGLWN 272

Query: 72  GISSPMLMEAPKRATKFACNDSYQ 95
           G+   +LM     + ++   DS++
Sbjct: 273 GLPVRILMIGTLTSFQWLIYDSFK 296

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 83/195 (42%), Gaps = 5/195 (2%)

Query: 1   MSEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQI 60
           MSEK        VSG   G++ +  + PLD++KTR+Q    S   S +     +    ++
Sbjct: 1   MSEKAGGVPAHLVSGFFGGLASVCALQPLDLLKTRLQQAQASSLRSVLRE---VRTTREL 57

Query: 61  VKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAG 120
            +    S L   I S + +     +       S  +    L  + +L    ++L+G+L+ 
Sbjct: 58  WRGTLPSALRTSIGSALYLSLLNYSRSALARGSEARTRSSL--LPRLQSYQNLLTGALSR 115

Query: 121 VTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGG 180
                V +P  ++K+R +     +NG  E      R  G    + G  +T  R+A + G 
Sbjct: 116 AAVGLVTMPITVIKVRYESTLYAYNGLAEATRHIWRSEGARGFFKGAAATTLRDAPYAGL 175

Query: 181 YFGVIFQIRALLPKA 195
           Y  +  Q + +LP+A
Sbjct: 176 YVLLYEQAKEMLPRA 190

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/184 (21%), Positives = 75/184 (40%), Gaps = 20/184 (10%)

Query: 113 ILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMW 172
           ++SG   G+   C + P +L+K RLQ   +     +  V + +R T    L+ G   +  
Sbjct: 12  LVSGFFGGLASVCALQPLDLLKTRLQQAQAS---SLRSVLREVRTTR--ELWRGTLPSAL 66

Query: 173 RNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQ 232
           R +  +  Y  ++   R+ L  A+ +  +T + L+        R  +   +L+   SR  
Sbjct: 67  RTSIGSALYLSLLNYSRSAL--ARGSEARTRSSLLP-------RLQSYQNLLTGALSRAA 117

Query: 233 SGATT------TLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIML 286
            G  T       +   + +  YN    +   I+  EG    +KG     LR  P  G+ +
Sbjct: 118 VGLVTMPITVIKVRYESTLYAYNGLAEATRHIWRSEGARGFFKGAAATTLRDAPYAGLYV 177

Query: 287 VVFN 290
           +++ 
Sbjct: 178 LLYE 181

>Kwal_27.11419
          Length = 298

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 59/248 (23%), Positives = 102/248 (41%), Gaps = 21/248 (8%)

Query: 1   MSEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQI 60
           MSE+P    + F+ G   G++  +++ P D++KTR+Q    S     V     I+  GQ+
Sbjct: 1   MSERPRGRSH-FIGGFVGGLTSAVILQPFDLLKTRLQQNKSSNLLDVVR---SIETPGQL 56

Query: 61  VKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAG 120
            K    S L   + S + +       + A  D   K      G      Q+S+    ++G
Sbjct: 57  WKGTLPSALRTSVGSALFLSTLN-IVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISG 115

Query: 121 -VTEACV---IVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAF 176
            +T A V    +P  ++K+R +     +    E      R  GI  L++G  +T+ R+A 
Sbjct: 116 AITRAAVGVATMPITVLKVRFESTMYNYKSLGEAATHIYRSEGIRGLFSGCGATVMRDAP 175

Query: 177 WNGGYFGVIFQIRALLPK---------AKTNTEKTTNDLIAGTIGGYCRYSTEHTILS-- 225
           + G Y     Q +  LP+          ++    T    I  +I  +   S   TI S  
Sbjct: 176 YAGLYVLFYEQSKLQLPRILPVWMVEHNESGVFSTKTSTIINSIAAFSSASLATTITSPF 235

Query: 226 -VVKSRIQ 232
             +K+R+Q
Sbjct: 236 DTIKTRMQ 243

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 40/195 (20%), Positives = 77/195 (39%), Gaps = 45/195 (23%)

Query: 13  VSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKG 72
           ++ AA GV+ +    P+ V+K R +        +   Y  + +    I + EG   L+ G
Sbjct: 117 ITRAAVGVATM----PITVLKVRFE-------STMYNYKSLGEAATHIYRSEGIRGLFSG 165

Query: 73  ISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKL-------------------TQQISI 113
             + ++ +AP           Y  ++   Y   KL                   + + S 
Sbjct: 166 CGATVMRDAP-----------YAGLYVLFYEQSKLQLPRILPVWMVEHNESGVFSTKTST 214

Query: 114 LSGSLAGVTEAC----VIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLES 169
           +  S+A  + A     +  PF+ +K R+Q   S++ G ++     IR     +L++GL  
Sbjct: 215 IINSIAAFSSASLATTITSPFDTIKTRMQLNPSQYYGFIQTFKSIIRYERPRNLFDGLSL 274

Query: 170 TMWRNAFWNGGYFGV 184
            + R A   G  +G+
Sbjct: 275 RLSRKALSAGIAWGI 289

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 70/323 (21%), Positives = 124/323 (38%), Gaps = 82/323 (25%)

Query: 14  SGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGI 73
           +G+ +G+    + YP + +KT +QL         V      + LG  V+       + G 
Sbjct: 15  AGSVSGLFSATITYPFEFLKTGLQLH------RNVVAAKPFEVLGYQVRT-----YFAGC 63

Query: 74  SSPMLMEAPKRATKFACNDSYQK------MFKD--LYGVDKLTQQISILSGSLAGVTEAC 125
           S+  +    K + +F   D   +      + KD  L GV  L      ++G+L G  E+ 
Sbjct: 64  SAVNIGVVMKTSLRFLAFDKASEWLRPPALAKDAPLSGVQLL------MAGALTGTMESL 117

Query: 126 VIVPFELVKI-----------RLQDVNSKFNGPM------------------EVVF---- 152
            I+PFE VK+           RL    S   G +                  E +F    
Sbjct: 118 CIIPFENVKVAMIQNSLLSHERLNTTTSNVQGQVANEVKKTFHKKPTLRSSYEALFPEKL 177

Query: 153 ---------KTIRETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTT 203
                    +  R+ G+ + + G   T+ R    +   F     ++   PK   N     
Sbjct: 178 PTNVLTTAAELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTMLKQFAPKEYQN----- 232

Query: 204 NDLIAGTIG--GYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSE 261
           N+  A  +G    C        L V+K+R+Q+  +  L   ++   Y        +I+ E
Sbjct: 233 NEYFATLLGLISSCAVVGATQPLDVIKTRMQAKDSVLLYRNSINCAY--------RIFVE 284

Query: 262 EGFTALYKGFIPKILRLGPGGGI 284
           EGF  L+KG++P+++++G  G +
Sbjct: 285 EGFAMLWKGWLPRLMKVGLSGSV 307

>Kwal_55.21338
          Length = 323

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 63/150 (42%), Gaps = 6/150 (4%)

Query: 22  ELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGISSPMLMEA 81
            + + YPL VV T++Q Q   G    +A     D +  I +++G    + G+ S +    
Sbjct: 36  SMTLTYPLIVVTTKLQTQDAKGEKLSLA-----DTIKDIYRKDGAMGFFAGLESALFGTT 90

Query: 82  PKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIVPFELVKIRLQDVN 141
                 + C ++  +         +LT   S+L GS+AG   A    P  +   R+  V 
Sbjct: 91  LSNFVYYYCYEASSRCVLRARHTQRLTTAESMLVGSIAGSLNATAANPLWVANTRMT-VQ 149

Query: 142 SKFNGPMEVVFKTIRETGILSLYNGLESTM 171
               G +  +F  +++ GI  L+ GL   +
Sbjct: 150 KSDRGTLSTIFDIVKDEGISGLFKGLNPAL 179

 Score = 35.8 bits (81), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 45/205 (21%), Positives = 84/205 (40%), Gaps = 23/205 (11%)

Query: 15  GAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGIS 74
           G+ AG        PL V  TRM +Q            G +  +  IVK EG S L+KG+ 
Sbjct: 125 GSIAGSLNATAANPLWVANTRMTVQKSD--------RGTLSTIFDIVKDEGISGLFKGL- 175

Query: 75  SPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIVPFELVK 134
           +P L+       ++   +  +           L+   + + G++  +       P+  +K
Sbjct: 176 NPALILVINPIIQYTVYEQLKNWILSSRQTRTLSPSWAFILGAVGKLAATGSTYPYVTMK 235

Query: 135 IRLQ---DVNSKFNGP----MEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFG---- 183
            R+    +  S    P    + ++ + I++ GIL LY G+   + ++       F     
Sbjct: 236 ARMHLLGEHKSSTAAPPRSLLSLMAEIIKKDGILGLYRGIGIKLVQSILTAAFLFFFKEG 295

Query: 184 -VIFQIRALLPKAKTNTEKTT--ND 205
            VI+ +R L   ++ NT++ +  ND
Sbjct: 296 LVIWSMRVLRAWSRFNTKRRSLIND 320

 Score = 35.0 bits (79), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 58/144 (40%), Gaps = 13/144 (9%)

Query: 134 KIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVI-FQIRALL 192
           K++ QD   +     + +    R+ G +  + GLES ++     N  Y+       R +L
Sbjct: 49  KLQTQDAKGEKLSLADTIKDIYRKDGAMGFFAGLESALFGTTLSNFVYYYCYEASSRCVL 108

Query: 193 PKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTW 252
               T    T   ++ G+I G    +T    L V  +R+           TV      T 
Sbjct: 109 RARHTQRLTTAESMLVGSIAGSLN-ATAANPLWVANTRM-----------TVQKSDRGTL 156

Query: 253 PSLFKIYSEEGFTALYKGFIPKIL 276
            ++F I  +EG + L+KG  P ++
Sbjct: 157 STIFDIVKDEGISGLFKGLNPALI 180

 Score = 33.1 bits (74), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 31/64 (48%)

Query: 10  YQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRL 69
           + F+ GA   ++     YP   +K RM L     + +      ++  + +I+K++G   L
Sbjct: 212 WAFILGAVGKLAATGSTYPYVTMKARMHLLGEHKSSTAAPPRSLLSLMAEIIKKDGILGL 271

Query: 70  YKGI 73
           Y+GI
Sbjct: 272 YRGI 275

>Scas_328.1
          Length = 227

 Score = 50.4 bits (119), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 36/68 (52%), Gaps = 4/68 (5%)

Query: 8   FIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFS 67
           F+  F+ G A  +S     YPLD V+ RM +     +G  V Y G IDC  QIV +EG  
Sbjct: 136 FLPSFLLGWAVTISASTTSYPLDTVRRRMMMT----SGQAVKYKGAIDCFQQIVSQEGVY 191

Query: 68  RLYKGISS 75
            L+KG  +
Sbjct: 192 SLFKGCGA 199

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 57/220 (25%), Positives = 86/220 (39%), Gaps = 31/220 (14%)

Query: 82  PKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEAC-VIVPFELVKIRL--- 137
           P +A  FA  D  + MF    G  +L Q +        G+   C    P   + +RL   
Sbjct: 7   PTQALNFAFKDKIKAMFGFQQGKRRLYQMVY----GECGIRWMCRCSFPIVCLFLRLCKN 62

Query: 138 ---QDVNS-------KFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVIFQ 187
               D  S       KFNG ++V  KT+   G+L LY G   ++     + G YFG+   
Sbjct: 63  EIGSDAKSIKSGAPRKFNGILDVYKKTLFTDGVLGLYRGFLPSVVGIMVYRGLYFGLYDS 122

Query: 188 IRALLPKAKTNTEKTTNDLI--AGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVV 245
           ++ +L           + L+  A TI      ST    L  V+ R+       +  G  V
Sbjct: 123 LKPVLLTGSFENAFLPSFLLGWAVTISA----STTSYPLDTVRRRMM------MTSGQAV 172

Query: 246 PKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIM 285
            KY        +I S+EG  +L+KG    I R     G++
Sbjct: 173 -KYKGAIDCFQQIVSQEGVYSLFKGCGANIFRGVAAAGVI 211

 Score = 27.7 bits (60), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 39/197 (19%), Positives = 77/197 (39%), Gaps = 31/197 (15%)

Query: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRM-QLQVGSG-----TGSGVAYNGVIDCLGQIVK 62
           +YQ V G           +P+  +  R+ + ++GS      +G+   +NG++D   + + 
Sbjct: 32  LYQMVYGECGIRWMCRCSFPIVCLFLRLCKNEIGSDAKSIKSGAPRKFNGILDVYKKTLF 91

Query: 63  REGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVT 122
            +G   LY+G    ++     R   F   DS + +   L G  +     S L G    ++
Sbjct: 92  TDGVLGLYRGFLPSVVGIMVYRGLYFGLYDSLKPVL--LTGSFENAFLPSFLLGWAVTIS 149

Query: 123 EACVIVPFELVKIRL-----------------------QDVNSKFNGPMEVVFKTIRETG 159
            +    P + V+ R+                       + V S F G    +F+ +   G
Sbjct: 150 ASTTSYPLDTVRRRMMMTSGQAVKYKGAIDCFQQIVSQEGVYSLFKGCGANIFRGVAAAG 209

Query: 160 ILSLYNGLESTMWRNAF 176
           ++SLY+ L+  ++   F
Sbjct: 210 VISLYDQLQLLLFGRKF 226

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 83/184 (45%), Gaps = 22/184 (11%)

Query: 1   MSEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQI 60
           M+++ +      VS  A+G++  L+  P+ V+KTR+       T S   Y  +++ + +I
Sbjct: 116 MNDRKMTSSMYLVSAGASGLATALLTNPMWVIKTRIM-----STKSSQGYTSILNAITRI 170

Query: 61  VKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQ-KMFKDLYGVDK----LTQQISILS 115
              EG    ++G+  P L    + A  FA  D+ + K   D   + +      + I I+ 
Sbjct: 171 YTEEGLKTFWRGL-VPSLFGVTQGALYFAIYDTLKLKYLHDRNDIQERRLNAVETIGII- 228

Query: 116 GSLAGVTEACVIVPFELVKIRLQ------DVNSKFNGPMEVVFKTIRETGILSLYNGLES 169
            SL+ +     + P +L+K  LQ      + NSK N  +  ++ T    GI   Y GL +
Sbjct: 229 -SLSKMISVSSVYPLQLLKTNLQTFRTEHNENSKMNSLIRSIWHT---NGIAGFYKGLFA 284

Query: 170 TMWR 173
            + R
Sbjct: 285 NLVR 288

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 75/186 (40%), Gaps = 38/186 (20%)

Query: 7   PFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQV------------------GSGTGSGV 48
           P   + +SG  AG    +V +PLD++K R+QL                    GSGT   +
Sbjct: 11  PLQKEIISGLTAGTITTIVTHPLDLIKLRLQLAAIDLKPSSYYNQVQRIIKDGSGTQQLL 70

Query: 49  --AYNGV-IDCLGQIVKREGFSRLYKGISSPM--LMEAPKRATKFACNDSYQKMFKDLYG 103
             AY G+ I+ +G  V    +  LY+     +  L   P    KF  ND           
Sbjct: 71  KEAYRGLGINIIGNAVAWGLYFGLYRCSKDVVYSLSSEPALQNKF-MNDR---------- 119

Query: 104 VDKLTQQISILSGSLAGVTEACVIVPFELVKIRLQDVNSK--FNGPMEVVFKTIRETGIL 161
             K+T  + ++S   +G+  A +  P  ++K R+    S   +   +  + +   E G+ 
Sbjct: 120 --KMTSSMYLVSAGASGLATALLTNPMWVIKTRIMSTKSSQGYTSILNAITRIYTEEGLK 177

Query: 162 SLYNGL 167
           + + GL
Sbjct: 178 TFWRGL 183

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 82/192 (42%), Gaps = 29/192 (15%)

Query: 110 QISILSGSLAGVTEACVIVPFELVKIRLQ--DVNSKFNGPMEVVFKTIRE-TGILSL--- 163
           Q  I+SG  AG     V  P +L+K+RLQ   ++ K +     V + I++ +G   L   
Sbjct: 13  QKEIISGLTAGTITTIVTHPLDLIKLRLQLAAIDLKPSSYYNQVQRIIKDGSGTQQLLKE 72

Query: 164 -YNGLESTMWRNAFWNGGYFG-------VIFQIRA--LLPKAKTNTEKTTNDLI---AGT 210
            Y GL   +  NA   G YFG       V++ + +   L     N  K T+ +    AG 
Sbjct: 73  AYRGLGINIIGNAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDRKMTSSMYLVSAGA 132

Query: 211 IGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKG 270
            G      T    + V+K+RI S  ++          Y     ++ +IY+EEG    ++G
Sbjct: 133 SGLATALLTNP--MWVIKTRIMSTKSS--------QGYTSILNAITRIYTEEGLKTFWRG 182

Query: 271 FIPKILRLGPGG 282
            +P +  +  G 
Sbjct: 183 LVPSLFGVTQGA 194

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 69/309 (22%), Positives = 125/309 (40%), Gaps = 33/309 (10%)

Query: 1   MSEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQI 60
           MS++  P   + +SG  AG    L+++PLD+ K R+QL + S T  G       +   +I
Sbjct: 1   MSDRYTPLQKEVISGLTAGSVTTLIVHPLDLFKVRLQLLITSTTKKGYR-----NLWSEI 55

Query: 61  VKRE-GFSR-LYKGISSPM--------LMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQ 110
           V  +   +R LY+G++  +        L  A  R  K    +   ++  D      L+  
Sbjct: 56  VGSDLSLTRELYRGLTVNLVGNTIAWGLYFASYRVAKDYLINYNHRIRND----KDLSSW 111

Query: 111 ISILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLEST 170
           + + + + +G+    +  P  ++K R+    +     M+V+   I+  G+  L+ GL   
Sbjct: 112 MYLSASASSGMLTTVLTNPLWVIKTRMMSKANSDLTSMKVLRDLIKNDGVQGLWKGLVPA 171

Query: 171 MWRNAFWNGGYFGVIFQI--RALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVK 228
           +       G      +      L+ K + + E T  + IA T       ++      ++K
Sbjct: 172 L--VGVSQGALHFTCYDTLKHKLVLKNRDSDEITNLETIAVTSVSKMLSTSAVYPFQLLK 229

Query: 229 SRIQSGATTTLADGTVVPKYNWTWPSLFK-IYSEEGFTALYKGFIPKILRLGPGGGIMLV 287
           S +QS   +   D  ++P        L K IYS  G    YKG    +LR  P   I   
Sbjct: 230 SNLQSFQASE-NDFKLLP--------LSKMIYSRSGLLGFYKGLSANLLRSVPSTCITFC 280

Query: 288 VFNGMMAFF 296
           ++    +F 
Sbjct: 281 IYENFKSFL 289

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 54/196 (27%), Positives = 83/196 (42%), Gaps = 30/196 (15%)

Query: 110 QISILSGSLAGVTEACVIVPFELVKIRLQ----DVNSKFNGPMEVVFKTIRETG------ 159
           Q  ++SG  AG     V+ P +L+K+RLQ           GP  V+ + IR +       
Sbjct: 10  QKEVISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHYGPFMVIKEIIRSSANSGRSV 69

Query: 160 ILSLYNGLESTMWRNAFWNGGYFGVIFQIRALLPKA-----KTNTEKTTND--------L 206
              LY GL   ++ NA   G YFG+    + L+ K+     +T  +   ND        L
Sbjct: 70  TNELYRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKMNSLIYL 129

Query: 207 IAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTA 266
            AG   G       + I  V+K+RI S  T+  A G     YN     + ++   +GF  
Sbjct: 130 SAGASSGLMTAILTNPIW-VIKTRIMS--TSKGAQGAYTSMYN----GVQQLLRTDGFQG 182

Query: 267 LYKGFIPKILRLGPGG 282
           L+KG +P +  +  G 
Sbjct: 183 LWKGLVPALFGVSQGA 198

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 73/323 (22%), Positives = 127/323 (39%), Gaps = 60/323 (18%)

Query: 7   PFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVK---- 62
           P   + +SG +AG    LV++PLD++K R+QL   S T +  A+ G    + +I++    
Sbjct: 8   PLQKEVISGLSAGSVTTLVVHPLDLLKVRLQL---SATSAQKAHYGPFMVIKEIIRSSAN 64

Query: 63  --REGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMF---------KDLYGV---DKLT 108
             R   + LY+G+S  +   A      F      +++            L GV    K+ 
Sbjct: 65  SGRSVTNELYRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKMN 124

Query: 109 QQISILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLE 168
             I + +G+ +G+  A +  P  ++K R+   +    G               S+YNG++
Sbjct: 125 SLIYLSAGASSGLMTAILTNPIWVIKTRIMSTSKGAQGAYT------------SMYNGVQ 172

Query: 169 STMWRNAF---WNG---GYFGV-----IFQIRALLPKAKTNTEK--------TTNDLIAG 209
             +  + F   W G     FGV      F +   L + K   ++        T  + I  
Sbjct: 173 QLLRTDGFQGLWKGLVPALFGVSQGALYFAVYDTLKQRKLRRKRENGLDIHLTNLETIEI 232

Query: 210 TIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYK 269
           T  G     T      ++KS +QS             K+   +P +  I + +GF  LYK
Sbjct: 233 TSLGKMVSVTLVYPFQLLKSNLQSFRANE-------QKFR-LFPLIKLIIANDGFVGLYK 284

Query: 270 GFIPKILRLGPGGGIMLVVFNGM 292
           G    ++R  P   I   V+  +
Sbjct: 285 GLSANLVRAIPSTCITFCVYENL 307

>Scas_687.15*
          Length = 328

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 71/332 (21%), Positives = 127/332 (38%), Gaps = 82/332 (24%)

Query: 11  QFVSGAAAGVSELLVMYPLDVVKTRMQLQ---VGSGTGSGVAYNGVIDCLGQIVKREGFS 67
           Q ++G+AA V E  + YP + +KT  QL    VG+     +    V              
Sbjct: 11  QILAGSAAAVFETTLTYPFEFLKTGFQLHRRTVGAKPFEALRPIKV-------------- 56

Query: 68  RLYKGISSPMLMEAPKRATKFACNDSYQKMFKD--LYGVDKLTQQISILSGSLAGVTEAC 125
             + G ++  L    K + +FA  D   ++ +D  L     L     +L+G L G  E+ 
Sbjct: 57  -YFAGCTALNLSAIVKTSVRFATFDKACQILRDPNLPKDSLLKGPRLLLAGILTGAVESL 115

Query: 126 VIVPFELVKIRL-----------------------------------------QDVNSKF 144
            I+PFE VK+ +                                         + V SK+
Sbjct: 116 CIIPFENVKVTMIENSLQLSESKPTEKEIAGTLKKKVTFHVAKPKQLSPQEQWRQVYSKY 175

Query: 145 NGPMEVVFKTIRET----GILSLYNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTE 200
             P   +F  ++E     G+     G   T++R    +   F     ++ L+     +  
Sbjct: 176 --PSSNIFSVVKEIYLTRGLRGFAQGAMPTVFRQVSNSTVRFTAYTTLKQLI-----SPT 228

Query: 201 KTTNDLIAGTIGGY--CRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKI 258
           +  N++ A  IG +  C        + VVK+R+QS              Y  +    +++
Sbjct: 229 QPLNEVYAFGIGLFSSCAVVALTQPIDVVKTRMQSKTAHYF--------YKNSLNCAYRV 280

Query: 259 YSEEGFTALYKGFIPKILRLGPGGGIMLVVFN 290
           + EEG  +L+KG++P++ ++G  GGI   V+ 
Sbjct: 281 FVEEGMVSLWKGWLPRLFKVGLSGGISFGVYQ 312

 Score = 36.2 bits (82), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 5/69 (7%)

Query: 4   KPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKR 63
           +PL  +Y F  G  +  + + +  P+DVVKTRMQ +          Y   ++C  ++   
Sbjct: 229 QPLNEVYAFGIGLFSSCAVVALTQPIDVVKTRMQSKTAH-----YFYKNSLNCAYRVFVE 283

Query: 64  EGFSRLYKG 72
           EG   L+KG
Sbjct: 284 EGMVSLWKG 292

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/210 (23%), Positives = 85/210 (40%), Gaps = 41/210 (19%)

Query: 103 GVDKLTQQISILSGSLAGVTEAC---VIVPFELVKIRLQDVN---SKFNGPMEVVFKTIR 156
            VDK +    + SG   GV+ +C   +I P + +KI  Q  N   SK+ G +  +++  +
Sbjct: 9   AVDKNSLDYVVRSGLAGGVSGSCAKTLIAPLDRIKILFQTSNPHYSKYAGSLVGLYEAAK 68

Query: 157 E----TGILSLYNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIG 212
                 GI   + G   T+ R   +    F    QIR++L  ++   E     L +G++ 
Sbjct: 69  HIWINDGIRGFFQGHSVTLLRIFPYAAVKFVAYEQIRSILIPSR-EYESHWRRLASGSLA 127

Query: 213 GYCR---------------YSTEHT---ILSVVKSRIQSGATTTLADGTVVPKYNWTWPS 254
           G C                Y TEH    +  +VK+     A+  L    +VPK+   W  
Sbjct: 128 GLCSVFITYPLDLTRVRLAYVTEHKRVKLRDIVKTIYHEPASEGLTSHLLVPKWFAHW-- 185

Query: 255 LFKIYSEEGFTALYKGFIPKILRLGPGGGI 284
                        Y+G++P +L + P  G+
Sbjct: 186 ----------CNFYRGYVPTVLGMIPYAGV 205

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 77/190 (40%), Gaps = 7/190 (3%)

Query: 10  YQFVSGAAAGVS---ELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGF 66
           Y   SG A GVS      ++ PLD +K   Q      +    +  G+ +    I   +G 
Sbjct: 17  YVVRSGLAGGVSGSCAKTLIAPLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHIWINDGI 76

Query: 67  SRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACV 126
              ++G S  +L   P  A KF   +  + +       +   ++++  SGSLAG+    +
Sbjct: 77  RGFFQGHSVTLLRIFPYAAVKFVAYEQIRSILIPSREYESHWRRLA--SGSLAGLCSVFI 134

Query: 127 IVPFELVKIRLQDVNSKFNGPMEVVFKTI-RETGILSLYNGLESTMWRNAFWNGGYFGVI 185
             P +L ++RL  V       +  + KTI  E     L + L    W  A W   Y G +
Sbjct: 135 TYPLDLTRVRLAYVTEHKRVKLRDIVKTIYHEPASEGLTSHLLVPKW-FAHWCNFYRGYV 193

Query: 186 FQIRALLPKA 195
             +  ++P A
Sbjct: 194 PTVLGMIPYA 203

 Score = 33.1 bits (74), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 31/162 (19%), Positives = 57/162 (35%), Gaps = 37/162 (22%)

Query: 11  QFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFS--- 67
           +  SG+ AG+  + + YPLD+ + R+           V    ++  +      EG +   
Sbjct: 120 RLASGSLAGLCSVFITYPLDLTRVRLAYVT---EHKRVKLRDIVKTIYHEPASEGLTSHL 176

Query: 68  ----------RLYKGISSPMLMEAPKRATKFACNDSYQKMFKDL----YGVDKLTQQ--- 110
                       Y+G    +L   P     F  +D    + K      Y V +L+ Q   
Sbjct: 177 LVPKWFAHWCNFYRGYVPTVLGMIPYAGVSFFAHDLIHDIMKSSLMAPYAVKQLSSQEEL 236

Query: 111 --------------ISILSGSLAGVTEACVIVPFELVKIRLQ 138
                           +++G L+G+       P E+++ RLQ
Sbjct: 237 ERKKLRQKTPLRTWAELVAGGLSGILSQTAAYPLEIIRRRLQ 278

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 86/180 (47%), Gaps = 22/180 (12%)

Query: 3   EKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVK 62
           ++ LP     ++  ++G++  ++  P+ V+KTR+     +G      Y    D + ++ +
Sbjct: 108 DRRLPAHAYMLAAGSSGIATAVLTNPIWVIKTRIMATSRAG-----PYKSTFDGVYKLYQ 162

Query: 63  REGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLY-GVDKLTQQISILSGSLAGV 121
            EG    ++G+  P L+   + A  FA  D+ +  F  L+   DK  +++S+    + G+
Sbjct: 163 TEGVLAFWRGV-VPSLLGVSQGAIYFALYDTLK--FHYLHSSTDKAERRLSV--SEIIGI 217

Query: 122 TEACV--------IVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWR 173
           T  C+        + PF+L+K +LQD  +  +G  ++V       GI   Y GL + + R
Sbjct: 218 T--CISKMISVTSVYPFQLLKSKLQDFGAP-SGITQLVQTVYSREGIRGFYRGLSANLLR 274

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 60/299 (20%), Positives = 121/299 (40%), Gaps = 37/299 (12%)

Query: 11  QFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR-L 69
           + +SG  AG    +  +P  +   +++LQ+ +G  +   Y G+I     I +R+ + R L
Sbjct: 11  EVISGLTAGTITTIASHP--LDLLKLRLQLSAGNRANTTYTGLIR---DIFERQQWGREL 65

Query: 70  YKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVD--------KLTQQISILSGSLAGV 121
           Y+G+   +L  +   A  F C    + +     G +        +L     +L+   +G+
Sbjct: 66  YRGLGVNLLGNSVAWALYFGCYRCAKDIALRHLGNESATGIMDRRLPAHAYMLAAGSSGI 125

Query: 122 TEACVIVPFELVKIRLQDVNSK--FNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNG 179
             A +  P  ++K R+   +    +    + V+K  +  G+L+ + G+  ++        
Sbjct: 126 ATAVLTNPIWVIKTRIMATSRAGPYKSTFDGVYKLYQTEGVLAFWRGVVPSLL-GVSQGA 184

Query: 180 GYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSV-----VKSRIQS- 233
            YF +   ++       ++T+K    L    I G    S   ++ SV     +KS++Q  
Sbjct: 185 IYFALYDTLK--FHYLHSSTDKAERRLSVSEIIGITCISKMISVTSVYPFQLLKSKLQDF 242

Query: 234 GATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGM 292
           GA + +               +  +YS EG    Y+G    +LR  P   I   V+  +
Sbjct: 243 GAPSGITQ------------LVQTVYSREGIRGFYRGLSANLLRAVPATCITFFVYENI 289

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 83/184 (45%), Gaps = 17/184 (9%)

Query: 4   KPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKR 63
           K L  +  F++G  AGV     +YP+D +K RMQ    +    G     +I    ++   
Sbjct: 316 KDLSKLSTFIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAELKGRKL--MIQTAKEMYTE 373

Query: 64  EGFSRLYKGISSPMLMEAPKRA---------TKFACNDSYQKMFKDLYGVDKLTQQISIL 114
            G    Y+G++  +L   P  A          K+  +   +K+ K    V+ L+  + + 
Sbjct: 374 GGLKLFYRGVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVE-LSNLVVLP 432

Query: 115 SGSLAGVTEACVIVPFELVKIRLQDVNS-----KFNGPMEVVFKTIRETGILSLYNGLES 169
            G+ +G   A V+ P  L++ RLQ   +     +++G  +V+ KTI+  G   L+ GL  
Sbjct: 433 MGAFSGTFGATVVYPINLLRTRLQAQGTFAHPYRYDGFRDVLLKTIQREGYPGLFKGLVP 492

Query: 170 TMWR 173
           T+ +
Sbjct: 493 TLAK 496

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 48/86 (55%), Gaps = 4/86 (4%)

Query: 15  GAAAGVSELLVMYPLDVVKTRMQLQVGSGT-GSGVAYNGVIDCLGQIVKREGFSRLYKGI 73
           GA +G     V+YP+++++TR+Q Q   GT      Y+G  D L + ++REG+  L+KG+
Sbjct: 434 GAFSGTFGATVVYPINLLRTRLQAQ---GTFAHPYRYDGFRDVLLKTIQREGYPGLFKGL 490

Query: 74  SSPMLMEAPKRATKFACNDSYQKMFK 99
              +    P  +  + C ++ +K+ K
Sbjct: 491 VPTLAKVCPAVSISYLCYENLKKLMK 516

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 64/324 (19%), Positives = 130/324 (40%), Gaps = 59/324 (18%)

Query: 12  FVSGAAAGVSELLVMYPLD------VVKTRMQLQVGSGTGSGVAYNG----------VID 55
           F++G  +GV       P D      + +T +   + + T   +A N           ++ 
Sbjct: 204 FIAGGISGVISRTCTAPFDRLKVFLIARTDLSSTLLNSTEDVLAKNPHAKPNKLRSPLVK 263

Query: 56  CLGQIVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMF------KDLYGVDKLTQ 109
            +  + ++ G    Y G     L   P+ + KF   +  +K+       KD   + KL+ 
Sbjct: 264 AIISLYRQGGIKSFYVGNGLNALKVFPESSIKFGSFEITKKLMTKVENCKDTKDLSKLS- 322

Query: 110 QISILSGSLAGVTEACVIVPFELVKIRLQ--DVNSKFNGPMEVVFKTIRET----GILSL 163
             + ++G LAGV     + P + +K R+Q   +N++  G  +++ +T +E     G+   
Sbjct: 323 --TFIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAELKG-RKLMIQTAKEMYTEGGLKLF 379

Query: 164 YNGLEST---MWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDL----------IAGT 210
           Y G+      ++  A  + G F ++ +        K N ++   +L           +GT
Sbjct: 380 YRGVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLVVLPMGAFSGT 439

Query: 211 IGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWT--WPSLFKIYSEEGFTALY 268
            G    Y      ++++++R+Q       A GT    Y +      L K    EG+  L+
Sbjct: 440 FGATVVYP-----INLLRTRLQ-------AQGTFAHPYRYDGFRDVLLKTIQREGYPGLF 487

Query: 269 KGFIPKILRLGPGGGIMLVVFNGM 292
           KG +P + ++ P   I  + +  +
Sbjct: 488 KGLVPTLAKVCPAVSISYLCYENL 511

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 75/163 (46%), Gaps = 16/163 (9%)

Query: 24  LVMYPLDVVKTRMQLQVG--SGTGSGVAYN-----GVIDCLGQIVKREGFSR-LYKGISS 75
           LV YPLD+V+TR+ +Q    +      A++     G+++ L +I + EG  R  Y+G+  
Sbjct: 131 LVTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYP 190

Query: 76  PMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIVPFELVKI 135
             L   P  A  FA  +  + +    Y    +     +  G+++G     V+ PF+L++ 
Sbjct: 191 TSLGVVPFVALNFALYERLKALIPHDYDAGSVAAA-KLAIGAVSGGIAQTVVYPFDLLRR 249

Query: 136 RLQ-------DVNSKFNGPMEVVFKTIRETGILSLYNGLESTM 171
           R Q       ++  ++    + ++   R+ G+   Y GL + +
Sbjct: 250 RFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANL 292

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 70/297 (23%), Positives = 124/297 (41%), Gaps = 27/297 (9%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNG-VIDCLGQIVKREGFSRLY 70
           FV+G   G     V+ P++ VK  +Q+Q      S  AYNG ++  + Q+ K EG   L+
Sbjct: 20  FVAGGVGGAVSRTVVSPVERVKILLQVQ-----SSTTAYNGGLVHAVKQVYKEEGVKGLF 74

Query: 71  KGISSPMLMEAPKRATKFACND-SYQKMFK-DLYGVDKLTQQISILSGSLAGVTEACVIV 128
           +G     L   P  A ++A  +    ++F     G ++L     ++ G+L G     V  
Sbjct: 75  RGNGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERLVGGALGGGASVLVTY 134

Query: 129 PFELVKIRL--QDVN------SKFN------GPMEVVFKTIRETGILS-LYNGLESTMWR 173
           P +LV+ RL  Q  N      SK +      G +E++ +  RE G L   Y G+  T   
Sbjct: 135 PLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLG 194

Query: 174 NAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQS 233
              +    F +  +++AL+P            L  G + G    +  +    +++ R Q 
Sbjct: 195 VVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYP-FDLLRRRFQ- 252

Query: 234 GATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFN 290
               T+    +  +Y     +L+ I  +EG    YKG    ++++ P   +   V+ 
Sbjct: 253 --VLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 47/90 (52%), Gaps = 3/90 (3%)

Query: 15  GAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGIS 74
           GA +G     V+YP D+++ R Q+     +  G  Y  V D L  I ++EG    YKG++
Sbjct: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLT 289

Query: 75  SPMLMEAPKRATKFACNDSYQKMFKDLYGV 104
           + ++   P  A ++     Y+ + ++++G+
Sbjct: 290 ANLVKVVPAMAVQWFV---YELISENMHGL 316

 Score = 30.0 bits (66), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 111 ISILSGSLAGVTEACVIVPFELVKIRLQDVNS--KFNGPM-EVVFKTIRETGILSLYNG 166
           I+ ++G + G     V+ P E VKI LQ  +S   +NG +   V +  +E G+  L+ G
Sbjct: 18  IAFVAGGVGGAVSRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRG 76

>YPR128C (ANT1) [5547] chr16 complement(791212..792198)
           Peroxisome-localized protein involved in adenine
           nucleotide transport, medium-chain fatty acid
           metabolism, and peroxisome proliferation, has similarity
           to ADP/ATP carrier proteins [987 bp, 328 aa]
          Length = 328

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 73/299 (24%), Positives = 117/299 (39%), Gaps = 54/299 (18%)

Query: 13  VSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGS---------GVAYNGVIDCLGQIVKR 63
           ++GA A     + +YPLD+ KT +Q QV   +              Y  V+DC+  I K 
Sbjct: 8   LTGAVASAMANIAVYPLDLSKTIIQSQVSPSSSEDSNEGKVLPNRRYKNVVDCMINIFKE 67

Query: 64  EGFSRLYKGISSPMLMEAPKRATKF----ACNDSYQKMFKDLYGVDKLTQQI-----SIL 114
           +G   LY+G++   +    +    F        SY K    L G+  L  +      S +
Sbjct: 68  KGILGLYQGMTVTTVATFVQNFVYFFWYTFIRKSYMK--HKLLGLQSLKNRDGPITPSTI 125

Query: 115 SGSLAGVTEACV----IVPFELVKIRLQDVNSKFNGPMEVVFKTI-RETGILSLYNGLES 169
              + GV  A +      P  +V  R Q V+S  +     V K I RE       NG  +
Sbjct: 126 EELVLGVAAASISQLFTSPMAVVATRQQTVHSAESAKFTNVIKDIYREN------NGDIT 179

Query: 170 TMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKT------TNDLIAGTIGGYCRYSTEHTI 223
                AFW G   G+   I   +  A     K       +ND  AG++      + ++ I
Sbjct: 180 -----AFWKGLRTGLALTINPSITYASFQRLKEVFFHDHSND--AGSLS-----AVQNFI 227

Query: 224 LSVVKSRIQSGATTTLADGTVV-----PKYNWTWPSLFKIYSEEGFTALYKGFIPKILR 277
           L V+   I +  T  L     +      K+     +L  +Y  EG  +L+KG +P++ +
Sbjct: 228 LGVLSKMISTLVTQPLIVAKAMLQSAGSKFTTFQEALLYLYKNEGLKSLWKGVLPQLTK 286

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 80/297 (26%), Positives = 128/297 (43%), Gaps = 27/297 (9%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71
           FV+GAAAG  E  V YP +  KTR+QL   +  GSG + N ++  L +  + +G   LY 
Sbjct: 14  FVAGAAAGAIEGCVTYPFEFAKTRLQL---AQQGSGESRNPLV-LLYRTARTQGAGALYV 69

Query: 72  GISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIV-PF 130
           G  + ++    K   +F   D+ ++  +D  G   L+    +L+G  AG+ E+ + V PF
Sbjct: 70  GCPAFVVGNTCKAGVRFLGFDALRRALQDERGA--LSGPRGMLAGLGAGLLESVLAVTPF 127

Query: 131 ELVKIRLQD--------VNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYF 182
           E VK  L D              G        +RE G+  LY GL     R A      F
Sbjct: 128 EAVKTALIDDRQAARPRYQHNGRGAARNYALLLRELGLRGLYGGLVPVALRQASNQAVRF 187

Query: 183 GVIFQIRALLPK-AKTNTEKTTNDLIAGTIGGYCRYSTEHTILSV--VKSRIQSGATTTL 239
           G   Q++  + + A T  ++         +G      T +  + V  VK+R+Q+      
Sbjct: 188 GCYTQLKQAVQRYAGTPADQPLGSGQTFLVGALSGIVTVYATMPVDTVKTRMQA------ 241

Query: 240 ADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFF 296
                  +Y  T      +  EEG  AL++G  P++ RL   GGI+   +  ++   
Sbjct: 242 ---LDAARYGSTVGCFRAVVREEGVRALWRGATPRLGRLVLSGGIVFTAYEKLLVLL 295

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 53/120 (44%), Gaps = 4/120 (3%)

Query: 78  LMEAPKRATKFACNDSYQKMFKDLYGV---DKLTQQISILSGSLAGVTEACVIVPFELVK 134
           L +A  +A +F C    ++  +   G      L    + L G+L+G+      +P + VK
Sbjct: 177 LRQASNQAVRFGCYTQLKQAVQRYAGTPADQPLGSGQTFLVGALSGIVTVYATMPVDTVK 236

Query: 135 IRLQDVNSKFNGPMEVVFKTI-RETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRALLP 193
            R+Q +++   G     F+ + RE G+ +L+ G    + R     G  F    ++  LLP
Sbjct: 237 TRMQALDAARYGSTVGCFRAVVREEGVRALWRGATPRLGRLVLSGGIVFTAYEKLLVLLP 296

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 7/77 (9%)

Query: 2   SEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIV 61
           +++PL     F+ GA +G+  +    P+D VKTRMQ            Y   + C   +V
Sbjct: 205 ADQPLGSGQTFLVGALSGIVTVYATMPVDTVKTRMQAL------DAARYGSTVGCFRAVV 258

Query: 62  KREGFSRLYKGISSPML 78
           + EG   L++G ++P L
Sbjct: 259 REEGVRALWRG-ATPRL 274

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 77/177 (43%), Gaps = 22/177 (12%)

Query: 16  AAAG----VSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71
           AAAG    +   LV  P + VK  +Q   G  +         +D   QIV+ +GF  L+K
Sbjct: 143 AAAGFISAIPTTLVTAPTERVKVVLQTTQGKAS--------FLDAAKQIVRTQGFQSLFK 194

Query: 72  GISSPMLMEAPKRATKFA----CNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVI 127
           G  + +  + P  A  FA    C +   K      G   +T     +SG +AGV+   V+
Sbjct: 195 GSLATLSRDGPGSALYFASYEICKEYLNKASGHTSGELSITN--VCISGGMAGVSMWVVV 252

Query: 128 VPFELVKIRLQDVNSKFNGPMEVVFKTIRET--GILSLYNGLESTMWRNAFWNGGYF 182
            P + VK +LQ  +SK    +EV  + I  T  GI   + G+   + R+   N   F
Sbjct: 253 FPIDTVKTQLQS-SSKRQSMLEVT-RMIYNTRGGIKGFFPGVGPAILRSFPANAATF 307

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 56/239 (23%), Positives = 96/239 (40%), Gaps = 19/239 (7%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRL-- 69
             +G   GV  +L  +P D+VK R Q          V++  ++    Q       + +  
Sbjct: 32  LAAGGVGGVCAVLTGHPFDLVKVRCQSNQARSAMDAVSH--ILQAARQAAGPTSLNAVRG 89

Query: 70  -YKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGV---------DKLTQQISILSGSLA 119
            YKG+  P+L   P  A  F   D  +K+   +             +LT      +G ++
Sbjct: 90  FYKGVVPPLLGVTPIFAVSFWGYDVGKKLVTSVPSSAASGAAAVEPELTLSQMAAAGFIS 149

Query: 120 GVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNG 179
            +    V  P E VK+ LQ    K +  ++   + +R  G  SL+ G  +T+ R+   + 
Sbjct: 150 AIPTTLVTAPTERVKVVLQTTQGKASF-LDAAKQIVRTQGFQSLFKGSLATLSRDGPGSA 208

Query: 180 GYFGVIFQIRALLPKAKTNTE---KTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGA 235
            YF      +  L KA  +T      TN  I+G + G   +     I   VK+++QS +
Sbjct: 209 LYFASYEICKEYLNKASGHTSGELSITNVCISGGMAGVSMWVVVFPI-DTVKTQLQSSS 266

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 39/88 (44%), Gaps = 9/88 (10%)

Query: 13  VSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVK-REGFSRLYK 71
           +SG  AGVS  +V++P+D VKT++Q        S      +++    I   R G    + 
Sbjct: 239 ISGGMAGVSMWVVVFPIDTVKTQLQ--------SSSKRQSMLEVTRMIYNTRGGIKGFFP 290

Query: 72  GISSPMLMEAPKRATKFACNDSYQKMFK 99
           G+   +L   P  A  F   +    +FK
Sbjct: 291 GVGPAILRSFPANAATFLGVELTHSLFK 318

 Score = 28.5 bits (62), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 40/89 (44%), Gaps = 7/89 (7%)

Query: 195 AKTNTEKTTN--DLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADG-TVVPKYNWT 251
           ++T ++ T N   L AG +GG C   T H    +VK R QS    +  D  + + +    
Sbjct: 19  SQTKSQLTENLKSLAAGGVGGVCAVLTGHP-FDLVKVRCQSNQARSAMDAVSHILQAARQ 77

Query: 252 WPSLFKIYSEEGFTALYKGFIPKILRLGP 280
                 + +  GF   YKG +P +L + P
Sbjct: 78  AAGPTSLNAVRGF---YKGVVPPLLGVTP 103

>Scas_716.29
          Length = 316

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 78/182 (42%), Gaps = 27/182 (14%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71
            V GA AG++   V YP DV++TR            VA + +     +I   EG    ++
Sbjct: 123 LVVGALAGMTSSFVSYPTDVLRTRFI------ANQDVALSSLSHGCKEIWNMEGIPGFFR 176

Query: 72  GISSPMLMEAPKRATKFACNDSYQKMFKDLYGVD-KLTQQISILSGSLAGVTEACVIVPF 130
           G ++ M       +  F   +S  K++ D Y  +   T  +   + S++GVT   V  P 
Sbjct: 177 GCTASMFTITLSASILFGTYESI-KIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPL 235

Query: 131 ELVKIRLQDVNS---KFNGPMEVV----------------FKTIRETGILSLYNGLESTM 171
           + ++ R+Q  NS   + N   ++V                   +R+ G+LSLY G+  ++
Sbjct: 236 DTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSL 295

Query: 172 WR 173
            +
Sbjct: 296 CK 297

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 66/301 (21%), Positives = 125/301 (41%), Gaps = 26/301 (8%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCL-GQIVKREGFSRLY 70
            V+G+ +G+    V+ PLD +K R+QL+    + +G A +G++  + G I+   G    +
Sbjct: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLR---PSYTGQAPSGLLKMMKGMILNEGGLRSFW 82

Query: 71  KGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIVPF 130
           KG     +M       +F+    Y  +F +   ++   Q  S++ G+LAG+T + V  P 
Sbjct: 83  KGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQ--SLVVGALAGMTSSFVSYPT 140

Query: 131 ELVKIRL---QDV--NSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVI 185
           ++++ R    QDV  +S  +G  E+        GI   + G  ++M+         FG  
Sbjct: 141 DVLRTRFIANQDVALSSLSHGCKEI----WNMEGIPGFFRGCTASMFTITLSASILFGTY 196

Query: 186 FQIRALLPKAK-----TNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLA 240
             I+    +       TN  + +   I+G       Y  + TI   ++ R        + 
Sbjct: 197 ESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLD-TIRRRIQVRNSVYVQHNVE 255

Query: 241 DGTVVPKYNWTWPSLF-----KIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAF 295
           +  V   Y     + F      I  +EG  +LY+G    + +  P   + L  +  +M  
Sbjct: 256 NKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRL 315

Query: 296 F 296
           +
Sbjct: 316 Y 316

 Score = 29.6 bits (65), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 20/27 (74%)

Query: 112 SILSGSLAGVTEACVIVPFELVKIRLQ 138
           S+++GS++G+    VI P + +KIRLQ
Sbjct: 25  SLVAGSVSGLLARTVIAPLDTLKIRLQ 51

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 48/86 (55%), Gaps = 4/86 (4%)

Query: 15  GAAAGVSELLVMYPLDVVKTRMQLQVGSGT-GSGVAYNGVIDCLGQIVKREGFSRLYKGI 73
           GA +G     V+YP+++++TR+Q Q   GT      Y G  D L + V+REG+  L+KG+
Sbjct: 429 GAFSGTVGATVVYPINLLRTRLQAQ---GTYAHPHTYTGFRDVLWKTVQREGYQGLFKGL 485

Query: 74  SSPMLMEAPKRATKFACNDSYQKMFK 99
              +    P  +  + C ++++++ K
Sbjct: 486 VPNLAKVCPAVSISYLCYENFKRLMK 511

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 75/169 (44%), Gaps = 15/169 (8%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71
           +++G   GV     +YP+D +K R+Q         G     +I    Q+ +  G    Y+
Sbjct: 319 YIAGGMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNEL--LISTARQMYRDGGLKLFYR 376

Query: 72  GISSPMLMEAPKRATKFACNDSYQKMF----KDLYG--VDKLT--QQISILSGSLAGVTE 123
           G++  ++   P  A       + +K +      + G  VD++T    I +  G+ +G   
Sbjct: 377 GVTVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVDQVTISNFIVLPMGAFSGTVG 436

Query: 124 ACVIVPFELVKIRLQDVNS-----KFNGPMEVVFKTIRETGILSLYNGL 167
           A V+ P  L++ RLQ   +      + G  +V++KT++  G   L+ GL
Sbjct: 437 ATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREGYQGLFKGL 485

 Score = 36.6 bits (83), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 53/278 (19%), Positives = 106/278 (38%), Gaps = 67/278 (24%)

Query: 53  VIDCLGQIVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVD---KLTQ 109
           +I     + ++ G    Y G    ++   P+ A KF   +  +++   L GV    +L++
Sbjct: 256 LIKAATTLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMAHLEGVHHTSELSK 315

Query: 110 QISILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLES 169
             + ++G + GV     + P + +K R+Q        P++   K           N L  
Sbjct: 316 FSTYIAGGMGGVVAQFSVYPIDTLKYRVQ------CAPLDTALKG----------NELLI 359

Query: 170 TMWRNAFWNGG----YFGVIFQIRALLPKAKTN-----------------------TEKT 202
           +  R  + +GG    Y GV   +  + P A  +                        + T
Sbjct: 360 STARQMYRDGGLKLFYRGVTVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVDQVT 419

Query: 203 TNDLI-------AGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWT--WP 253
            ++ I       +GT+G    Y      ++++++R+Q       A GT    + +T    
Sbjct: 420 ISNFIVLPMGAFSGTVGATVVYP-----INLLRTRLQ-------AQGTYAHPHTYTGFRD 467

Query: 254 SLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNG 291
            L+K    EG+  L+KG +P + ++ P   I  + +  
Sbjct: 468 VLWKTVQREGYQGLFKGLVPNLAKVCPAVSISYLCYEN 505

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 60/265 (22%), Positives = 106/265 (40%), Gaps = 26/265 (9%)

Query: 28  PLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGISSPMLMEAPKRATK 87
           P++ VKTR+QLQ     G    Y+G    +  I + EG   L +G++     +     ++
Sbjct: 31  PIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNGSR 90

Query: 88  FACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIV-----PFELVKIRLQDVNS 142
               D  +         D+ T   + L+ +      A +I      P +LVK R+Q +  
Sbjct: 91  LGLYDPLRAALGGCVLSDRRTYGTAALAVNATAGAAAGMIGAALGSPLQLVKTRMQALAP 150

Query: 143 KFNGPM-----EVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKT 197
           +   P+       +    ++ G+  LY G+++ + R         G   Q+ A+   AK 
Sbjct: 151 RRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTG------VGSAVQL-AVYSHAKE 203

Query: 198 NTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTL--ADGTVVPKYNWTWPSL 255
              +   D +A     Y   S   ++   +       A T +    G +   Y      L
Sbjct: 204 ALSRHVPDGMA----LYTLASALSSVAVCIAMNPFDVAMTRMYHHRGGL---YRGPLDCL 256

Query: 256 FKIYSEEGFTALYKGFIPKILRLGP 280
            K   +EGF+ALYKG + ++LR+ P
Sbjct: 257 CKTVRQEGFSALYKGHLAQLLRIAP 281

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 38/71 (53%), Gaps = 6/71 (8%)

Query: 13  VSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKG 72
           ++ A + V+  + M P DV  TRM    G        Y G +DCL + V++EGFS LYKG
Sbjct: 218 LASALSSVAVCIAMNPFDVAMTRMYHHRGG------LYRGPLDCLCKTVRQEGFSALYKG 271

Query: 73  ISSPMLMEAPK 83
             + +L  AP 
Sbjct: 272 HLAQLLRIAPH 282

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 66/174 (37%), Gaps = 17/174 (9%)

Query: 129 PFELVKIRLQ-------DVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGY 181
           P E VK RLQ        V+  ++GP + V    R  G+  L  GL          NG  
Sbjct: 31  PIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNGSR 90

Query: 182 FGVIFQIRA-----LLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGAT 236
            G+   +RA     +L   +T                    +   + L +VK+R+Q+   
Sbjct: 91  LGLYDPLRAALGGCVLSDRRTYGTAALAVNATAGAAAGMIGAALGSPLQLVKTRMQA--- 147

Query: 237 TTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFN 290
             LA   V P        L  ++ + G   LY+G    +LR G G  + L V++
Sbjct: 148 --LAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYS 199

>YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to C. elegans mitochondrial
           phosphate carrier protein [903 bp, 300 aa]
          Length = 300

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 53/282 (18%), Positives = 121/282 (42%), Gaps = 40/282 (14%)

Query: 28  PLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGISSPMLMEAPKRATK 87
           PLD+VK R+Q+       +   Y   +    +I+  EG+ ++Y G  +  +  + + A K
Sbjct: 38  PLDLVKCRLQV-------NPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGK 90

Query: 88  FACNDSYQKMFKDLY--GVDKLTQQISILSGSLAGVTEACVIVPFELVKIRLQDVNSKF- 144
           +   + ++ ++      GV      + +++ + A      ++ PFE +K++ Q     F 
Sbjct: 91  YGGYEYFKHLYSSWLSPGVT-----VYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFC 145

Query: 145 NGPMEVVFKTIRETG-ILSLYNGLESTMWRNAFWNGGYF----GVIFQIRALLPKAKTNT 199
           N  ++   K   E+G + + Y G+     R   +    F     ++ +I ++LPK K   
Sbjct: 146 NNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEM 205

Query: 200 ---EKTTNDLIAGTIGGYCRYSTEH---TILSVVKSRIQSGATTTLADGTVVPKYNWTWP 253
              ++ +   + G + G    +  H    ++S + S  ++  + ++A             
Sbjct: 206 NALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMSVASK----------- 254

Query: 254 SLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAF 295
              +IY + GFT L+ G + +I+ +G       ++++   A+
Sbjct: 255 ---RIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAY 293

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score = 47.8 bits (112), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 48/86 (55%), Gaps = 4/86 (4%)

Query: 15  GAAAGVSELLVMYPLDVVKTRMQLQVGSGT-GSGVAYNGVIDCLGQIVKREGFSRLYKGI 73
           GA +G     ++YP+++++TR+Q Q   GT      YNG  D L + ++REG+  L+KG+
Sbjct: 433 GAFSGTVGATLVYPINLLRTRLQAQ---GTYAHPHTYNGFSDVLKKTIQREGYQGLFKGL 489

Query: 74  SSPMLMEAPKRATKFACNDSYQKMFK 99
              +    P  +  + C ++ +++ K
Sbjct: 490 VPNLAKVCPAVSISYLCYENLKRLMK 515

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 78/170 (45%), Gaps = 17/170 (10%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRL-Y 70
           +++G   GV+    +YP+D +K R+Q    +   + +  + ++    + + ++G  RL Y
Sbjct: 323 YIAGGLGGVAAQFSVYPIDTLKYRIQC---APLNTNLKKSSILLQTAKEMYQQGGIRLFY 379

Query: 71  KGISSPMLMEAPKRATKFACNDSYQKMF-KDLYGVDKLTQQISILS-------GSLAGVT 122
           +G+   ++   P  A       + +K + K       L +   I+S       G+ +G  
Sbjct: 380 RGVHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNLIVLPMGAFSGTV 439

Query: 123 EACVIVPFELVKIRLQDVNS-----KFNGPMEVVFKTIRETGILSLYNGL 167
            A ++ P  L++ RLQ   +      +NG  +V+ KTI+  G   L+ GL
Sbjct: 440 GATLVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQREGYQGLFKGL 489

 Score = 36.6 bits (83), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 67/320 (20%), Positives = 126/320 (39%), Gaps = 51/320 (15%)

Query: 12  FVSGAAAGVSELLVMYPLDVVK------TRMQLQVGSGTGSGVAYNG----------VID 55
           F++G  +GV       P D +K      T +   + +   + +A N           +I 
Sbjct: 203 FIAGGCSGVVSRTCTAPFDRIKVFLIARTDLSSTLLNSKDTLLAKNPNADLSKIKSPLIK 262

Query: 56  CLGQIVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILS 115
               + ++ G    Y G    ++   P+ A KF   +  +++   L  V K T ++S LS
Sbjct: 263 AATTLYRQGGLRAFYVGNGLNVVKVFPESAIKFGSFEMAKRIMARLENV-KDTSELSRLS 321

Query: 116 ----GSLAGVTEACVIVPFELVKIRLQ--DVNSKFNGPMEVVFKTIRET----GILSLYN 165
               G L GV     + P + +K R+Q   +N+       ++ +T +E     GI   Y 
Sbjct: 322 TYIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKS-SILLQTAKEMYQQGGIRLFYR 380

Query: 166 GLE---STMWRNAFWNGGYFGVIFQIRALLPKAKT---NTEKTTNDLI-------AGTIG 212
           G+      ++  A  + G F  + +        KT     E   ++LI       +GT+G
Sbjct: 381 GVHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNLIVLPMGAFSGTVG 440

Query: 213 GYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFI 272
               Y      ++++++R+Q+  T           YN     L K    EG+  L+KG +
Sbjct: 441 ATLVYP-----INLLRTRLQAQGTYAHPH-----TYNGFSDVLKKTIQREGYQGLFKGLV 490

Query: 273 PKILRLGPGGGIMLVVFNGM 292
           P + ++ P   I  + +  +
Sbjct: 491 PNLAKVCPAVSISYLCYENL 510

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 86/225 (38%), Gaps = 44/225 (19%)

Query: 91  NDSYQKMFKDLY---GVDKLTQQISILSGSLAGVTEAC---VIVPFELVKIRLQDVNSKF 144
           NDSY+ + K+       D+ +    + SG   G++ +C   +I P + +KI  Q  N  +
Sbjct: 9   NDSYKHINKNTTQKTSFDRNSFDYIVRSGLAGGISGSCAKTLIAPLDRIKILFQTSNPHY 68

Query: 145 N-------GPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKT 197
                   G +E         G+   + G  +T+ R   +    F    QIR  L  +K 
Sbjct: 69  TKYTGSLIGLVEAAKHIWINDGVRGFFQGHSATLLRIFPYAAVKFVAYEQIRNTLIPSK- 127

Query: 198 NTEKTTNDLIAGTIGGYCR---------------YSTEHTILS---VVKSRIQSGATTTL 239
             E     L++G++ G C                Y TEH  +    ++K   +  A+ TL
Sbjct: 128 EFESHWRRLVSGSLAGLCSVFITYPLDLVRVRLAYETEHKRVKLGRIIKKIYKEPASATL 187

Query: 240 ADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGI 284
                +P +   W               Y+G++P +L + P  G+
Sbjct: 188 IKNDYIPNWFCHW------------CNFYRGYVPTVLGMIPYAGV 220

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 81/193 (41%), Gaps = 9/193 (4%)

Query: 8   FIYQFVSGAAAGVS---ELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKRE 64
           F Y   SG A G+S      ++ PLD +K   Q      T    +  G+++    I   +
Sbjct: 30  FDYIVRSGLAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWIND 89

Query: 65  GFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKL-TQQISILSGSLAGVTE 123
           G    ++G S+ +L   P  A KF    +Y+++   L    +  +    ++SGSLAG+  
Sbjct: 90  GVRGFFQGHSATLLRIFPYAAVKFV---AYEQIRNTLIPSKEFESHWRRLVSGSLAGLCS 146

Query: 124 ACVIVPFELVKIRLQ-DVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYF 182
             +  P +LV++RL  +   K      ++ K  +E    +L        W    W   Y 
Sbjct: 147 VFITYPLDLVRVRLAYETEHKRVKLGRIIKKIYKEPASATLIKNDYIPNW-FCHWCNFYR 205

Query: 183 GVIFQIRALLPKA 195
           G +  +  ++P A
Sbjct: 206 GYVPTVLGMIPYA 218

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/206 (20%), Positives = 74/206 (35%), Gaps = 59/206 (28%)

Query: 11  QFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKR------- 63
           + VSG+ AG+  + + YPLD+V+ R+  +                 LG+I+K+       
Sbjct: 135 RLVSGSLAGLCSVFITYPLDLVRVRLAYETEHKRVK----------LGRIIKKIYKEPAS 184

Query: 64  -------------EGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDL----YGVDK 106
                          +   Y+G    +L   P     F  +D    + K      Y V +
Sbjct: 185 ATLIKNDYIPNWFCHWCNFYRGYVPTVLGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLE 244

Query: 107 LTQQ-----------------ISILSGSLAGVTEACVIVPFELVKIRLQD--------VN 141
           L++                    ++SG LAG+       PFE+++ RLQ          +
Sbjct: 245 LSEDDELERVQKKQRRPLRTWAELISGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYD 304

Query: 142 SKFNGPMEVVFKTIRETGILSLYNGL 167
            KF    E+     +E G+   + GL
Sbjct: 305 HKFQSISEIAHIIFKERGVRGFFVGL 330

 Score = 31.2 bits (69), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 22/96 (22%), Positives = 41/96 (42%), Gaps = 4/96 (4%)

Query: 3   EKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGS-GTGSGVAYNGVIDCLGQIV 61
            +PL    + +SG  AG++     YP ++++ R+Q+   S  T     +  + +    I 
Sbjct: 259 RRPLRTWAELISGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQSISEIAHIIF 318

Query: 62  KREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKM 97
           K  G    + G+S   +   P  A  F     Y++M
Sbjct: 319 KERGVRGFFVGLSIGYIKVTPMVACSFFV---YERM 351

>Scas_697.47
          Length = 328

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 101/243 (41%), Gaps = 23/243 (9%)

Query: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAY----NGVIDCLGQIVKR- 63
           +   V+G   GV  +L  +P D++K R Q    S T   +         I     +V   
Sbjct: 37  LKSLVAGGVGGVCAVLTGHPFDLIKVRCQSGQASSTIHAIKIILKDARAIPTSNMLVNSV 96

Query: 64  EGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMF-KDLYGVDKLTQQISILSGSLAGVT 122
           +GF   YKG+  P+L   P  A  F   D  +K+  +      +LT      +G ++ + 
Sbjct: 97  KGF---YKGVIPPLLGVTPIFAVSFWGYDVGKKIVTRSDSSSAQLTMGQMAAAGFISAIP 153

Query: 123 EACVIVPFELVKIRLQD--VNSK--FNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWN 178
              V  P E +K+ LQ    NSK  F G  + +   +++ G+ SL+ G  +T+ R+   +
Sbjct: 154 TTLVTAPTERIKVVLQTAGANSKTSFIGAAKNI---VKDGGVKSLFKGSLATLARDGPGS 210

Query: 179 GGYFGV------IFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQ 232
             YF            R    ++KT      N  +AG I G   +     I   +K+++Q
Sbjct: 211 ALYFASYEISKKFLNDRNATAESKTGEVNIANVCLAGGIAGMSMWLVVFPI-DTIKTKLQ 269

Query: 233 SGA 235
           S +
Sbjct: 270 SSS 272

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 43/87 (49%), Gaps = 7/87 (8%)

Query: 13  VSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKG 72
           ++G  AG+S  LV++P+D +KT+  LQ  SG+ S VA    I      VKR G    + G
Sbjct: 245 LAGGIAGMSMWLVVFPIDTIKTK--LQSSSGSQSMVAATREI-----YVKRGGIKGFFPG 297

Query: 73  ISSPMLMEAPKRATKFACNDSYQKMFK 99
           +   +L   P  A  F   +    +FK
Sbjct: 298 LGPALLRSFPANAATFLGVELTHSLFK 324

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 38/84 (45%), Gaps = 18/84 (21%)

Query: 205 DLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTT--------LADGTVVPKYNWTWPSLF 256
            L+AG +GG C   T H    ++K R QSG  ++        L D   +P  N       
Sbjct: 39  SLVAGGVGGVCAVLTGHP-FDLIKVRCQSGQASSTIHAIKIILKDARAIPTSNML----- 92

Query: 257 KIYSEEGFTALYKGFIPKILRLGP 280
            + S +GF   YKG IP +L + P
Sbjct: 93  -VNSVKGF---YKGVIPPLLGVTP 112

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score = 46.6 bits (109), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 59/129 (45%), Gaps = 7/129 (5%)

Query: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR 68
           ++  V+G+ +G+    V  P+D VK R QLQ+ S       Y+G++     + + EG   
Sbjct: 25  LHAVVAGSVSGLVARSVTAPMDTVKIRRQLQLASEH----KYHGILHTFRTVAREEGVRA 80

Query: 69  LYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIV 128
           L+KG      M     + +F    +Y  +           Q  S+  G+LAG+  + +  
Sbjct: 81  LWKGNVPASAMYVLYGSLQFG---TYAWLNTAAASAGLPPQAHSLAVGALAGLVSSLLTY 137

Query: 129 PFELVKIRL 137
           P +L++ RL
Sbjct: 138 PLDLLRTRL 146

 Score = 35.0 bits (79), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query: 112 SILSGSLAGVTEACVIVPFELVKIRLQ---DVNSKFNGPMEVVFKTIRETGILSLYNG 166
           ++++GS++G+    V  P + VKIR Q       K++G +       RE G+ +L+ G
Sbjct: 27  AVVAGSVSGLVARSVTAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKG 84

 Score = 35.0 bits (79), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 40/178 (22%), Positives = 71/178 (39%), Gaps = 29/178 (16%)

Query: 7   PFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIV-KREG 65
           P  +    GA AG+   L+ YPLD+++TR+         +  A+   +    +++   EG
Sbjct: 117 PQAHSLAVGALAGLVSSLLTYPLDLLRTRL-------VANRSAHFFSLRRQARVIWDTEG 169

Query: 66  FSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEAC 125
            +  ++G +  +          F   ++   +  D YG+  L    S      AG+    
Sbjct: 170 PAGFFRGGAWAIAATTLTTGLIFGIYETC-TIAADTYGLPWLAAAAS----PTAGLVSKA 224

Query: 126 VIVPFELVKIRLQDVNSKF-----NGP-----------MEVVFKTIRETGILSLYNGL 167
            + P + V+ RLQ V++K        P           + +    +R  GI SLY GL
Sbjct: 225 AVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGL 282

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 42/86 (48%), Gaps = 10/86 (11%)

Query: 6   LPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQL----QVGSGTGSGVAYNGV--IDCLG- 58
           LP++    S  A  VS+  V +PLD V+ R+Q+     +   T    AY+ +     LG 
Sbjct: 207 LPWLAAAASPTAGLVSKAAV-FPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGL 265

Query: 59  --QIVKREGFSRLYKGISSPMLMEAP 82
              +V+ EG + LYKG++  +    P
Sbjct: 266 AVHMVRAEGIASLYKGLTMALCKSTP 291

>Kwal_23.3042
          Length = 542

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 75/169 (44%), Gaps = 15/169 (8%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71
           +++G   GV   L +YP+D +K R+Q    +    G     +I     + K  G    Y+
Sbjct: 348 YLAGGLGGVMAQLSVYPIDTLKYRVQCAPLNTESKGRQL--LISTAKDMYKEGGLRIFYR 405

Query: 72  GISSPMLMEAPKRATKFACNDSYQKMF----KDLYGVDK----LTQQISILSGSLAGVTE 123
           GI+  ++   P  A       + +K +      L G+ +    ++    +L G+ +G   
Sbjct: 406 GITVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQVTMSNMFVLLMGAFSGTVG 465

Query: 124 ACVIVPFELVKIRLQDVNS-----KFNGPMEVVFKTIRETGILSLYNGL 167
           A  + P  L++ RLQ   +     ++NG  +V+ KT++  G   L+ GL
Sbjct: 466 ATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREGYQGLFKGL 514

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 49/92 (53%), Gaps = 4/92 (4%)

Query: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGT-GSGVAYNGVIDCLGQIVKREGFS 67
           ++  + GA +G      +YP+++++TR+Q Q   GT      YNG  D L + V+REG+ 
Sbjct: 452 MFVLLMGAFSGTVGATAVYPVNLLRTRLQAQ---GTFAHPHRYNGFRDVLLKTVQREGYQ 508

Query: 68  RLYKGISSPMLMEAPKRATKFACNDSYQKMFK 99
            L+KG+   +    P  +  + C ++ ++  K
Sbjct: 509 GLFKGLVPNLAKVCPAVSISYLCYENLKRGMK 540

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 49/232 (21%), Positives = 96/232 (41%), Gaps = 31/232 (13%)

Query: 82  PKRATKFACNDSYQKMFKDLYGVDK---LTQQISILSGSLAGVTEACVIVPFELVKIRLQ 138
           P+ A KF   +  +++   L GV     L++  + L+G L GV     + P + +K R+Q
Sbjct: 314 PESAIKFGSFELAKRLMAQLEGVQDTAGLSRFSTYLAGGLGGVMAQLSVYPIDTLKYRVQ 373

Query: 139 --DVNSKFNGPMEVVFKT---IRETGILSLYNGLE---------STMWRNAFWNGGYFGV 184
              +N++  G   ++       +E G+   Y G+          + M    F     + +
Sbjct: 374 CAPLNTESKGRQLLISTAKDMYKEGGLRIFYRGITVGIMGIFPYAAMDLGTFSALKKWYI 433

Query: 185 IFQIRAL-LPKAKTNTEKTTNDLI---AGTIGGYCRYSTEHTILSVVKSRIQSGATTTLA 240
             Q R   LP+ +         L+   +GT+G    Y      ++++++R+Q+  T    
Sbjct: 434 ARQARLTGLPEDQVTMSNMFVLLMGAFSGTVGATAVYP-----VNLLRTRLQAQGTFAHP 488

Query: 241 DGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGM 292
                 +YN     L K    EG+  L+KG +P + ++ P   I  + +  +
Sbjct: 489 H-----RYNGFRDVLLKTVQREGYQGLFKGLVPNLAKVCPAVSISYLCYENL 535

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/190 (22%), Positives = 77/190 (40%), Gaps = 17/190 (8%)

Query: 13  VSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKG 72
           ++G  AG     ++ PLD +K   Q           +  G++     I+  +G    ++G
Sbjct: 24  LAGGIAGSCAKTLVAPLDRIKILFQTSNPQFAQFAGSMGGLVRASKYIMAHDGPRGFFQG 83

Query: 73  ISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIVPFEL 132
            S+ +L   P  A KF   +  + +    +  +   +++  LSGSLAG+    V  P +L
Sbjct: 84  HSATLLRIFPYAAIKFIAYEQIRSVVIPTWRHESHWRRL--LSGSLAGLCSVFVTYPLDL 141

Query: 133 VKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRN-------AFWNGGYFGVI 185
           V++RL  V  + +  +  +   I        YN   S   R        A W+  Y G  
Sbjct: 142 VRVRLAYVTERHDAKVRKIMACI--------YNERPSEALRKWYIPQWFAHWSNFYRGYT 193

Query: 186 FQIRALLPKA 195
             +  ++P A
Sbjct: 194 PTVIGMIPYA 203

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 68/175 (38%), Gaps = 33/175 (18%)

Query: 11  QFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREG----- 65
           + +SG+ AG+  + V YPLD+V+ R+                ++ C+      E      
Sbjct: 121 RLLSGSLAGLCSVFVTYPLDLVRVRLAYVTERHDAK---VRKIMACIYNERPSEALRKWY 177

Query: 66  -------FSRLYKGISSPMLMEAPKRATKFACNDSYQKMFK----DLYGV---------D 105
                  +S  Y+G +  ++   P     F  +D  Q +F+    + Y V         D
Sbjct: 178 IPQWFAHWSNFYRGYTPTVIGMIPYAGVSFFAHDLCQDIFRHPMLEPYSVLSPGGSSAYD 237

Query: 106 K---LTQQISILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRE 157
           +   L     +++G LAG+       PFE+++ RLQ   S    P    F  I E
Sbjct: 238 RTVPLKTWAQLVAGGLAGMASQTAAYPFEIIRRRLQ--VSAITDPTRRHFVGINE 290

 Score = 29.3 bits (64), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 40/85 (47%), Gaps = 3/85 (3%)

Query: 5   PLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKRE 64
           PL    Q V+G  AG++     YP ++++ R  LQV + T     +   I+ + +I+  E
Sbjct: 241 PLKTWAQLVAGGLAGMASQTAAYPFEIIRRR--LQVSAITDPTRRHFVGINEIAKIIYTE 298

Query: 65  GFSR-LYKGISSPMLMEAPKRATKF 88
           G  R  + G+S   +   P  A  F
Sbjct: 299 GGWRGFFVGLSIGYIKVTPMVACSF 323

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/226 (22%), Positives = 91/226 (40%), Gaps = 15/226 (6%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71
            V+G+ +G+     + PLD VK ++Q+           +N   + L  I+KREG    +K
Sbjct: 19  LVAGSLSGLFARTCIAPLDTVKIKLQV---------TPHNKNANVLINILKREGIRGFWK 69

Query: 72  GISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIVPFE 131
           G     +M       +F          +    ++   Q  S L GSLAG+T +    PF+
Sbjct: 70  GNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFD 129

Query: 132 LVKIRL-QDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRA 190
           +++ R   +   +     + +       G++  ++G  S+M          FGV   I+ 
Sbjct: 130 VLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKI 189

Query: 191 LLPKAKTNTEK----TTNDLIAGTIGGYCRYSTEHTILSVVKSRIQ 232
              +    +++    T  + +AG I G+         L  V+ RIQ
Sbjct: 190 FTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFP-LDTVRRRIQ 234

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 58/139 (41%), Gaps = 9/139 (6%)

Query: 7   PFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGF 66
           P +Y  + G+ AG++  L  YP DV++TR      +  G  +      D +  I   EG 
Sbjct: 106 PQLYSCLVGSLAGMTSSLASYPFDVLRTRF---AANSQGQLIKLR---DEIMAIWSHEGL 159

Query: 67  SRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISI---LSGSLAGVTE 123
              + G  S M+      A  F   +S +   ++   +       ++   L+G ++G T 
Sbjct: 160 MGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTS 219

Query: 124 ACVIVPFELVKIRLQDVNS 142
                P + V+ R+Q  NS
Sbjct: 220 KLATFPLDTVRRRIQIRNS 238

 Score = 36.2 bits (82), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 40/195 (20%), Positives = 75/195 (38%), Gaps = 13/195 (6%)

Query: 105 DKLTQQISILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLY 164
           ++++   S+++GSL+G+     I P + VKI+LQ   +  N    V+   ++  GI   +
Sbjct: 11  EEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQV--TPHNKNANVLINILKREGIRGFW 68

Query: 165 NGLESTMWRNAFWNGGYFGVIFQIRALLPKA-KTNTEKTTNDLIAGTIGGYCRYSTEHTI 223
            G          + G  FG    I + L      N        + G++ G    S     
Sbjct: 69  KGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTS-SLASYP 127

Query: 224 LSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGG 283
             V+++R  + +   L               +  I+S EG    + G    ++ +G    
Sbjct: 128 FDVLRTRFAANSQGQLIK---------LRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTA 178

Query: 284 IMLVVFNGMMAFFQE 298
           IM  V+  +  F +E
Sbjct: 179 IMFGVYESIKIFTEE 193

 Score = 28.5 bits (62), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 39/97 (40%), Gaps = 23/97 (23%)

Query: 196 KTNTEKTTNDLIAGTIGG-YCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPS 254
           K     TTN L+AG++ G + R  T    L  VK ++Q            V  +N     
Sbjct: 9   KDEEVSTTNSLVAGSLSGLFAR--TCIAPLDTVKIKLQ------------VTPHNKNANV 54

Query: 255 LFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNG 291
           L  I   EG    +KG +P        G IM +++ G
Sbjct: 55  LINILKREGIRGFWKGNVP--------GSIMYIIYGG 83

>Scas_578.3*
          Length = 524

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 70/322 (21%), Positives = 128/322 (39%), Gaps = 53/322 (16%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKT---------------RMQLQVGSGTGSGVAYNGVIDC 56
           F++G  +GV       PLD +K                +M L++  G       + +I  
Sbjct: 212 FIAGGLSGVISRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRI-QGLNLAKIRSPIIKA 270

Query: 57  LGQIVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISIL-- 114
           +  + ++ G    Y G    +    P+ + KF   +  +++  +L G DKL   +S L  
Sbjct: 271 IRSLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLMANLSG-DKLVNDLSKLQT 329

Query: 115 --SGSLAGVTEACVIVPFELVKIRLQ----DVNSKFNGPMEVVFKTI-RETGILSLYNGL 167
             +G +AGV     I P + +K R+Q    + N K N  +    K + +E GI   Y G+
Sbjct: 330 YVAGGIAGVMAQISIYPIDTLKFRIQCAPLEGNLKGNALLISTAKEMYKEGGIRVFYRGV 389

Query: 168 ---ESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDL----------IAGTIGGY 214
                 ++  A  + G F  + +        K N  +    L           +GT+G  
Sbjct: 390 LLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVMLSYLLVLPMGAFSGTVGAT 449

Query: 215 CRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWT-WPSLF-KIYSEEGFTALYKGFI 272
             Y      ++++++R+Q       A GT    Y +T +  +F +    EG    YKG +
Sbjct: 450 AVYP-----INLLRTRLQ-------AQGTYAHPYTYTGFRDVFMQTLKREGVPGFYKGLV 497

Query: 273 PKILRLGPGGGIMLVVFNGMMA 294
           P ++++ P   I  + +    A
Sbjct: 498 PTLVKVCPAVSIGYLCYEKFKA 519

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 92/212 (43%), Gaps = 18/212 (8%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGT---GSGVAYNGVIDCLGQIVKREGFSR 68
            ++GA +G+    +  P+D +K R+QL   +G    GS      V++    ++K EG   
Sbjct: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGS-----QVMEVARSMIKNEGIRS 74

Query: 69  LYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIV 128
            +KG     L+     + +F+    + +     +G++      S++ G+ AG+T + V  
Sbjct: 75  FWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTP-FGLEARLH--SLVVGAFAGITSSIVSY 131

Query: 129 PFELVKIRLQDVNSKFNGPMEVVFKTI-RETGILSLYNGLESTMWRNAFWNGGYFGVIFQ 187
           PF++++ RL   N   +  +    + I +  G+   + G  ++M          FG    
Sbjct: 132 PFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYET 191

Query: 188 IRALLPKAKTNT------EKTTNDLIAGTIGG 213
           IR    + +  T      E  T +  AGTIGG
Sbjct: 192 IRIYCDENEKTTAAHKKWELATLNHSAGTIGG 223

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 87/216 (40%), Gaps = 51/216 (23%)

Query: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYN-----GVIDCLGQIVKR 63
           ++  V GA AG++  +V YP DV++TR+           VA N      +   +  I K 
Sbjct: 113 LHSLVVGAFAGITSSIVSYPFDVLRTRL-----------VANNQMHSMSITREVRDIWKL 161

Query: 64  EGFSRLYKGISSPM--------LMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILS 115
           EG    +KG  + M        +M       +  C+++ +K        +  T   S  +
Sbjct: 162 EGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDEN-EKTTAAHKKWELATLNHS--A 218

Query: 116 GSLAGVTEACVIVPFELVKIRLQDVNSKF----------------NGPMEVVFKTIRETG 159
           G++ GV    +  P E ++ R+Q +NSK                  G   +  + +++ G
Sbjct: 219 GTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEG 278

Query: 160 ILSLYNGLESTMWRN------AFWNGGYFGVIFQIR 189
           + SLY G+   + +       +FW  GY   I  +R
Sbjct: 279 VSSLYRGILVALSKTIPTTFVSFW--GYETAIHYLR 312

 Score = 32.3 bits (72), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 5/60 (8%)

Query: 112 SILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGP-----MEVVFKTIRETGILSLYNG 166
           ++L+G+++G+    +  P + +KIRLQ   +    P     MEV    I+  GI S + G
Sbjct: 19  TLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKG 78

>Kwal_23.5757
          Length = 307

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/282 (20%), Positives = 109/282 (38%), Gaps = 36/282 (12%)

Query: 28  PLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGISSPMLMEAPKRATK 87
           PLD+VK R Q+           Y   +D   QIV+ EG ++++ G+ +  +  + + A K
Sbjct: 39  PLDLVKCRRQVDAS-------LYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFK 91

Query: 88  FACNDSYQKMFKDLYGVDKLTQQ---ISILSGSLAGVTEACVIVPFELVKIRLQD-VNSK 143
           +   + ++  +  L   +        I + + + A       + P+E +K+R Q  V   
Sbjct: 92  YGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPP 151

Query: 144 F-NGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFG----VIFQIRALLPKAKTN 198
           F     +   K +   G  SLY G+    +R   +    F     ++  I A LP  K  
Sbjct: 152 FARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKRE 211

Query: 199 TEK---TTNDLIAGTIGGYCRYSTEH---TILSVVKSRIQSGATTTLADGTVVPKYNWTW 252
             +    +     G + G       H    ++S V +  +SG +T  A            
Sbjct: 212 MSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSGESTLQATS---------- 261

Query: 253 PSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMA 294
               +IY + GF  L+ G   +IL +G       ++++   A
Sbjct: 262 ----RIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFKA 299

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 74/168 (44%), Gaps = 18/168 (10%)

Query: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR 68
           I+   S +A  ++++ +  P + +K R Q  V            V D   ++V  EGF+ 
Sbjct: 118 IFLAASASAEFIADIFLC-PWEAIKVRQQTAVPPPFA-----RNVFDAYSKMVGAEGFAS 171

Query: 69  LYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYG--------VDKLTQ-QISILSGSLA 119
           LYKGI+     + P    KF    S++++ + +Y         + +L Q  +S   G LA
Sbjct: 172 LYKGITPLWFRQIPYTMCKFT---SFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLA 228

Query: 120 GVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGL 167
           G+  A V  P +++  ++ +        ++   +   + G   L+NGL
Sbjct: 229 GILCAVVSHPADVMVSKVNNERKSGESTLQATSRIYGKIGFPGLWNGL 276

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 66/177 (37%), Gaps = 25/177 (14%)

Query: 114 LSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTM-- 171
           L G +A       + P +LVK R Q   S +   ++   + +R  G   ++ G+ +T   
Sbjct: 24  LGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIG 83

Query: 172 --WRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGY------CRYSTEHTI 223
              + AF  GGY     Q   L+     ++ +T   L A     +      C +      
Sbjct: 84  YSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWE----- 138

Query: 224 LSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGP 280
              +K R Q+      A   V   Y+       K+   EGF +LYKG  P   R  P
Sbjct: 139 --AIKVRQQTAVPPPFAR-NVFDAYS-------KMVGAEGFASLYKGITPLWFRQIP 185

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 46/83 (55%), Gaps = 4/83 (4%)

Query: 15  GAAAGVSELLVMYPLDVVKTRMQLQVGSGT-GSGVAYNGVIDCLGQIVKREGFSRLYKGI 73
           GA +G     V+YP+++++TR+Q Q   GT      YNG  D L + ++REG+  L+KG+
Sbjct: 461 GAFSGTVGASVVYPINLLRTRLQAQ---GTYAHPYVYNGFKDVLLKTLEREGYQGLFKGL 517

Query: 74  SSPMLMEAPKRATKFACNDSYQK 96
              +    P  +  + C ++ +K
Sbjct: 518 VPTLAKVCPAVSISYLCYENLKK 540

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 86/184 (46%), Gaps = 17/184 (9%)

Query: 4   KPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKR 63
           K L     +++G  AG++    +YP+D +K R+Q    +   + +  N ++    + + R
Sbjct: 343 KDLSKFSTYIAGGLAGMAAQFSVYPIDTLKFRVQC---APLDTKLKGNNLLFQTAKDMFR 399

Query: 64  EGFSRL-YKGISSPMLMEAPKRATKFACNDSYQKMF--KDLYGVDKLTQQISILS----- 115
           EG  RL Y+G++  ++   P  A       + +K +  K    ++    Q+++ +     
Sbjct: 400 EGGLRLFYRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVTLSNLVVLP 459

Query: 116 -GSLAGVTEACVIVPFELVKIRLQDVNSK-----FNGPMEVVFKTIRETGILSLYNGLES 169
            G+ +G   A V+ P  L++ RLQ   +      +NG  +V+ KT+   G   L+ GL  
Sbjct: 460 MGAFSGTVGASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLEREGYQGLFKGLVP 519

Query: 170 TMWR 173
           T+ +
Sbjct: 520 TLAK 523

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 69/326 (21%), Positives = 134/326 (41%), Gaps = 57/326 (17%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQ------------ 59
           F++G  +GV       P D +K  +   +     S +  N   D L +            
Sbjct: 231 FIAGGISGVISRTCTAPFDRLKVFL---IARTDLSSILLNSKTDLLAKNPNADINKISSP 287

Query: 60  -------IVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYG---VDKLTQ 109
                  + ++ G    Y G    ++   P+ + KF   +  +K+   L G      L++
Sbjct: 288 LAKAVKSLYRQGGIKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIMTKLEGCRDTKDLSK 347

Query: 110 QISILSGSLAGVTEACVIVPFELVKIRLQ--DVNSKFNGPMEVVFKT----IRETGILSL 163
             + ++G LAG+     + P + +K R+Q   +++K  G   ++F+T     RE G+   
Sbjct: 348 FSTYIAGGLAGMAAQFSVYPIDTLKFRVQCAPLDTKLKGN-NLLFQTAKDMFREGGLRLF 406

Query: 164 YNGLESTM---WRNAFWNGGYFGVIFQIRALLPKAKT----NTEKTTNDLI-------AG 209
           Y G+   +   +  A  + G F  + +   +  +AKT      + T ++L+       +G
Sbjct: 407 YRGVTVGIVGIFPYAALDLGTFSAL-KKWYIAKQAKTLNLPQDQVTLSNLVVLPMGAFSG 465

Query: 210 TIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYK 269
           T+G    Y      ++++++R+Q  A  T A   V   YN     L K    EG+  L+K
Sbjct: 466 TVGASVVYP-----INLLRTRLQ--AQGTYAHPYV---YNGFKDVLLKTLEREGYQGLFK 515

Query: 270 GFIPKILRLGPGGGIMLVVFNGMMAF 295
           G +P + ++ P   I  + +  +  F
Sbjct: 516 GLVPTLAKVCPAVSISYLCYENLKKF 541

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 63/308 (20%), Positives = 119/308 (38%), Gaps = 26/308 (8%)

Query: 1   MSEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQI 60
           M+E+P       + G   G++  +V+ P D++KTR+Q Q    T  G      I    Q+
Sbjct: 1   MAERP-KTSSHLIGGFVGGLTSAIVLQPFDLLKTRLQ-QNKDTTLWGTLKE--IRSPKQL 56

Query: 61  VKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAG 120
            +    S L   I S + +               Q +      + +LT   ++ SG+   
Sbjct: 57  WRGALPSSLRTSIGSALYLSTLNVFRTAMAKGKTQTLNPGSSFLPQLTMYENLASGAFTR 116

Query: 121 VTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGG 180
                + +P  ++K+R +     +    E         GI   +NG  +T+ R+A + G 
Sbjct: 117 GVVGFITMPITIIKVRYESTMYSYKSLGEATRHIYSTEGIRGFFNGCGATVMRDAPYAGL 176

Query: 181 YFGVIFQIRALLPKAKTNTE---------KTTNDLIAGTIGGYCRYSTEHTILS---VVK 228
           Y  +  + + L+P    ++           T    +  +I  +   S   TI S    +K
Sbjct: 177 YVLLYEKAKLLVPMMLPSSTISYDEAGMFTTYTSTVVNSISAFMSASLATTITSPFDTIK 236

Query: 229 SRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVV 288
           +R+Q   T          K++  + +L  I S+E F  L+ G   ++ R     GI   +
Sbjct: 237 TRMQLDPT----------KFSGFYKTLVLIVSKEKFKNLFDGLTLRLTRKAFSAGIAWGI 286

Query: 289 FNGMMAFF 296
           +  ++  F
Sbjct: 287 YEELIKRF 294

>AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 315
           aa]
          Length = 315

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 62/144 (43%), Gaps = 2/144 (1%)

Query: 28  PLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGISSPMLMEAPKRATK 87
           PL  + TRMQ+        G      ++ + +I ++EG    Y G+ S M   A      
Sbjct: 36  PLVTLATRMQVS-EQDKEPGTRSKSKLEAVREIYRKEGVVGFYYGLESAMYGMAANSLNY 94

Query: 88  FACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGP 147
           +   +   +    + G  +L    +ILS ++AG   A    P  +V  R+    S+    
Sbjct: 95  YYFYELAARATMRVRGSRRLNTSEAILSSAVAGSMTAIASNPIWVVNTRMTVAKSE-QST 153

Query: 148 MEVVFKTIRETGILSLYNGLESTM 171
           + V+   +R+ G+ +L+NGL   +
Sbjct: 154 LAVLLDIVRKDGVTALFNGLRPAL 177

 Score = 31.6 bits (70), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 34/159 (21%), Positives = 64/159 (40%), Gaps = 19/159 (11%)

Query: 125 CVIVPFELVKIRLQ------DVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWN 178
            + +P   +  R+Q      +  ++    +E V +  R+ G++  Y GLES M+  A  +
Sbjct: 32  ALTMPLVTLATRMQVSEQDKEPGTRSKSKLEAVREIYRKEGVVGFYYGLESAMYGMAANS 91

Query: 179 GGYFGVI-FQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATT 237
             Y+       RA +    +    T+  +++  + G       + I  VV +R+      
Sbjct: 92  LNYYYFYELAARATMRVRGSRRLNTSEAILSSAVAGSMTAIASNPIW-VVNTRM------ 144

Query: 238 TLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKIL 276
                TV      T   L  I  ++G TAL+ G  P ++
Sbjct: 145 -----TVAKSEQSTLAVLLDIVRKDGVTALFNGLRPALM 178

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 2/64 (3%)

Query: 10  YQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRL 69
           + F+ GA   ++     YP   +KTRM L    G         +   +  IVK+EG   L
Sbjct: 210 WAFLLGAVGKLAATGSTYPYITLKTRMHL--AKGKEDADTQQSMWSLMVDIVKKEGIQGL 267

Query: 70  YKGI 73
           Y GI
Sbjct: 268 YHGI 271

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 68/305 (22%), Positives = 122/305 (40%), Gaps = 34/305 (11%)

Query: 11  QFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGV--IDCLGQI-------- 60
             + G A G+S  + + PLD++KTR Q   G     G  +  V  +D   Q+        
Sbjct: 7   HLIGGFAGGLSSAVALQPLDLLKTRFQQTKG-----GTLWQTVKSLDTPWQLWRGTLPSA 61

Query: 61  VKREGFSRLYKGISSPMLME-APKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLA 119
           ++    S LY  +SS  LM  A  +  +F   DS   +      + +L+   ++++G+ A
Sbjct: 62  IRTSVGSALY--LSSLNLMRTALAKRKQFDTADSV--VTGKSSNLPQLSMYENLVTGAFA 117

Query: 120 GVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNG 179
             T   + +P  ++K+R +     +    E       + GI   + G   T  R+A ++G
Sbjct: 118 RGTVGYITMPITIIKVRYESTLYNYKSIAEAAKSIAAQEGIRGFFRGFGPTCLRDAPYSG 177

Query: 180 GYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTL 239
            Y  +  +++  LP     T    + L   + G Y  Y T   I S       S ATT  
Sbjct: 178 LYVLLYEKLKHTLP-----TILPKSLLQLDSEGRYTAY-TSTAINSTSAILSASMATTVT 231

Query: 240 ADGTVVP--------KYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNG 291
           A    +         K+   W +L  I ++E    ++ G   ++ R     GI   ++  
Sbjct: 232 APFDTIKTRMQLEPTKFKTFWSTLTTIVTQEHPIKIFSGLSMRLTRKALSAGIAWGIYEE 291

Query: 292 MMAFF 296
           ++  F
Sbjct: 292 LIKHF 296

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 37/173 (21%), Positives = 76/173 (43%), Gaps = 15/173 (8%)

Query: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71
           +V+G   G+     +YP+D +K R+Q         G+    +I     + +  G    Y+
Sbjct: 299 YVAGGLGGIMAQFSVYPIDTLKFRIQCAPLDTRCRGLPL--LIKTAKDMYREGGLRLFYR 356

Query: 72  GISSPMLMEAPKRATKFACNDSYQKMF----KDLYGVDK----LTQQISILSGSLAGVTE 123
           G+   +L   P  A       + ++ +     +  G+ +    ++  + +  G+ +G   
Sbjct: 357 GLGVGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAFSGTVG 416

Query: 124 ACVIVPFELVKIRLQDVNS-----KFNGPMEVVFKTIRETGILSLYNGLESTM 171
           A V+ P  L++ RLQ   +     +++G  +V  KT++  G+  LY GL  T+
Sbjct: 417 ATVVYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLVPTL 469

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 45/86 (52%), Gaps = 4/86 (4%)

Query: 15  GAAAGVSELLVMYPLDVVKTRMQLQVGSGT-GSGVAYNGVIDCLGQIVKREGFSRLYKGI 73
           GA +G     V+YP+++++TR+Q Q   GT      Y+G  D   + V+REG   LYKG+
Sbjct: 409 GAFSGTVGATVVYPINLLRTRLQAQ---GTYAHPHRYDGFQDVFRKTVQREGLPGLYKGL 465

Query: 74  SSPMLMEAPKRATKFACNDSYQKMFK 99
              +    P  A  + C ++ ++  +
Sbjct: 466 VPTLAKVCPAVAISYLCYENLKRAMR 491

>Kwal_47.19228
          Length = 281

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 41/77 (53%), Gaps = 6/77 (7%)

Query: 4   KPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKR 63
           KPL   Y F  G  +  + + V  P+DV+KTRMQ +      +   Y   ++C  +I   
Sbjct: 180 KPLNEYYAFALGFISSCAVVAVTQPIDVIKTRMQSKY-----TWSNYKNSLNCAYRIFVE 234

Query: 64  EGFSRLYKGISSPMLME 80
           EGF++ +KG  +P LM+
Sbjct: 235 EGFTKFWKGW-APRLMK 250

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 38/66 (57%), Gaps = 8/66 (12%)

Query: 224 LSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGG 283
           + V+K+R+QS  T +         Y  +    ++I+ EEGFT  +KG+ P+++++G  GG
Sbjct: 205 IDVIKTRMQSKYTWS--------NYKNSLNCAYRIFVEEGFTKFWKGWAPRLMKVGLSGG 256

Query: 284 IMLVVF 289
           +   V+
Sbjct: 257 VSFGVY 262

>Kwal_26.7972
          Length = 358

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 48/210 (22%), Positives = 77/210 (36%), Gaps = 41/210 (19%)

Query: 103 GVDKLTQQISILSGSLAGVTEAC---VIVPFELVKIRLQDVNSKFNGPMEVVFKTIR--- 156
            VDK +    + SG   G+  +C   +I P + +KI  Q  N  +          IR   
Sbjct: 18  SVDKRSAHYILRSGLAGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTMGLIRAGA 77

Query: 157 ----ETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIG 212
                 GI   Y G  +T+ R   +    F    QIR  +  +K   E     L +G++ 
Sbjct: 78  HINAHDGIRGFYQGHSATLIRIFPYAAIKFIAYEQIRHFMIPSK-EYETHARRLASGSMA 136

Query: 213 GYCR---------------YSTEHT---ILSVVKSRIQSGATTTLADGTVVPKYNWTWPS 254
           G C                Y T+ +   +L V+K      A+ +L   + VP++   W  
Sbjct: 137 GLCSVFMTYPLDLIRVRLAYVTDRSRIKMLPVIKQIYTERASESLTSKSYVPRWFAHW-- 194

Query: 255 LFKIYSEEGFTALYKGFIPKILRLGPGGGI 284
                        Y+GF P +L + P  G+
Sbjct: 195 ----------CNFYRGFTPTVLGMIPYAGV 214

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 73/184 (39%), Gaps = 4/184 (2%)

Query: 13  VSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKG 72
           ++G  AG     ++ PLD +K   Q           +  G+I     I   +G    Y+G
Sbjct: 32  LAGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTMGLIRAGAHINAHDGIRGFYQG 91

Query: 73  ISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIVPFEL 132
            S+ ++   P  A KF   +  +     +   +  T    + SGS+AG+    +  P +L
Sbjct: 92  HSATLIRIFPYAAIKFIAYEQIRHFM--IPSKEYETHARRLASGSMAGLCSVFMTYPLDL 149

Query: 133 VKIRLQDVNSKFNGPMEVVFKTI-RETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRAL 191
           +++RL  V  +    M  V K I  E    SL +      W  A W   Y G    +  +
Sbjct: 150 IRVRLAYVTDRSRIKMLPVIKQIYTERASESLTSKSYVPRW-FAHWCNFYRGFTPTVLGM 208

Query: 192 LPKA 195
           +P A
Sbjct: 209 IPYA 212

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 42/87 (48%), Gaps = 1/87 (1%)

Query: 2   SEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIV 61
           S +PL    + V+G  AG++     YP ++++ R+Q+ V S T S   +  + D +  I 
Sbjct: 252 SSRPLKTWAELVAGGLAGMASQTASYPFEIIRRRLQVSVVSPT-SIHNFQTIPDMIRIIY 310

Query: 62  KREGFSRLYKGISSPMLMEAPKRATKF 88
           K  G+   + G+S   +   P  A  F
Sbjct: 311 KERGWRGFFVGLSIGYIKVTPMVACSF 337

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 39/77 (50%), Gaps = 6/77 (7%)

Query: 4   KPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKR 63
           KPL   Y FV G  +  + + V  P+DV+KTRMQ +          Y   ++C  +I   
Sbjct: 319 KPLNEYYAFVLGFISSCAVVAVTQPIDVIKTRMQSKYAWAN-----YKNSLNCAYRIFVE 373

Query: 64  EGFSRLYKGISSPMLME 80
           EG  + +KG  +P LM+
Sbjct: 374 EGIPKFWKGW-APRLMK 389

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 63/333 (18%), Positives = 122/333 (36%), Gaps = 86/333 (25%)

Query: 13  VSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKG 72
           V+G+ A V +  + YP + +KT +QL       +   +N +            F   + G
Sbjct: 99  VAGSCASVFQTTISYPFEFLKTGLQLH--RSLPNAHPFNMM----------HQFKYYFSG 146

Query: 73  ISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISIL-SGSLAGVTEACVIVPFE 131
            ++  +    K  T+F   +   ++ KD            +L +G++ G  E+  +VPFE
Sbjct: 147 CAALNVGTLFKTVTRFTTFEKACQLLKDPSSPSAFISGPRLLMAGAITGFMESLWVVPFE 206

Query: 132 LVKIRL--------------------------QDVNSKFN------------------GP 147
            +K  +                          ++V + F+                   P
Sbjct: 207 NIKTTMVENALVLSGRFQKEIEDKGKAETGSKREVRATFHKQTPGISPRERLFLHYEEHP 266

Query: 148 MEVVFKTIRET----GILSLYNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTT 203
               F T++E     G+     G   T++R    +   F     ++ L+     +  K  
Sbjct: 267 TSRFFSTVKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFTTYTSLKQLI-----SPNKPL 321

Query: 204 NDLIAGTIG--GYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNW-----TWPSLF 256
           N+  A  +G    C        + V+K+R+QS             KY W     +    +
Sbjct: 322 NEYYAFVLGFISSCAVVAVTQPIDVIKTRMQS-------------KYAWANYKNSLNCAY 368

Query: 257 KIYSEEGFTALYKGFIPKILRLGPGGGIMLVVF 289
           +I+ EEG    +KG+ P+++++G  GG+   V+
Sbjct: 369 RIFVEEGIPKFWKGWAPRLMKVGLSGGVSFGVY 401

>Scas_705.9
          Length = 323

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 68/307 (22%), Positives = 119/307 (38%), Gaps = 70/307 (22%)

Query: 13  VSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVA--------YNGVIDCLGQIVKRE 64
           ++GA A     +++YPLDV KT +Q +  +     ++           VI CL +I ++ 
Sbjct: 8   ITGAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCLIRIFRKR 67

Query: 65  GFSRLYKGISSPMLMEAPKRATKFA---CNDSYQKMFKDLYGVDKLTQQ--------ISI 113
           G   LY+G+S+ +        +KF    C   +    +  Y   KL +         IS 
Sbjct: 68  GLRGLYQGMSTSVF-------SKFVQSFCYFFWYSFLRRKYFSLKLLRNTQARPINSIST 120

Query: 114 LSGSLAGVTEAC----VIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLES 169
           +   + GV  A     V  P E++  + Q  + K N     V K I           +ES
Sbjct: 121 VEELIVGVGAAALTQVVNNPIEVILTKQQTTDDKDNVDFYSVLKQIY----------VES 170

Query: 170 TMWRNAFWNGGYFGVIFQI------------RALLPKAKTNTEKT-------TNDLIAGT 210
               +++W G    +I  +            + +L K  +N+EK+         + I G 
Sbjct: 171 NGKLSSYWKGFKVSLILTVNPSITFAAYQRFKDILLKQVSNSEKSYSGQLTVNQNFILGA 230

Query: 211 IGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKG 270
           +           I+S + ++    A  +L       K+      L  +Y EEG  AL+KG
Sbjct: 231 LAK---------IISTIITQPLIVAKVSLQRSN--SKFKHFEEVLRYLYKEEGVLALWKG 279

Query: 271 FIPKILR 277
             P++ +
Sbjct: 280 VGPQLTK 286

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 79/183 (43%), Gaps = 15/183 (8%)

Query: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQI-VKREG-F 66
           + + + G  A     +V  P++V+ T+ Q    +     V +  V   L QI V+  G  
Sbjct: 121 VEELIVGVGAAALTQVVNNPIEVILTKQQ---TTDDKDNVDFYSV---LKQIYVESNGKL 174

Query: 67  SRLYKGISSPMLMEAPKRATKFACNDSYQK-MFKDLYGVDK-----LTQQISILSGSLAG 120
           S  +KG    +++      T FA    ++  + K +   +K     LT   + + G+LA 
Sbjct: 175 SSYWKGFKVSLILTVNPSIT-FAAYQRFKDILLKQVSNSEKSYSGQLTVNQNFILGALAK 233

Query: 121 VTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGG 180
           +    +  P  + K+ LQ  NSKF    EV+    +E G+L+L+ G+   + +     G 
Sbjct: 234 IISTIITQPLIVAKVSLQRSNSKFKHFEEVLRYLYKEEGVLALWKGVGPQLTKGVLVQGL 293

Query: 181 YFG 183
            F 
Sbjct: 294 VFA 296

>KLLA0E18788g complement(1661093..1662238) similar to sp|P38702
           Saccharomyces cerevisiae YHR002w, start by similarity
          Length = 381

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 76/184 (41%), Gaps = 4/184 (2%)

Query: 13  VSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKG 72
           ++G  AG     ++ PLD +K   Q           ++ G+++    I  R+    +++G
Sbjct: 58  LAGGVAGSCAKTLIAPLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLRGVFQG 117

Query: 73  ISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIVPFEL 132
            S+ +L   P  A KF   +  + +   +   +  T    + SGSLAG+       P +L
Sbjct: 118 HSATLLRIFPYAAVKFIAYEQIRNVI--IPSKEYETHFRRLCSGSLAGLCSVFCTYPLDL 175

Query: 133 VKIRLQDVNSKFNGPMEVVFKTI-RETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRAL 191
           +++RL  V       +  + K I  E    +L +      W  A W   Y G I  +  +
Sbjct: 176 IRVRLAYVTEHHKVRVWPLVKQIYSEPASEALSSKAYVPKW-FAQWCNFYRGYIPTVIGM 234

Query: 192 LPKA 195
           +P A
Sbjct: 235 IPYA 238

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 73/196 (37%), Gaps = 38/196 (19%)

Query: 114 LSGSLAGVTEACVIVPFELVKIRLQDVNSK-------FNGPMEVVFKTIRETGILSLYNG 166
           L+G +AG     +I P + +KI  Q  N         F G +           +  ++ G
Sbjct: 58  LAGGVAGSCAKTLIAPLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLRGVFQG 117

Query: 167 LESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCR---------- 216
             +T+ R   +    F    QIR ++  +K   E     L +G++ G C           
Sbjct: 118 HSATLLRIFPYAAVKFIAYEQIRNVIIPSK-EYETHFRRLCSGSLAGLCSVFCTYPLDLI 176

Query: 217 -----YSTEHTILSV---VKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALY 268
                Y TEH  + V   VK      A+  L+    VPK+   W +             Y
Sbjct: 177 RVRLAYVTEHHKVRVWPLVKQIYSEPASEALSSKAYVPKWFAQWCNF------------Y 224

Query: 269 KGFIPKILRLGPGGGI 284
           +G+IP ++ + P  G+
Sbjct: 225 RGYIPTVIGMIPYAGV 240

 Score = 31.6 bits (70), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 40/192 (20%), Positives = 68/192 (35%), Gaps = 55/192 (28%)

Query: 11  QFVSGAAAGVSELLVMYPLDVVKTRMQL------------------QVGSGTGSGVAYNG 52
           +  SG+ AG+  +   YPLD+++ R+                    +  S   S  AY  
Sbjct: 155 RLCSGSLAGLCSVFCTYPLDLIRVRLAYVTEHHKVRVWPLVKQIYSEPASEALSSKAY-- 212

Query: 53  VIDCLGQIVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFK------------D 100
           V     Q      +   Y+G    ++   P     F  +D +  + +            D
Sbjct: 213 VPKWFAQ------WCNFYRGYIPTVIGMIPYAGVSFFAHDLFHDILRHPVIAPYSVLRVD 266

Query: 101 LYGVDKLTQQI---------------SILSGSLAGVTEACVIVPFELVKIRLQDVNSKFN 145
               D L   +                +L+G LAG+       PFE+++ RLQ V +  N
Sbjct: 267 DLDADDLKVDVQTTRTGKRIPLNTWAELLAGGLAGMASQTAAYPFEIIRRRLQ-VGAVTN 325

Query: 146 GPMEVVFKTIRE 157
            P+E  F ++ E
Sbjct: 326 -PLEHKFTSMSE 336

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 74/187 (39%), Gaps = 19/187 (10%)

Query: 14  SGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGI 73
           SGA       L+  P+ V+K R +  +         Y  +      I + EG    ++G 
Sbjct: 110 SGAVTRALTGLITMPITVIKVRYESTL-------YQYTSLRYATSHIFRTEGLRGFFRGF 162

Query: 74  SSPMLMEAPKRATKFACNDSYQKMFKDLY--GVDKL-------TQQISILSGSLA---GV 121
            +  L +AP         D  + +   L    V KL       T   ++++GS A    V
Sbjct: 163 GATALRDAPYAGLYMLFYDRMKVLVPTLLPSNVVKLNSDNRYSTYASTLINGSSAFSAAV 222

Query: 122 TEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGY 181
               +  PF+ VK R+Q   +KF+      +    +  + +L+ G+   + R AF  G  
Sbjct: 223 IATSITAPFDTVKTRMQLEPAKFHSFTSTFWHIATKESVRNLFAGISLRLTRKAFSAGIA 282

Query: 182 FGVIFQI 188
           +G+  +I
Sbjct: 283 WGIYEEI 289

 Score = 34.7 bits (78), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 52/302 (17%), Positives = 115/302 (38%), Gaps = 34/302 (11%)

Query: 11  QFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSG---------TGSGVAYNGVIDCLGQIV 61
             + G + G+   +++ P D++KTR+Q    S          T S +    +  C+   V
Sbjct: 10  HLIGGFSGGLVSAIILQPFDLLKTRLQQDKTSTLWKTLKSIETPSQLWRGALPSCIRTSV 69

Query: 62  KREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGV 121
                S +Y  + + +     K     +   SY         + +L    ++ SG++   
Sbjct: 70  G----SAMYLTMLNSIRQAISKGKNTGSTGSSY---------LPQLNMYENMFSGAVTRA 116

Query: 122 TEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGY 181
               + +P  ++K+R +    ++           R  G+   + G  +T  R+A + G Y
Sbjct: 117 LTGLITMPITVIKVRYESTLYQYTSLRYATSHIFRTEGLRGFFRGFGATALRDAPYAGLY 176

Query: 182 FGVIFQIRALLPK------AKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGA 235
                +++ L+P        K N++   +   +  I G   +S      +V+ + I +  
Sbjct: 177 MLFYDRMKVLVPTLLPSNVVKLNSDNRYSTYASTLINGSSAFSA-----AVIATSITAPF 231

Query: 236 TTTLADGTVVP-KYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMA 294
            T      + P K++    + + I ++E    L+ G   ++ R     GI   ++  ++ 
Sbjct: 232 DTVKTRMQLEPAKFHSFTSTFWHIATKESVRNLFAGISLRLTRKAFSAGIAWGIYEEIVK 291

Query: 295 FF 296
            F
Sbjct: 292 KF 293

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 36/73 (49%), Gaps = 4/73 (5%)

Query: 112 SILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTM 171
           ++LS SLA      V  PF+ +K R+Q   SKF          ++   +L L++GL   +
Sbjct: 230 AVLSASLA----TTVTAPFDTIKTRMQLEPSKFTNSFNTFTSIVKNENVLKLFSGLSMRL 285

Query: 172 WRNAFWNGGYFGV 184
            R AF  G  +G+
Sbjct: 286 ARKAFSAGIAWGI 298

 Score = 32.0 bits (71), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 41/94 (43%), Gaps = 7/94 (7%)

Query: 113 ILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRE-TGILSLYNGLESTM 171
           ++ G   G+T A  + P +L+K R+Q            ++K ++E    L L+ G   + 
Sbjct: 14  LIGGFFGGLTSAVALQPLDLLKTRIQQ------DKKATLWKNLKEIDSPLQLWRGTLPSA 67

Query: 172 WRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTND 205
            R +  +  Y   +  +R+ L K +      TND
Sbjct: 68  LRTSIGSALYLSCLNLMRSSLAKRRNAVPSLTND 101

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 37/192 (19%), Positives = 80/192 (41%), Gaps = 12/192 (6%)

Query: 11  QFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLY 70
             + G   G++  + + PLD++KTR+Q    +     +     ID   Q+ +    S L 
Sbjct: 13  HLIGGFFGGLTSAVALQPLDLLKTRIQQDKKATLWKNLKE---IDSPLQLWRGTLPSALR 69

Query: 71  KGISSPMLME---------APKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGV 121
             I S + +          A +R    +  +    ++     + +LT   ++L+G+ A  
Sbjct: 70  TSIGSALYLSCLNLMRSSLAKRRNAVPSLTNDSNIVYNKSSSLPRLTMYENLLTGAFARG 129

Query: 122 TEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGY 181
               + +P  ++K+R +     ++   E +     + G+   + G  +T  R+A + G Y
Sbjct: 130 LVGYITMPITVIKVRYESTLYNYSSLKEAITHIYTKEGLFGFFRGFGATCLRDAPYAGLY 189

Query: 182 FGVIFQIRALLP 193
             +  + + LLP
Sbjct: 190 VLLYEKSKQLLP 201

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 6/64 (9%)

Query: 10  YQ-FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR 68
           YQ F +GA +  + + +  P+DV+KTRMQ +    T     Y   ++C  +I   EGF  
Sbjct: 249 YQAFAAGALSSAAVVALTQPIDVIKTRMQSKTAWFT-----YKSSLNCAYRIFVEEGFRY 303

Query: 69  LYKG 72
           ++KG
Sbjct: 304 MWKG 307

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 36/67 (53%), Gaps = 8/67 (11%)

Query: 224 LSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGG 283
           + V+K+R+QS         T    Y  +    ++I+ EEGF  ++KG++P++ ++   GG
Sbjct: 269 IDVIKTRMQSK--------TAWFTYKSSLNCAYRIFVEEGFRYMWKGWVPRLFKVSLSGG 320

Query: 284 IMLVVFN 290
           I   V+ 
Sbjct: 321 ISFGVYQ 327

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 54/123 (43%), Gaps = 13/123 (10%)

Query: 13  VSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKG 72
           ++GAAA V +  + +P + +KT  QL          A+N +            F   + G
Sbjct: 25  IAGAAAAVFQTTMSHPFEFLKTGQQLH--RALPGAAAFNML----------HPFKYYFSG 72

Query: 73  ISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDK-LTQQISILSGSLAGVTEACVIVPFE 131
            ++  +    K  T+FA  +      +D    D+ +     +L+G++ G  E+  +VPFE
Sbjct: 73  CAALNVGTLLKTGTRFATFEQACVWLRDPEHADQPIAGPRLLLAGAITGFLESLWVVPFE 132

Query: 132 LVK 134
            +K
Sbjct: 133 SIK 135

>YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1
           mutant that affects mitochondrial HMG-like DNA-binding
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 83/314 (26%), Positives = 127/314 (40%), Gaps = 44/314 (14%)

Query: 1   MSEKPLPFIYQFVSGAAAGVSELLVM-YPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQ 59
           + +KP+ F    + GA   +SE+  +  PL+VVKT M                 ++ +  
Sbjct: 13  IEKKPVSF-SNILLGACLNLSEVTTLGQPLEVVKTTMAANRNFT---------FLESVKH 62

Query: 60  IVKREGFSRLYKGISSPMLMEAP-KRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSL 118
           +  R G    Y+G+     +EA  K A     +   +  FK L G++       IL G  
Sbjct: 63  VWSRGGILGYYQGLIPWAWIEASTKGAVLLFVSAEAEYRFKSL-GLNNFAS--GILGGVT 119

Query: 119 AGVTEACVIVPF----ELVKIRLQDVNSKFNGPMEV--VFKTI-RETGILSLYNGLESTM 171
            GVT+A + + F    + V+I      S    P     VFK I ++ GI  +  G+ +  
Sbjct: 120 GGVTQAYLTMGFCTCMKTVEITRHKSASAGGVPQSSWSVFKNIYKKEGIRGINKGVNAVA 179

Query: 172 WRNAFWNGGYFGVIFQIRALLPK--AKTNTEKTTN---DLIAGTIGGYCRYSTEHTILSV 226
            R     G  FG+   +   + K   KTN +   N    + A  +GG    S  +  + V
Sbjct: 180 IRQMTNWGSRFGLSRLVEDGIRKITGKTNKDDKLNPFEKIGASALGG--GLSAWNQPIEV 237

Query: 227 VKSRIQSGATTTLADGTVVPKYNWTWPSLFK-IYSEEGFTALYKGFIPKILRLGPGGGIM 285
           ++  +QS       +    PK N T    FK IY   G   LY+G  P+I     G GI 
Sbjct: 238 IRVEMQS-----KKEDPNRPK-NLTVGKTFKYIYQSNGLKGLYRGVTPRI-----GLGIW 286

Query: 286 LVVFNGMMAFFQEM 299
             VF   M  F +M
Sbjct: 287 QTVF---MVGFGDM 297

>CAGL0K07436g complement(734496..735419) highly similar to sp|Q04013
           Saccharomyces cerevisiae YMR241w, hypothetical start
          Length = 307

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 79/305 (25%), Positives = 124/305 (40%), Gaps = 42/305 (13%)

Query: 1   MSEKPLPFIYQFVSGAAAGVSELLVM-YPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQ 59
           + +KP+ F    + GA   +SE+  +  PL+VVKT M             +N  +     
Sbjct: 5   IEKKPVSF-SNILLGAGLNLSEVTTLGQPLEVVKTTMAAHR--------EFN-FLQATKH 54

Query: 60  IVKREGFSRLYKGISSPMLMEAP-KRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSL 118
           +  R G    Y+G+     +EA  K A     +   +  FK L G++       I+ G  
Sbjct: 55  VWSRGGIFGFYQGLIPWAWIEASTKGAVLLFVSAEAEYRFKVL-GLNNFGA--GIMGGIT 111

Query: 119 AGVTEACVIVPF-------ELVKIRLQDVNSKFNGPMEVVFKTI-RETGILSLYNGLEST 170
            GVT+A + + F       E+ + +  +V          VFK+I ++ GI  +  G+ + 
Sbjct: 112 GGVTQAYLTMGFCTCMKTVEITRQKAANVPGVIPQSSWQVFKSIYKKEGIRGINKGVNAV 171

Query: 171 MWRNAFWNGGYFG----VIFQIRALLPKAKTNTEKTT-NDLIAGTIGGYCRYSTEHTILS 225
             R     G  FG    V   IR L  K   + + T    ++A  IGG    S  +  + 
Sbjct: 172 AIRQMTNWGSRFGLSRLVEDGIRKLTGKTGKDDKLTALEKIMASAIGGGL--SAWNQPIE 229

Query: 226 VVKSRIQSGATTTLADGTVVPKYNWTWPSLFK-IYSEEGFTALYKGFIPKILRLGPGGGI 284
           V++  +QS       +    PK N T    FK IY   G   LY+G  P++     G GI
Sbjct: 230 VIRVEMQSKK-----EDPNRPK-NLTVGKTFKYIYQSNGLKGLYRGVTPRV-----GLGI 278

Query: 285 MLVVF 289
              VF
Sbjct: 279 WQTVF 283

>Scas_717.20
          Length = 356

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 63/146 (43%), Gaps = 7/146 (4%)

Query: 14  SGAAAGVS---ELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLY 70
           SG A G+S      ++ PLD +K   Q      T    +  G+ +    I   +G    +
Sbjct: 35  SGLAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGFF 94

Query: 71  KGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKL-TQQISILSGSLAGVTEACVIVP 129
           +G S  ++   P  A KF    +Y+++   L    +  +    ++SGSLAG+       P
Sbjct: 95  QGHSVTLMRIFPYAAVKFV---AYEQIRNTLIPSKEYESHWRRLMSGSLAGLCSVFTTYP 151

Query: 130 FELVKIRLQDVNSKFNGPMEVVFKTI 155
            +L+++RL  V       +  + KTI
Sbjct: 152 LDLIRVRLAYVTEHKRISLLGLVKTI 177

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 40/205 (19%), Positives = 77/205 (37%), Gaps = 40/205 (19%)

Query: 11  QFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGS--GVAYNGVIDCLGQIVKREGF-- 66
           + +SG+ AG+  +   YPLD+++ R+         S  G+      +     ++ +G+  
Sbjct: 134 RLMSGSLAGLCSVFTTYPLDLIRVRLAYVTEHKRISLLGLVKTIYKEPASTTLEAKGYIP 193

Query: 67  ------SRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDL----YGVDKLTQQ------ 110
                    Y+G +  +L   P     F  +D    + K      Y V  L++       
Sbjct: 194 NWFAHWCNFYRGYTPTVLGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLALSESEQEERH 253

Query: 111 -----------ISILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETG 159
                        +LSG LAG+       PFE+++ RLQ      +   +  F++I E  
Sbjct: 254 FKHQRLPLRTWAELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSISE-- 311

Query: 160 ILSLYNGLESTMWRNAFWNGGYFGV 184
                  +   +++   W G + G+
Sbjct: 312 -------IAKIIYKERGWRGFFVGL 329

 Score = 28.5 bits (62), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 19/85 (22%), Positives = 37/85 (43%), Gaps = 1/85 (1%)

Query: 5   PLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTG-SGVAYNGVIDCLGQIVKR 63
           PL    + +SG  AG++     YP ++++ R+Q+   S +      +  + +    I K 
Sbjct: 260 PLRTWAELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSISEIAKIIYKE 319

Query: 64  EGFSRLYKGISSPMLMEAPKRATKF 88
            G+   + G+S   +   P  A  F
Sbjct: 320 RGWRGFFVGLSIGYIKVTPMVACSF 344

>Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement
          Length = 302

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 36/168 (21%), Positives = 72/168 (42%), Gaps = 19/168 (11%)

Query: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR 68
           +Y   S +A  ++++L+  P + +K + Q  +             ++   +I   EG S 
Sbjct: 114 VYLCASASAEFLADILLC-PWEAIKVKQQTTIPPFC------KNFLEGWSKITAAEGLSG 166

Query: 69  LYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQ---------ISILSGSLA 119
           LYKGI+     + P    KF    S++++ + +Y     ++Q         +S + G LA
Sbjct: 167 LYKGITPLWCRQIPYTMCKFT---SFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLA 223

Query: 120 GVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGL 167
           G+  A V  P +++  ++     +    +E   +     G   L+NGL
Sbjct: 224 GILCAVVSHPADVMVSKVNADRKQGESMVEASKRIYSRIGFGGLWNGL 271

>Kwal_55.21106
          Length = 328

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 74/180 (41%), Gaps = 21/180 (11%)

Query: 13  VSGAAAGVSELLVMYPLDVVKTRMQLQ-----VGSGTG----------SGVAYNGVIDCL 57
           ++GA A     +V+YPLD+VKT +Q Q     +GS  G            + Y   +D L
Sbjct: 8   ITGAVASSLANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSLDAL 67

Query: 58  GQIVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMF---KDLYG-VDKLTQQISI 113
            +I K +G   LY+G+ + ++    +  + F      +K F   K L G + K +    +
Sbjct: 68  IKIFKTKGVLGLYQGLWTSIIAGFLQSFSYFFWYSIVRKSFFRYKLLRGRLGKFSTPEEL 127

Query: 114 LSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTI--RETGILSLYNGLESTM 171
           L G +A         P  ++  R Q   S   G    V   I   +  I   + G + ++
Sbjct: 128 LLGIVAAAVSQIFTSPIGVISTRQQTSTSGSKGGFREVLHQIYSEQNNITGFWRGFKVSL 187

 Score = 28.1 bits (61), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 40/199 (20%), Positives = 76/199 (38%), Gaps = 41/199 (20%)

Query: 112 SILSGSLAGVTEACVIVPFELVKIRLQDVNS----------------------KFNGPME 149
           S ++G++A      V+ P +LVK  +Q  N                       ++   ++
Sbjct: 6   SAITGAVASSLANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSLD 65

Query: 150 VVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAG 209
            + K  +  G+L LY GL +++      +  YF     +R    + K         L+ G
Sbjct: 66  ALIKIFKTKGVLGLYQGLWTSIIAGFLQSFSYFFWYSIVRKSFFRYK---------LLRG 116

Query: 210 TIGGYCRYSTEHTILSVVKSRIQS------GATTTLADGTVVPKYNWTWPSLFKIYSEE- 262
            +G +   + E  +L +V + +        G  +T    +           L +IYSE+ 
Sbjct: 117 RLGKFS--TPEELLLGIVAAAVSQIFTSPIGVISTRQQTSTSGSKGGFREVLHQIYSEQN 174

Query: 263 GFTALYKGF-IPKILRLGP 280
             T  ++GF +  IL + P
Sbjct: 175 NITGFWRGFKVSLILTVNP 193

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 47/205 (22%), Positives = 82/205 (40%), Gaps = 39/205 (19%)

Query: 113 ILSGSLAGVTEACVIVPFELVKIRLQD---------------VNSK--FNGPMEVVFKTI 155
           +++G+L G+ E+  I+PFE +K  L                 VN+K  F+          
Sbjct: 79  LIAGTLTGIVESLFIIPFENIKTTLIQSAMIDHKKLEKNQPVVNAKATFHKVATKSTPVA 138

Query: 156 RETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTE-----KTTNDLIAGT 210
           R   +L     +  T    AF  G    +  QI     +    T      +  ND  +  
Sbjct: 139 RIEKLLPAVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQARNDKASSV 198

Query: 211 IGGYCRYSTEHTILS------VVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGF 264
           I G    +T  T+++      VVK+R+ S    T        +Y  T   +++I+ +EG 
Sbjct: 199 ITGL---ATSFTLVAMTQPIDVVKTRMMSQNAKT--------EYKNTLNCMYRIFVQEGM 247

Query: 265 TALYKGFIPKILRLGPGGGIMLVVF 289
              +KG I + +++G  GG+   V+
Sbjct: 248 ATFWKGSIFRFMKVGISGGLTFTVY 272

 Score = 37.0 bits (84), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 5/60 (8%)

Query: 13  VSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKG 72
           ++G A   + + +  P+DVVKTRM  Q      +   Y   ++C+ +I  +EG +  +KG
Sbjct: 199 ITGLATSFTLVAMTQPIDVVKTRMMSQ-----NAKTEYKNTLNCMYRIFVQEGMATFWKG 253

>Scas_613.24
          Length = 177

 Score = 36.6 bits (83), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 36/171 (21%), Positives = 69/171 (40%), Gaps = 3/171 (1%)

Query: 1   MSEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQI 60
           MS+K        VSG   G+S  + + PLD++KTR+Q   G+   S +    + D + Q 
Sbjct: 1   MSDKSPKTSVHLVSGFIGGLSSAVTLQPLDLLKTRIQQHKGATLWSAI--KDIKDPI-QF 57

Query: 61  VKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAG 120
            +    S L   I S + +           +            + +LT   ++L+G++A 
Sbjct: 58  WRGTLPSALRTSIGSALYLSCLNIMRTQLVHGKKGSAASKSSSLPQLTMYENLLTGAMAR 117

Query: 121 VTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTM 171
                + +P  ++K+R +     +    E +    +  GI   + G   T+
Sbjct: 118 GLVGYITMPITILKVRYESTYYSYKSMNEAIKDIYKMEGISGFFKGFGPTV 168

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 35.8 bits (81), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 40/96 (41%), Gaps = 30/96 (31%)

Query: 13  VSGAAAGVSELLVMYPLDVVKTRMQLQVGS------------------------------ 42
           +SGA A      V+YPLD+VKT +Q Q+                                
Sbjct: 8   LSGAVASAMANTVVYPLDLVKTLVQTQLKQDEQLKQLETEPQSQDKDEPVKDIPPVPIKL 67

Query: 43  GTGSGVAYNGVIDCLGQIVKREGFSRLYKGISSPML 78
              + + YN   D + +I K+EG   LY+G+++ ++
Sbjct: 68  NENNYLQYNSTFDAIYKIYKQEGIRGLYQGLTTSVM 103

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 20/30 (66%)

Query: 247 KYNWTWPSLFKIYSEEGFTALYKGFIPKIL 276
           +YN T+ +++KIY +EG   LY+G    ++
Sbjct: 74  QYNSTFDAIYKIYKQEGIRGLYQGLTTSVM 103

 Score = 28.9 bits (63), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 133 VKIRLQDVNS-KFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYF 182
           V I+L + N  ++N   + ++K  ++ GI  LY GL +++    F    YF
Sbjct: 63  VPIKLNENNYLQYNSTFDAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYF 113

>Sklu_2127.4 , Contig c2127 6322-7293
          Length = 323

 Score = 35.0 bits (79), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 32/148 (21%), Positives = 64/148 (43%), Gaps = 10/148 (6%)

Query: 27  YPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGISSPMLMEAPKRAT 86
           YPL  + T++Q Q   G          ++ + +I +++G    Y G+ S +   A    T
Sbjct: 32  YPLVTITTKLQTQ---GNDENNQVKSKLETIKEIYRKDGLLGFYAGLESAIYGMA---LT 85

Query: 87  KFACNDSYQKMFKDLYGV---DKLTQQISILSGSLAGVTEACVIVPFELVKIRLQDVNSK 143
            F     Y+   +++  V    KL    S+L+G +AG   A    P  +   R+    S+
Sbjct: 86  NFVYYYFYELTSRNVLKVRKHKKLNTLESMLTGCVAGSVTAIASNPIWVANTRMTVTKSE 145

Query: 144 FNGPMEVVFKTIRETGILSLYNGLESTM 171
               +  + + +++    +L+NGL+  +
Sbjct: 146 -KTALATIIEIVKKDSAKTLFNGLKPAL 172

 Score = 32.3 bits (72), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 42/91 (46%), Gaps = 7/91 (7%)

Query: 129 PFELVKIRLQ----DVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGV 184
           P   +  +LQ    D N++    +E + +  R+ G+L  Y GLES ++  A  N  Y+  
Sbjct: 33  PLVTITTKLQTQGNDENNQVKSKLETIKEIYRKDGLLGFYAGLESAIYGMALTNFVYY-Y 91

Query: 185 IFQI--RALLPKAKTNTEKTTNDLIAGTIGG 213
            +++  R +L   K     T   ++ G + G
Sbjct: 92  FYELTSRNVLKVRKHKKLNTLESMLTGCVAG 122

 Score = 32.3 bits (72), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 36/74 (48%), Gaps = 10/74 (13%)

Query: 10  YQFVSGAAAGVSELLVMYPLDVVKTRMQL-QVGSGT---------GSGVAYNGVIDCLGQ 59
           + F+ GA   ++     YP   +KTRM L + G  T         G   +   ++  + +
Sbjct: 205 WAFLLGALGKLAATGSTYPYITLKTRMHLSESGKHTDDDSGKKAKGHKASSKSMLSLITE 264

Query: 60  IVKREGFSRLYKGI 73
           IVK++G S LY+G+
Sbjct: 265 IVKKDGVSGLYRGV 278

>Sklu_2194.3 YMR241W, Contig c2194 5245-6183
          Length = 312

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 35/175 (20%), Positives = 72/175 (41%), Gaps = 14/175 (8%)

Query: 15  GAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGIS 74
           G   GV++  +          +++      G+G           +I K++G   + KG++
Sbjct: 115 GVTGGVAQAYLTMGFCTCMKTVEITKKKSAGAGAIPQSSWGAFKEIYKKDGIKGINKGVN 174

Query: 75  SPMLMEAPKRATKFACNDSYQKMFKDLYGV----DKLTQQISILSGSLAGVTEACVIVPF 130
           +  + +     ++F  +   ++  ++  G     DKLT    I + ++ G   A    P 
Sbjct: 175 AVAIRQMTNWGSRFGFSRLVEEGIRNATGKTNPDDKLTALEKIAASAIGGGLSAWN-QPI 233

Query: 131 ELVKIRLQ----DVNSKFNGPMEVVFKTI-RETGILSLYNGLESTM----WRNAF 176
           E++++ +Q    D N   N  +   FK I + +GI  LY G+   +    W+  F
Sbjct: 234 EVIRVEMQSKKEDPNRPKNLTVSSAFKYIYQSSGIKGLYRGVAPRIGLGVWQTVF 288

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 76/313 (24%), Positives = 125/313 (39%), Gaps = 41/313 (13%)

Query: 1   MSEKPLPFIYQFVSGAAAGVSELLVM-YPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQ 59
           + +KP+ F    + GA   + E+  +  PL+V+KT M         +  +++   + +  
Sbjct: 11  LKKKPISF-SNILLGAGLNMCEVTTLGQPLEVIKTTM--------AANRSFS-FFNAIKH 60

Query: 60  IVKREGFSRLYKGISSPMLMEAPKRATKF---ACNDSYQKMFKDLYGVDKLTQQISILSG 116
           +  R G    Y+G+     +EA  +       +    YQ  FK + G+        I+ G
Sbjct: 61  VWSRGGVFGFYQGLIPWAWIEASTKGAVLLFVSAESEYQ--FKRM-GLSNFGS--GIMGG 115

Query: 117 SLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEV------VFKTI-RETGILSLYNGLES 169
              GV +A + + F      ++    K  G   +       FK I ++ GI  +  G+ +
Sbjct: 116 VTGGVAQAYLTMGFCTCMKTVEITKKKSAGAGAIPQSSWGAFKEIYKKDGIKGINKGVNA 175

Query: 170 TMWRNAFWNGGYFG----VIFQIRALLPKAKTNTEKTTNDLIAGT-IGGYCRYSTEHTIL 224
              R     G  FG    V   IR    K   + + T  + IA + IGG    S  +  +
Sbjct: 176 VAIRQMTNWGSRFGFSRLVEEGIRNATGKTNPDDKLTALEKIAASAIGG--GLSAWNQPI 233

Query: 225 SVVKSRIQSGATTTLADGTVVPKYNWTWPSLFK-IYSEEGFTALYKGFIPKILRLGPGGG 283
            V++  +QS       +    PK N T  S FK IY   G   LY+G  P+I  LG    
Sbjct: 234 EVIRVEMQS-----KKEDPNRPK-NLTVSSAFKYIYQSSGIKGLYRGVAPRI-GLGVWQT 286

Query: 284 IMLVVFNGMMAFF 296
           + +V F  M   F
Sbjct: 287 VFMVGFGDMARDF 299

>YHR206W (SKN7) [2491] chr8 (512730..514598) Transcription factor
           involved in oxidative and osmotic stress response and G1
           phase cell-cycle control, has similarity to response
           regulator proteins of bacterial two-component systems
           [1869 bp, 622 aa]
          Length = 622

 Score = 32.7 bits (73), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 28/44 (63%), Gaps = 3/44 (6%)

Query: 133 VKIRLQDVNSKFNGPME--VVFKTIRETGILSLYNGLESTMWRN 174
            K+ LQ +NSK+N  +E  + FKTI E  +L+ +N L ST+  N
Sbjct: 264 TKVELQKLNSKYNTVIESLITFKTINE-NLLNNFNTLCSTLANN 306

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 32.0 bits (71), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 49/114 (42%), Gaps = 10/114 (8%)

Query: 104 VDKLTQQISILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSL 163
           VD+L   I+   GSL G     V  P   +   LQ   ++    +E + +   + GI+  
Sbjct: 9   VDELAHAIA---GSLGGAASIAVTYPLVTITTNLQTKENEARPKLETIKEIYNKNGIIGY 65

Query: 164 YNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTEK----TTNDLIAGTIGG 213
           + GLES ++  A  N  Y+   +        A+T T K    T   ++A TI G
Sbjct: 66  FLGLESAVYGMATTNFVYY---YFYEWCAKTARTLTTKQYLSTWESILASTIAG 116

 Score = 31.2 bits (69), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 4/72 (5%)

Query: 3   EKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVK 62
           +K L   + F+ GA   ++     YP   +KTRM L           ++ +++    IVK
Sbjct: 192 KKVLSPSWAFLLGAIGKLAATGTTYPYITLKTRMHLMQNDPKHQKSMWSLIVE----IVK 247

Query: 63  REGFSRLYKGIS 74
           ++G S LY G++
Sbjct: 248 KDGVSGLYNGVA 259

>YMR247C (YMR247C) [4203] chr13 complement(763350..768038) Protein of
            unknown function, has weak similarity to uncharacterized
            C. albicans Orf6.3079p [4689 bp, 1562 aa]
          Length = 1562

 Score = 31.6 bits (70), Expect = 1.00,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 53/110 (48%), Gaps = 28/110 (25%)

Query: 66   FSRLYKGISSPMLMEAPKRATKFACNDSYQKMF------KDLYGVDKLTQQISILSGSLA 119
            + +LYK ISS   ME  K  ++      Y+++F      KD+      ++ ++ L GSL 
Sbjct: 1152 YQKLYKVISS---MELKKLESQ------YKRIFEVVLNDKDIGSNINQSRLLTTLLGSLV 1202

Query: 120  GVTEACVIVPFELVKIRLQ------------DVNSKFNGPMEVVFKTIRE 157
              T+  +I+ +EL +I+ Q            DVNSKF  P +++ K   E
Sbjct: 1203 VKTQQDIIIEYEL-RIQKQTGSDVDGSASDNDVNSKFKLPQKLLQKVTDE 1251

>Scas_671.1*
          Length = 123

 Score = 29.6 bits (65), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 26/62 (41%), Gaps = 7/62 (11%)

Query: 13 VSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKG 72
          VS  A+      +  P D +KTRMQL+          +      L  I K E   +L+ G
Sbjct: 44 VSAIASASLATAITAPFDTIKTRMQLKPK-------VFTNFFTTLVLITKNESIFQLFSG 96

Query: 73 IS 74
          +S
Sbjct: 97 LS 98

 Score = 29.3 bits (64), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 31/73 (42%), Gaps = 4/73 (5%)

Query: 112 SILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTM 171
           +I S SLA      +  PF+ +K R+Q     F      +    +   I  L++GL   +
Sbjct: 46  AIASASLA----TAITAPFDTIKTRMQLKPKVFTNFFTTLVLITKNESIFQLFSGLSMRL 101

Query: 172 WRNAFWNGGYFGV 184
            R A   G  +G+
Sbjct: 102 TRKALSAGIAWGI 114

>YGR088W (CTT1) [2048] chr7 (654603..656324) Catalase T (cytosolic),
           important for detoxification of superoxide radicals and
           hydrogen peroxide [1722 bp, 573 aa]
          Length = 573

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 32/73 (43%), Gaps = 11/73 (15%)

Query: 75  SPMLMEAPKRATKFACNDSYQKMF-----------KDLYGVDKLTQQISILSGSLAGVTE 123
           SP+  E P+   +   ND  +K+F           KD     ++TQ   +L+  L  V  
Sbjct: 489 SPLDFEQPRALYEKVYNDEQKKLFVHNVVCHACKIKDPKVKKRVTQYFGLLNEDLGKVIA 548

Query: 124 ACVIVPFELVKIR 136
            C+ VP+E V + 
Sbjct: 549 ECLGVPWEPVDLE 561

>ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH]
           (771097..772119) [1023 bp, 340 aa]
          Length = 340

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 61/311 (19%), Positives = 104/311 (33%), Gaps = 61/311 (19%)

Query: 13  VSGAAAGVSELLVMYPLDVVKTRMQLQVGS----------------------------GT 44
           V GA A     + +YPLD+ KT +Q Q+                                
Sbjct: 7   VIGATASSLANIAVYPLDLAKTLVQTQLKDEFVEAGEEAGEERAGSRRQNRIKPIALRSP 66

Query: 45  GSGVAYNGVIDCLGQIVKREGFSRLYKGISSPMLMEAPKRATKF----ACNDSYQKMFKD 100
            +   Y G +D L +I   EG + LY+G+ S  +    +  + F         Y ++ + 
Sbjct: 67  QAAEQYKGALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFWYTLVRKHYFRLKQA 126

Query: 101 LYGVDKLTQQISILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGP-MEVVFKTIRETG 159
             G  + +    ++ G +A  T    + P  +V  R Q          M  V + +    
Sbjct: 127 RGGDARFSTPEELVLGIVAAATSQLFVNPINVVATRQQTRGQAAGAADMRTVAREVHAE- 185

Query: 160 ILSLYNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYST 219
                NG     WR  FW G    ++  +    P     T +   + +  T         
Sbjct: 186 -----NG-----WRG-FWAGLKVSLVLTVN---PSITYATYERLREALFPTPAAASHLVD 231

Query: 220 EHTILS----VVKSRIQSGATTTLADGTVVPKYNWTWPS---------LFKIYSEEGFTA 266
              +LS     V   +    +T L    ++ K +              L  +YS EG  +
Sbjct: 232 SAALLSPGQNFVMGVLSKIVSTVLTQPLIIAKASLQRSGSCFQDFHQVLHHLYSTEGPLS 291

Query: 267 LYKGFIPKILR 277
           L+KG  P+I +
Sbjct: 292 LWKGLGPQITK 302

>AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH]
           complement(1408478..1409410) [933 bp, 310 aa]
          Length = 310

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 71/290 (24%), Positives = 110/290 (37%), Gaps = 36/290 (12%)

Query: 1   MSEKPLPFIYQFVSGAAAGVSELLVM-YPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQ 59
           + +KP+ F      GAA  + E+  +  PL+V KT M      G    V +         
Sbjct: 10  LQKKPVSF-SNIALGAALNMCEVTTLGQPLEVTKTTMAANRQFGFSQAVRH--------- 59

Query: 60  IVKREGFSRLYKGISSPMLMEAP-KRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSL 118
           +  R G    Y+G+     +EA  K A     +   +  F+ L G+        IL G  
Sbjct: 60  VWSRGGVFGFYQGLIPWAWIEASTKGAVLLFVSAEAEYQFRRL-GLSNFGA--GILGGVS 116

Query: 119 AGVTEACVIVPF----ELVKIRLQDVNSKFNGPMEV---VFKTI-RETGILSLYNGLEST 170
            GV +A + + F    + V+I      S    P+     VFK I    G+  +  G+ + 
Sbjct: 117 GGVAQAYLTMGFCTCMKTVEITRSKAASAPGVPVPSSLQVFKQIFAAEGLRGINKGVNAV 176

Query: 171 MWRNAFWNGGYFG----VIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSV 226
             R     G  FG    V   IR +  K           ++A  +GG    S  +  + V
Sbjct: 177 AIRQMTNWGSRFGLSRLVEDGIRRVTHKRSDEKLSAMEKIVASALGGGL--SAWNQPIEV 234

Query: 227 VKSRIQSGATTTLADGTVVPKYNWTWPSLFK-IYSEEGFTALYKGFIPKI 275
           ++  +QS       +    PK N T    F+ IY   G   LY+G  P+I
Sbjct: 235 IRVEMQS-----RTNDPNRPK-NLTVGKTFRYIYENNGLRGLYRGVTPRI 278

>KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces
           cerevisiae YMR241w YHM2 yeast suppressor gene of HM
           (mitochondrial histone) mutant (ABF2) singleton, start
           by similarity
          Length = 308

 Score = 29.6 bits (65), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 75/306 (24%), Positives = 114/306 (37%), Gaps = 46/306 (15%)

Query: 1   MSEKPLPFIYQFVSGAAAGVSELLVM-YPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQ 59
           + +KP+ F    + GA   + E+  +  PL+VVKT M                    +  
Sbjct: 8   LKKKPISF-SNILLGAGLNMCEVTTLGQPLEVVKTTMAAN---------RQFTFFQAINH 57

Query: 60  IVKREGFSRLYKGISSPMLMEAP-KRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSL 118
           I  R G    Y+G+     +EA  K A     +   +  FK L G++       I+ G  
Sbjct: 58  IWSRGGVFGFYQGLIPWAWIEASTKGAVLLFVSAEAEYHFKKL-GLNNFGA--GIMGGVS 114

Query: 119 AGVTEACVIVPF-------ELVKIRLQDVNSKFNGPMEVVFKTI-RETGILSLYNGLEST 170
            GV +A + + F       E+ K +     +K +      FK I  + GI  +  G+ + 
Sbjct: 115 GGVAQAYLTMGFCTCMKTVEITKHKSAAAGAKQSS--WAAFKEIYNKEGIRGINKGVNAV 172

Query: 171 MWRNAFWNGGYFGVIFQIRALLPK--AKTNTEKTTNDL---IAGTIGGYCRYSTEHTILS 225
             R     G  FG    +   L K   KTN +     L    A  IGG    S  +  + 
Sbjct: 173 AIRQMTNWGSRFGFSRLVEEGLRKFTGKTNPDDKLTALEKIFASAIGG--GLSAWNQPIE 230

Query: 226 VVKSRIQSGAT--TTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGG 283
           V++  +QS         D TV   + +       IY   G   LY+G  P+I     G G
Sbjct: 231 VIRVEMQSKTNDPNRPKDLTVGKAFRY-------IYQSNGVKGLYRGVTPRI-----GLG 278

Query: 284 IMLVVF 289
           I   VF
Sbjct: 279 IWQTVF 284

>Scas_696.9
          Length = 312

 Score = 29.3 bits (64), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 51/122 (41%), Gaps = 10/122 (8%)

Query: 55  DCLGQIVKREGFSRLYKGISSPMLMEAPKRATKFA----CNDSYQKMFKDLYGVDKLTQQ 110
           +    I  +EG   +YKG+++  + +     ++F       D  +K        D+L   
Sbjct: 155 NVFRSIYAKEGLRGIYKGVNAVAIRQMTNWGSRFGFSRLVEDWVRKATGKTKPEDRLNAW 214

Query: 111 ISILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEV----VFKTIRET-GILSLYN 165
             I + ++ G   A    P E++++ +Q      N P  +     FK I +T G+  LY 
Sbjct: 215 EKIGATAVGGGLSAWN-QPIEVIRVEMQSKKEDPNRPKNLTVAKTFKYIMKTNGVKGLYR 273

Query: 166 GL 167
           G+
Sbjct: 274 GV 275

>Scas_705.36*
          Length = 163

 Score = 28.5 bits (62), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 111 ISILSGSLAGVTEACVIVPF-ELVKIRLQDVNSKFNGPMEVV 151
           I++ S S+AG+T  C+++P+   VK   +DV  K+    E +
Sbjct: 76  IALTSASVAGLTNLCILLPWTRKVKEERKDVARKYKDDKEKI 117

>Scas_701.22
          Length = 550

 Score = 29.3 bits (64), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 21/32 (65%)

Query: 154 TIRETGILSLYNGLESTMWRNAFWNGGYFGVI 185
           TI +TG+L++  G   T+W++AF +   FG +
Sbjct: 323 TISDTGLLAMTRGPHVTLWKDAFKSRPCFGSM 354

>Scas_648.18*
          Length = 704

 Score = 28.5 bits (62), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 15/20 (75%)

Query: 74  SSPMLMEAPKRATKFACNDS 93
           SS +L+  P+R+TK  CND+
Sbjct: 520 SSKVLLHTPRRSTKCICNDT 539

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.138    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,217,101
Number of extensions: 385173
Number of successful extensions: 2409
Number of sequences better than 10.0: 216
Number of HSP's gapped: 1483
Number of HSP's successfully gapped: 565
Length of query: 299
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 198
Effective length of database: 13,099,691
Effective search space: 2593738818
Effective search space used: 2593738818
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)