Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0J04092g30129715510.0
YOR223W2922807479e-99
Scas_640.24*2892836964e-91
Sklu_2012.22532766213e-80
Kwal_26.86732762886093e-78
ACR110W2522675119e-64
KLLA0D07095g2462784683e-57
Kwal_27.116111561135691.3
ABR013W142498681.8
YOR350C (MNE1)66380671.9
YJL178C (ATG27)27133652.8
YAR035W (YAT1)68779653.6
KLLA0B01265g33828635.0
YLR272C (YCS4)117626635.7
Kwal_56.2325656781626.8
CAGL0L01991g105343637.0
YPL085W (SEC16)219565627.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J04092g
         (297 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J04092g complement(382821..383726) similar to tr|Q12015 Sac...   602   0.0  
YOR223W (YOR223W) [5015] chr15 (759782..760660) Protein of unkno...   292   9e-99
Scas_640.24*                                                          272   4e-91
Sklu_2012.2 YOR223W, Contig c2012 1288-2049                           243   3e-80
Kwal_26.8673                                                          239   3e-78
ACR110W [1157] [Homologous to ScYOR223W - SH] complement(548056....   201   9e-64
KLLA0D07095g 608975..609715 similar to sgd|S0005749 Saccharomyce...   184   3e-57
Kwal_27.11611                                                          31   1.3  
ABR013W [604] [Homologous to ScYKL010C (UFD4) - SH] complement(4...    31   1.8  
YOR350C (MNE1) [5127] chr15 complement(992859..994850) Protein o...    30   1.9  
YJL178C (ATG27) [2745] chr10 complement(89280..90095) Protein in...    30   2.8  
YAR035W (YAT1) [82] chr1 (190189..192252) Outer carnitine acetyl...    30   3.6  
KLLA0B01265g 100414..101430 some similarities with sp|P12887 Sac...    29   5.0  
YLR272C (YCS4) [3665] chr12 complement(683674..687204) Subunit o...    29   5.7  
Kwal_56.23256                                                          28   6.8  
CAGL0L01991g 229840..233001 similar to sp|P36097 Saccharomyces c...    29   7.0  
YPL085W (SEC16) [5359] chr16 (387062..393649) Hydrophilic protei...    28   7.9  

>CAGL0J04092g complement(382821..383726) similar to tr|Q12015
           Saccharomyces cerevisiae YOR223w, hypothetical start
          Length = 301

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/297 (100%), Positives = 297/297 (100%)

Query: 1   MSSGLGTGSLDGMPGDNGGISRFIVVRFNDDTIPDLKLNITHVSMDTINTQWLRRLCREL 60
           MSSGLGTGSLDGMPGDNGGISRFIVVRFNDDTIPDLKLNITHVSMDTINTQWLRRLCREL
Sbjct: 1   MSSGLGTGSLDGMPGDNGGISRFIVVRFNDDTIPDLKLNITHVSMDTINTQWLRRLCREL 60

Query: 61  RGEQTHRRRLRFIRNGNILNSRANLGSEILQYFERLQAENTEGTLNELLFYVHCIIGTED 120
           RGEQTHRRRLRFIRNGNILNSRANLGSEILQYFERLQAENTEGTLNELLFYVHCIIGTED
Sbjct: 61  RGEQTHRRRLRFIRNGNILNSRANLGSEILQYFERLQAENTEGTLNELLFYVHCIIGTED 120

Query: 121 LTDEQLASEDVMDTMGPSADSVTTQAIGFDRLASVGFSEEEIELLRQQFRSTYGDPEEED 180
           LTDEQLASEDVMDTMGPSADSVTTQAIGFDRLASVGFSEEEIELLRQQFRSTYGDPEEED
Sbjct: 121 LTDEQLASEDVMDTMGPSADSVTTQAIGFDRLASVGFSEEEIELLRQQFRSTYGDPEEED 180

Query: 181 DLLNGDESQSNIGSRGGNARRDIRQLEEMWMESGNDPMATAGDGLQPGRDRNGEVEDRFN 240
           DLLNGDESQSNIGSRGGNARRDIRQLEEMWMESGNDPMATAGDGLQPGRDRNGEVEDRFN
Sbjct: 181 DLLNGDESQSNIGSRGGNARRDIRQLEEMWMESGNDPMATAGDGLQPGRDRNGEVEDRFN 240

Query: 241 SIPVTDIRHNKDLLIGITTGFCLGIFALLLMKNEGLFNKRQRMSIIVGVATNVLFCL 297
           SIPVTDIRHNKDLLIGITTGFCLGIFALLLMKNEGLFNKRQRMSIIVGVATNVLFCL
Sbjct: 241 SIPVTDIRHNKDLLIGITTGFCLGIFALLLMKNEGLFNKRQRMSIIVGVATNVLFCL 297

>YOR223W (YOR223W) [5015] chr15 (759782..760660) Protein of unknown
           function, has low similarity to uncharacterized C.
           albicans Orf6.1950p [879 bp, 292 aa]
          Length = 292

 Score =  292 bits (747), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 148/280 (52%), Positives = 196/280 (70%), Gaps = 19/280 (6%)

Query: 22  RFIVVRFNDDTIPDLKLNITHVSMDTINTQWLRRLCRELRGEQTHRRRLRFIRNGNILNS 81
           +FIV+RF+D ++ DL+LNI++V    INT WLRR+CRELR +QT +RRL+FIRNG+ILN+
Sbjct: 24  KFIVIRFSDVSVRDLQLNISNVPFSNINTHWLRRMCRELRPQQTQKRRLKFIRNGSILNT 83

Query: 82  RANLGSEILQYFERLQAEN----TEGTLNELLFYVHCIIGTEDLTDEQLASEDVMDTMGP 137
            + +  E+  YF+     N    T     +  +Y+HCIIGTE+LT  +LA+ED+ D   P
Sbjct: 84  HSKIAEELTHYFDTANNSNVATGTSVAPEQNNYYIHCIIGTEELTQAELANEDLKDDATP 143

Query: 138 SADSVTTQAIGFDRLASVGFSEEEIELLRQQFRSTYGDPEEEDDLLNGDESQSNIGSRGG 197
           S DS+TTQAIGFDRL SVGF+E+EIELLRQQFR+TYGD EEE++ L  + ++ + G    
Sbjct: 144 SNDSMTTQAIGFDRLRSVGFTEQEIELLRQQFRATYGDLEEEEERLAQNGNRDDEG---- 199

Query: 198 NARRDIRQLEEMWMESGNDPMATAGDGLQPGRDRNGEVEDRFNSIPVTDIRHNKDLLIGI 257
               DIRQLEE WMESG+      G G           EDRFNS+P+ +I+HNKDLL+GI
Sbjct: 200 ---HDIRQLEEQWMESGSGTAQGNGAGGG--------NEDRFNSVPIANIKHNKDLLLGI 248

Query: 258 TTGFCLGIFALLLMKNEGLFNKRQRMSIIVGVATNVLFCL 297
             GF  G+F +LLMK +GLFN+RQ+M+I  GV  NV+FCL
Sbjct: 249 CVGFFFGVFGILLMKFDGLFNRRQKMAIFAGVIVNVMFCL 288

>Scas_640.24*
          Length = 289

 Score =  272 bits (696), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 145/283 (51%), Positives = 190/283 (67%), Gaps = 18/283 (6%)

Query: 22  RFIVVRFNDDTIPDLKLNITHVSMDTINTQWLRRLCRELRGEQTHRRRLRFIRNGNILNS 81
           +FIV+RF+D TI DL++NIT V +  INT WLR++CR+LR  +T   RL+FIR+G +LNS
Sbjct: 14  KFIVIRFSDVTIADLQINITQVPISNINTHWLRQMCRDLRPRETQSHRLKFIRSGALLNS 73

Query: 82  RANLGSEILQYFERLQAENTEGTLNELL----FYVHCIIGTEDLTDEQLASEDVMDTMGP 137
           R++L  +I  YF    +++T     E      FY+HCIIG++ L++++LA ED MD +GP
Sbjct: 74  RSSLALQIQDYFRTSASDHTPQQEEEEEEANKFYIHCIIGSDLLSEDELAREDAMDDLGP 133

Query: 138 SADSVTTQAIGFDRLASVGFSEEEIELLRQQFRSTYGDPEEEDDLLNGDESQSNIGSRGG 197
           + +  TTQAIGFDRL +VGFSE EIELLRQQFRSTYGD EE    L G++     G+   
Sbjct: 134 NEEGRTTQAIGFDRLRAVGFSEREIELLRQQFRSTYGDLEER---LQGNDEFEEEGN--N 188

Query: 198 NARRDIRQLEEMWM---ESGNDPMATAGDGLQPGRDRNGEVEDRFNSIPVTDIRHNKDLL 254
           N+  DIRQLEE WM    +    M      +    D      DRFNSIP+T+++HNKDLL
Sbjct: 189 NSTTDIRQLEEQWMGKWWTWTHEMKMGWLIIMSFDD------DRFNSIPITNLKHNKDLL 242

Query: 255 IGITTGFCLGIFALLLMKNEGLFNKRQRMSIIVGVATNVLFCL 297
           IGI  GFC GIFA +LM  +GL NKRQRMS+  G+  N+LFCL
Sbjct: 243 IGIFIGFCFGIFAFILMNIDGLLNKRQRMSMFAGIIVNILFCL 285

>Sklu_2012.2 YOR223W, Contig c2012 1288-2049
          Length = 253

 Score =  243 bits (621), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 143/276 (51%), Positives = 188/276 (68%), Gaps = 45/276 (16%)

Query: 24  IVVRFNDDTIPDLKLNITHVSMDTINTQWLRRLCRELRGEQTHRRRLRFIRNGNILNSRA 83
           IVVRF+D  I DL L+I+++  D+INT WLRR+CR+LR E T  +RL+FIR+G  LNS  
Sbjct: 17  IVVRFSDVAIHDLTLDISNLPWDSINTNWLRRMCRQLRKEATTNKRLKFIRSGRPLNSNT 76

Query: 84  NLGSEILQYFERLQAENTEGTLNELLFYVHCIIGTEDLTDEQLASEDVMDTMGPSADSVT 143
           N  SE+ Q+F++   ENT+       +YVHCI+G +DLT+E+LA+EDV+D +GPS +  T
Sbjct: 77  NFASELQQFFQQ-DTENTK-------YYVHCIVG-QDLTEEELANEDVLDDIGPSNEGTT 127

Query: 144 TQAIGFDRLASVGFSEEEIELLRQQFRSTYGDPEEEDDLLNGDESQSNI--GSRGGNARR 201
           TQA+GFDRL SVGFS+EEIELLR+QFRSTYGD E             N+   S+GG   R
Sbjct: 128 TQAVGFDRLRSVGFSDEEIELLREQFRSTYGDLE-------------NVVQESQGG---R 171

Query: 202 DIRQLEEMWMESGNDPMATAGDGLQPGRDRNGEVEDRFNSIPVTDIRHNKDLLIGITTGF 261
           DIRQLEE WMESG        D            ED+FNS+P+ D + N+DLLIG+  G 
Sbjct: 172 DIRQLEEQWMESG------VSD------------EDQFNSVPIADYKRNRDLLIGLIIGC 213

Query: 262 CLGIFALLLMKNEGLFNKRQRMSIIVGVATNVLFCL 297
            LGIF+LLL+K EGLF+KRQ+M+++ G+  N+ F L
Sbjct: 214 LLGIFSLLLLKQEGLFSKRQKMAVVAGLLVNLFFGL 249

>Kwal_26.8673
          Length = 276

 Score =  239 bits (609), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 134/288 (46%), Positives = 184/288 (63%), Gaps = 50/288 (17%)

Query: 16  DNGGIS------RFIVVRFNDDTIPDLKLNITHVSMDTINTQWLRRLCRELRGEQTHRRR 69
           D GG++      + +VVRF+D+ + DL LN+++V ++ INT+WLRR+CR+LRG  T  +R
Sbjct: 26  DQGGLASTSASGKLVVVRFSDEQLEDLPLNVSNVPLNEINTRWLRRMCRQLRGRFTGNKR 85

Query: 70  LRFIRNGNILNSRANLGSEILQYFERLQAENTEGTLNELLFYVHCIIGTEDLTDEQLASE 129
           LRFIRNG  L+  ++L  ++ QYFE        G+ ++  FYVHCI+G E LT E+L +E
Sbjct: 86  LRFIRNGRFLDINSDL--QLQQYFE--------GSNDK--FYVHCIVGQE-LTPEELENE 132

Query: 130 DVMDTMGPSADSVTTQAIGFDRLASVGFSEEEIELLRQQFRSTYGDPEEEDDLLNGDESQ 189
           DV+D    + +  T QAIGFDRL SVGFSEEEIELLRQ+FRSTYGD EE           
Sbjct: 133 DVLDEAQQNTEGTTAQAIGFDRLRSVGFSEEEIELLRQRFRSTYGDLEEL---------- 182

Query: 190 SNIGSRGGNARRDIRQLEEMWMESGNDPMATAGDGLQPGRDRNGEVEDRFNSIPVTDIRH 249
               SRG +  RDIRQLEE WME+G +                 E  D+  S+ + + +H
Sbjct: 183 ----SRGNDEARDIRQLEEQWMETGAN-----------------EENDQLGSVGIANYKH 221

Query: 250 NKDLLIGITTGFCLGIFALLLMKNEGLFNKRQRMSIIVGVATNVLFCL 297
           N DLL+G+  G  LG+F+LLLMK +GLFNKRQ+M+++ G+  N+ F L
Sbjct: 222 NTDLLVGLVVGCVLGVFSLLLMKQDGLFNKRQKMAMVGGLLMNLCFGL 269

>ACR110W [1157] [Homologous to ScYOR223W - SH]
           complement(548056..548814) [759 bp, 252 aa]
          Length = 252

 Score =  201 bits (511), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 116/267 (43%), Positives = 158/267 (59%), Gaps = 42/267 (15%)

Query: 29  NDDTIPDLKLNITHVSMDTINTQWLRRLCRELRGEQTHRRRLRFIRNGNILNSRANLGSE 88
           +D T+ DL L ++ +    + T+WLR + R++R  +T R RL+FIRNG  LN+ +NL  E
Sbjct: 23  SDPTLQDLTLEVSSIPYADVTTRWLRAMVRQIRPAKTVRHRLKFIRNGQPLNAMSNLRLE 82

Query: 89  ILQYFERLQAENTEGTLNELLFYVHCIIGTEDLTDEQLASEDVMDTMGPSADSVTTQAIG 148
             Q+FE  + EN +       +Y+HCI+G E LT EQL  ED +D +G   D  T + IG
Sbjct: 83  --QFFESAE-ENDK-------YYIHCIVGPE-LTTEQLQDEDALDNVGQQVDGTTPEVIG 131

Query: 149 FDRLASVGFSEEEIELLRQQFRSTYGDPEEEDDLLNGDESQSNIGSRGGNARRDIRQLEE 208
           FDRL SVGFS+EEIELLRQQFR+TYGD          D SQ   G R      D+RQLEE
Sbjct: 132 FDRLRSVGFSDEEIELLRQQFRATYGD---------LDTSQQPDGERA-----DLRQLEE 177

Query: 209 MWMESGNDPMATAGDGLQPGRDRNGEVEDRFNSIPVTDIRHNKDLLIGITTGFCLGIFAL 268
            W+E+G    AT             E   + +SIP  + R+N DLLIG+  G   G+F++
Sbjct: 178 QWIETG----AT-------------EQGAQLSSIPTANYRYNMDLLIGLMVGCLFGVFSI 220

Query: 269 LLMKNEGLFNKRQRMSIIVGVATNVLF 295
           LL+K   LF KRQ+M++  G+  NV+F
Sbjct: 221 LLLKQGELFTKRQKMAVFAGIVANVIF 247

>KLLA0D07095g 608975..609715 similar to sgd|S0005749 Saccharomyces
           cerevisiae YOR223w hypothetical protein, start by
           similarity
          Length = 246

 Score =  184 bits (468), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 118/278 (42%), Positives = 168/278 (60%), Gaps = 47/278 (16%)

Query: 22  RFIVVRFNDDTIPDLKLNITHVSMDTINTQWLRRLCRELRGEQTHRRRLRFIRNGNILNS 81
           + +V+RF +DTI DL+L+IT++    + T WLRR+CR+L+  +T  +RLRFI+NG  LNS
Sbjct: 11  KAVVIRFANDTIADLQLDITNIDPTLVTTSWLRRMCRQLKPTETRGKRLRFIKNGRPLNS 70

Query: 82  RANLGSEILQYFERLQAENTEGTLNELLFYVHCIIGTEDLTDEQLASEDVM-DTMGPSAD 140
            ++LG            E+ +   N    Y+H IIG   LT E+L +ED + D    + +
Sbjct: 71  HSDLG-----------IESFKDNPNITEMYIHGIIGA-GLTAEELINEDNLDDDFSNTNE 118

Query: 141 SVTTQAIGFDRLASVGFSEEEIELLRQQFRSTYGDPEEEDDLLNGDESQSNIGSRGGNAR 200
           + TTQAIGFDRL SVGFSE+EI+LLRQQF +TYGD E                +     +
Sbjct: 119 NGTTQAIGFDRLRSVGFSEQEIDLLRQQFLATYGDLE----------------TMPNQQQ 162

Query: 201 RDIRQLEEMWMESG-NDPMATAGDGLQPGRDRNGEVEDRFNSIPVTDIRHNKDLLIGITT 259
           RDIRQLEE WME+G NDP                    +FNSI + + + N DLLIG++ 
Sbjct: 163 RDIRQLEEQWMETGVNDPQG-----------------QQFNSIGIANWKSNMDLLIGLSI 205

Query: 260 GFCLGIFALLLMKNEGLFNKRQRMSIIVGVATNVLFCL 297
           G  LG+F+LLL+K +GLF++RQ+MSI+ G+  N+ + +
Sbjct: 206 GSLLGVFSLLLLKQQGLFSQRQKMSIVAGLIFNIAWWI 243

>Kwal_27.11611
          Length = 1561

 Score = 31.2 bits (69), Expect = 1.3,   Method: Composition-based stats.
 Identities = 31/135 (22%), Positives = 55/135 (40%), Gaps = 26/135 (19%)

Query: 139 ADSVTTQAIGFDRLASVGFSEEEIELLRQQFRSTYG---------------DPEEEDDLL 183
           AD+  ++ I   +L+S  FS E +E + QQ  S+                  PE E++ L
Sbjct: 408 ADTPFSRTIYDQKLSS--FSTENVERIVQQMHSSLPGVATSATRASSRPQPTPEREEEHL 465

Query: 184 NGDESQSNIGSRGGNARRDIRQLEEMWMESGNDPMATAGDGLQPGRDRNGEVEDRFNSIP 243
           +G +SQ  + S   +  +D         ES N  +A A D ++    +  +      ++P
Sbjct: 466 SGVQSQIKLSSTPSDKSKD---------ESHNSTLAEATDKIKEQAVKTTKERHESENVP 516

Query: 244 VTDIRHNKDLLIGIT 258
           V     N   L  ++
Sbjct: 517 VVKQEDNDTFLASVS 531

>ABR013W [604] [Homologous to ScYKL010C (UFD4) - SH]
           complement(412721..416995) [4275 bp, 1424 aa]
          Length = 1424

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/98 (21%), Positives = 45/98 (45%), Gaps = 6/98 (6%)

Query: 53  LRRLCRELRGEQTHRRRLRFIRNGNILNSRANLGSEI---LQYFERLQAENTEGTLNELL 109
           L  L + L+   T       I  G   +  A+LG ++   L+Y   L+ +N    ++ L+
Sbjct: 770 LELLVKTLQSALTKLESFEIIDCGTTESRAASLGKQMKLKLEYIGDLKKDNIPPMMSSLM 829

Query: 110 FYVHCIIGTEDLTD---EQLASEDVMDTMGPSADSVTT 144
             +HCI   + L +    ++A    ++++ P ++S+  
Sbjct: 830 VNIHCISSYKTLNEFLKHRVAQSRFLNSILPLSNSIAA 867

>YOR350C (MNE1) [5127] chr15 complement(992859..994850) Protein of
           unknown function [1992 bp, 663 aa]
          Length = 663

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 42/80 (52%), Gaps = 6/80 (7%)

Query: 37  KLNITHVSMDTINTQWLRRLCRELRGEQTHRRRLRFIRNGNILNSRANLGSEILQYFERL 96
           K+ +   S+  ++  +  +  + L  E   R  ++F+RN  +L  ++   +  L+  +RL
Sbjct: 148 KIALAKFSLQLLDRYYFLK-TKSLTIEGKFRANIKFLRNCTLLIVKSQ-SNYYLRAIQRL 205

Query: 97  QAENTEG----TLNELLFYV 112
            AEN+EG     L++L FYV
Sbjct: 206 FAENSEGQLLANLSQLAFYV 225

>YJL178C (ATG27) [2745] chr10 complement(89280..90095) Protein
           involved in the cytoplasm-to-vacuole targeting (Cvt)
           pathway, appears to act as a downstream effector of
           Vps34p [816 bp, 271 aa]
          Length = 271

 Score = 29.6 bits (65), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 22/33 (66%), Gaps = 2/33 (6%)

Query: 131 VMDTMGPSADSVTTQAIGFDRLASVGFSEEEIE 163
           + D + P  D++TTQ I FD+  ++GF+ EE E
Sbjct: 80  LTDVILPGKDAITTQIIDFDK--NIGFNVEETE 110

>YAR035W (YAT1) [82] chr1 (190189..192252) Outer carnitine
           acetyltransferase, mitochondrial [2064 bp, 687 aa]
          Length = 687

 Score = 29.6 bits (65), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 2/79 (2%)

Query: 33  IPDLKLNITHVSMDTINTQWLRRLCRELRGEQTHRRRLRFIRNGNILNSRANLGSEILQY 92
           +P+LK        DT+N ++L R+   L+ E+ +RR  R + +   L++   L   +L+Y
Sbjct: 1   MPNLKRLPIPPLQDTLN-RYLARV-EPLQDERQNRRTRRTVLSAENLDALNTLHERLLEY 58

Query: 93  FERLQAENTEGTLNELLFY 111
             RL   N E +  E  +Y
Sbjct: 59  DARLAESNPESSYIEQFWY 77

>KLLA0B01265g 100414..101430 some similarities with sp|P12887
           Saccharomyces cerevisiae YML021c UNG1 uracil-DNA
           glycosylase singleton, hypothetical start
          Length = 338

 Score = 28.9 bits (63), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 18/28 (64%)

Query: 33  IPDLKLNITHVSMDTINTQWLRRLCREL 60
           +P+ K  +  + MDTI+  WLRRL +E 
Sbjct: 79  VPEEKKCLLDLEMDTIDISWLRRLKQEF 106

>YLR272C (YCS4) [3665] chr12 complement(683674..687204) Subunit of
           condensin protein complex required for proper chromosome
           condensation and segregation [3531 bp, 1176 aa]
          Length = 1176

 Score = 28.9 bits (63), Expect = 5.7,   Method: Composition-based stats.
 Identities = 11/26 (42%), Positives = 20/26 (76%)

Query: 163 ELLRQQFRSTYGDPEEEDDLLNGDES 188
           +L+R++   T+G PEEED +L+ ++S
Sbjct: 812 DLIREKTMMTFGKPEEEDSILSLEQS 837

>Kwal_56.23256
          Length = 567

 Score = 28.5 bits (62), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 41/81 (50%), Gaps = 10/81 (12%)

Query: 96  LQAENTEGTLNELLFYVHCIIGTEDLTD---EQLASEDVMDTMGPSADSVTTQ----AIG 148
           LQA N +GT+N L+ Y      TED      + L +  + DT+    D++TTQ    A  
Sbjct: 192 LQAFNNQGTINRLVKYQQVSKLTEDFEQCWLDLLEALQLGDTVNELKDNLTTQVSINAKN 251

Query: 149 FDRLASVGFSEEEIELLRQQF 169
            DR+ S+   E++I+ L  Q 
Sbjct: 252 EDRIHSL---EDQIKTLEAQL 269

>CAGL0L01991g 229840..233001 similar to sp|P36097 Saccharomyces
           cerevisiae YKL033w, start by similarity
          Length = 1053

 Score = 28.9 bits (63), Expect = 7.0,   Method: Composition-based stats.
 Identities = 15/43 (34%), Positives = 24/43 (55%)

Query: 79  LNSRANLGSEILQYFERLQAENTEGTLNELLFYVHCIIGTEDL 121
           +N   N+ SE ++       E+TEGTL++L F V  + G  +L
Sbjct: 382 INEVRNIFSEEVENLNSQLKESTEGTLSQLFFLVKLLEGDSEL 424

>YPL085W (SEC16) [5359] chr16 (387062..393649) Hydrophilic protein
           required for autophagy and vesicle formation in ER to
           Golgi transport [6588 bp, 2195 aa]
          Length = 2195

 Score = 28.5 bits (62), Expect = 7.9,   Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 30/65 (46%), Gaps = 3/65 (4%)

Query: 177 EEEDDLLNGDESQSNIGSRGGNARRDIRQLEEMWMESGND--PMATAGDGLQPGRDRNGE 234
           E  +D+ +G + Q   G      + +I    +  M  GN   P++   D ++PG+D   +
Sbjct: 372 ETSEDIFHGHDKQVVEGQNDFTGK-NIENESQKLMGEGNHKLPLSAEADIIEPGKDIQDQ 430

Query: 235 VEDRF 239
            ED F
Sbjct: 431 AEDLF 435

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.138    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,055,158
Number of extensions: 456736
Number of successful extensions: 1520
Number of sequences better than 10.0: 34
Number of HSP's gapped: 1499
Number of HSP's successfully gapped: 35
Length of query: 297
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 196
Effective length of database: 13,099,691
Effective search space: 2567539436
Effective search space used: 2567539436
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)