Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0J04070g1501486631e-90
Scas_640.231471485642e-75
YOR224C (RPB8)1461485563e-74
Sklu_2012.31441505042e-66
Kwal_26.86781441504677e-61
KLLA0D07139g1451494624e-60
ACR111C1441494521e-58
YNL172W (APC1)174850700.24
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J04070g
         (148 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J04070g 382116..382568 highly similar to sp|P20436 Saccharo...   259   1e-90
Scas_640.23                                                           221   2e-75
YOR224C (RPB8) [5016] chr15 complement(760825..761265) Shared su...   218   3e-74
Sklu_2012.3 YOR224C, Contig c2012 3508-3942 reverse complement        198   2e-66
Kwal_26.8678                                                          184   7e-61
KLLA0D07139g complement(611102..611539) similar to sp|P20436 Sac...   182   4e-60
ACR111C [1158] [Homologous to ScYOR224C (RPB8) - SH] (548897..54...   178   1e-58
YNL172W (APC1) [4426] chr14 (310636..315882) Component of the an...    32   0.24 

>CAGL0J04070g 382116..382568 highly similar to sp|P20436
           Saccharomyces cerevisiae YOR224c RPB8, start by
           similarity
          Length = 150

 Score =  259 bits (663), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 126/148 (85%)

Query: 1   MSTTLFDDIFTISEVDPGRYNNVCRIEAGSTTQEQCKLTLDINTNLFPVQVNEQLXXXXX 60
           MSTTLFDDIFTISEVDPGRYNNVCRIEAGSTTQEQCKLTLDINTNLFPVQVNEQL     
Sbjct: 1   MSTTLFDDIFTISEVDPGRYNNVCRIEAGSTTQEQCKLTLDINTNLFPVQVNEQLTVTVA 60

Query: 61  XXXXXXXXXXXXXXXXXGASRSWRPPQPGDRSLADDYDYVMHGTAYKFEEVSKDVIAVYY 120
                            GASRSWRPPQPGDRSLADDYDYVMHGTAYKFEEVSKDVIAVYY
Sbjct: 61  SSLDVDDDDKAKVNDSTGASRSWRPPQPGDRSLADDYDYVMHGTAYKFEEVSKDVIAVYY 120

Query: 121 SFGGLLMRLEGNYRNLNNLKQETAYLLI 148
           SFGGLLMRLEGNYRNLNNLKQETAYLLI
Sbjct: 121 SFGGLLMRLEGNYRNLNNLKQETAYLLI 148

>Scas_640.23
          Length = 147

 Score =  221 bits (564), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 108/148 (72%), Positives = 115/148 (77%), Gaps = 3/148 (2%)

Query: 1   MSTTLFDDIFTISEVDPGRYNNVCRIEAGSTTQEQCKLTLDINTNLFPVQVNEQLXXXXX 60
           MS TLFDDIFT+SEVDPGRYN VCRIEA STTQEQCKLTLDINT LFPV  N+QL     
Sbjct: 1   MSNTLFDDIFTVSEVDPGRYNKVCRIEATSTTQEQCKLTLDINTELFPVSNNDQLTITIA 60

Query: 61  XXXXXXXXXXXXXXXXXGASRSWRPPQPGDRSLADDYDYVMHGTAYKFEEVSKDVIAVYY 120
                             A RSWRPPQP +RS+ADDYDYVM+GTAYKFEEV+KD+IAVYY
Sbjct: 61  SSLSIESDSNANQD---AAQRSWRPPQPDERSIADDYDYVMYGTAYKFEEVNKDIIAVYY 117

Query: 121 SFGGLLMRLEGNYRNLNNLKQETAYLLI 148
           SFGGLLMRLEGNYRNLN LKQE AYLLI
Sbjct: 118 SFGGLLMRLEGNYRNLNTLKQENAYLLI 145

>YOR224C (RPB8) [5016] chr15 complement(760825..761265) Shared
           subunit of RNA polymerases I, II, and III (ABC14.5) [441
           bp, 146 aa]
          Length = 146

 Score =  218 bits (556), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 113/148 (76%), Gaps = 4/148 (2%)

Query: 1   MSTTLFDDIFTISEVDPGRYNNVCRIEAGSTTQEQCKLTLDINTNLFPVQVNEQLXXXXX 60
           MS TLFDDIF +SEVDPGRYN VCRIEA STTQ+QCKLTLDIN  LFPV   + L     
Sbjct: 1   MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIA 60

Query: 61  XXXXXXXXXXXXXXXXXGASRSWRPPQPGDRSLADDYDYVMHGTAYKFEEVSKDVIAVYY 120
                             A+RSWRPPQ GDRSLADDYDYVM+GTAYKFEEVSKD+IAVYY
Sbjct: 61  SSLNLEDTPANDS----SATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYY 116

Query: 121 SFGGLLMRLEGNYRNLNNLKQETAYLLI 148
           SFGGLLMRLEGNYRNLNNLKQE AYLLI
Sbjct: 117 SFGGLLMRLEGNYRNLNNLKQENAYLLI 144

>Sklu_2012.3 YOR224C, Contig c2012 3508-3942 reverse complement
          Length = 144

 Score =  198 bits (504), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 112/150 (74%), Gaps = 10/150 (6%)

Query: 1   MSTTLFDDIFTISEVDPGRYNNVCRIEAGSTTQEQCKLTLDINTNLFPVQVNEQLXXXXX 60
           MSTTLFDDIF + EVD GRYN V RIEA ST+ EQCKLTLDINT+LFPV VN+ L     
Sbjct: 1   MSTTLFDDIFQVQEVDQGRYNKVSRIEATSTSTEQCKLTLDINTDLFPVHVNDNLTVMLS 60

Query: 61  XXXXXXXXXXXXXXXXXGASRSWRPPQPGDRSLADDYDYVMHGTAYKFEEV--SKDVIAV 118
                             +S SWR PQPG RSLADDYDYVM+GTAY+FE+V  +KDVIAV
Sbjct: 61  STLNLDGHEE--------SSVSWRAPQPGQRSLADDYDYVMYGTAYRFEDVNNNKDVIAV 112

Query: 119 YYSFGGLLMRLEGNYRNLNNLKQETAYLLI 148
           YYSFGGLLMRLEGNYRNL+NLKQE AYLL+
Sbjct: 113 YYSFGGLLMRLEGNYRNLSNLKQENAYLLV 142

>Kwal_26.8678
          Length = 144

 Score =  184 bits (467), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 111/150 (74%), Gaps = 10/150 (6%)

Query: 1   MSTTLFDDIFTISEVDPGRYNNVCRIEAGSTTQEQCKLTLDINTNLFPVQVNEQLXXXXX 60
           MSTTLFDD+F ++EVD GRYN V RIEA ST+QE  +LT+DINT LFPV+VN+ L     
Sbjct: 1   MSTTLFDDVFQVTEVDLGRYNKVSRIEAHSTSQE-FQLTVDINTELFPVRVNDNLTVMLS 59

Query: 61  XXXXXXXXXXXXXXXXXGASRSWRPPQPGDRSLADDYDYVMHGTAYKFEEVS--KDVIAV 118
                              + SWR PQPG+RSLADDYDYVM+GTAY+FEEV+  KD+IAV
Sbjct: 60  SSLSLDETETVQ-------NGSWRAPQPGERSLADDYDYVMYGTAYRFEEVAGKKDLIAV 112

Query: 119 YYSFGGLLMRLEGNYRNLNNLKQETAYLLI 148
           YYSFGGLLMRLEGNYR L+NLKQE AYLL+
Sbjct: 113 YYSFGGLLMRLEGNYRGLSNLKQENAYLLV 142

>KLLA0D07139g complement(611102..611539) similar to sp|P20436
           Saccharomyces cerevisiae YOR224c RPB8 DNA-directed RNA
           polymerase I, II, III 16 KD subunit singleton, start by
           similarity
          Length = 145

 Score =  182 bits (462), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 105/149 (70%), Gaps = 9/149 (6%)

Query: 1   MSTTLFDDIFTISEVDPGRYNNVCRIEAGSTTQEQCKLTLDINTNLFPVQVNEQLXXXXX 60
           MS+ LFDD+FT+ EVD GRYN V RIEA ST+QE CKLTLDIN+ LFP++  +QL     
Sbjct: 1   MSSALFDDVFTVQEVDTGRYNKVSRIEAQSTSQESCKLTLDINSELFPIKTQDQLAVMIT 60

Query: 61  XXXXXXXXXXXXXXXXXGASRSWRPPQPGDRSLADDYDYVMHGTAYKFEEV--SKDVIAV 118
                                SWR P  G RSLADDYDYVM+GTAYKFEEV  +KD++AV
Sbjct: 61  TSLQLDGSEEPQ-------GTSWRAPPAGTRSLADDYDYVMYGTAYKFEEVKGNKDLLAV 113

Query: 119 YYSFGGLLMRLEGNYRNLNNLKQETAYLL 147
           YYSFGGLLMRLEGNYR LNNLKQE AYLL
Sbjct: 114 YYSFGGLLMRLEGNYRLLNNLKQENAYLL 142

>ACR111C [1158] [Homologous to ScYOR224C (RPB8) - SH]
           (548897..549331) [435 bp, 144 aa]
          Length = 144

 Score =  178 bits (452), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 92/149 (61%), Positives = 105/149 (70%), Gaps = 10/149 (6%)

Query: 1   MSTTLFDDIFTISEVDPGRYNNVCRIEAGSTTQEQCKLTLDINTNLFPVQVNEQLXXXXX 60
           MS+TLFDDIFTI EVD GRYN V RIEA ST+Q+ CKLTLD+NT LFP+Q  +QL     
Sbjct: 1   MSSTLFDDIFTIQEVDQGRYNKVSRIEAISTSQDTCKLTLDVNTELFPLQPQQQLTVMLA 60

Query: 61  XXXXXXXXXXXXXXXXXGASRSWRPPQPGDRSLADDYDYVMHGTAYKFEEV--SKDVIAV 118
                             +  SWRPP PG RSLADD+DYV +GTAYKFEE   +KD++AV
Sbjct: 61  TTLNLDGTED--------SHGSWRPPAPGARSLADDFDYVTYGTAYKFEEANGNKDMLAV 112

Query: 119 YYSFGGLLMRLEGNYRNLNNLKQETAYLL 147
           YYSFGGLLMRLEGNYR L+N KQE  YLL
Sbjct: 113 YYSFGGLLMRLEGNYRLLSNFKQENVYLL 141

>YNL172W (APC1) [4426] chr14 (310636..315882) Component of the
            anaphase-promoting complex (APC), required for Clb2p
            degradation and for the metaphase-anaphase transition
            [5247 bp, 1748 aa]
          Length = 1748

 Score = 31.6 bits (70), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 93   LADDYDYVMHGT--AYKFEEVSKDVIAVYYSFGGLLMRLEGNYRNLNNLK 140
            + DD  ++M       KF E++ D++ +YY+  G ++ +   + +  NLK
Sbjct: 1301 IGDDLSFIMKDVDIGVKFSELNTDLLPIYYTMAGRILAMGIRFASTGNLK 1350

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.136    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,272,933
Number of extensions: 139724
Number of successful extensions: 323
Number of sequences better than 10.0: 10
Number of HSP's gapped: 311
Number of HSP's successfully gapped: 10
Length of query: 148
Length of database: 16,596,109
Length adjustment: 92
Effective length of query: 56
Effective length of database: 13,411,253
Effective search space: 751030168
Effective search space used: 751030168
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 56 (26.2 bits)