Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0J04026g1198118055990.0
YOR227W124693721160.0
Scas_640.21119998420770.0
Scas_700.38123999819540.0
YPL137C127699819290.0
CAGL0M02607g1204103318400.0
Kwal_26.8687108895317920.0
KLLA0D07216g127899017650.0
ACR113W110296516600.0
Scas_690.3314237296362e-67
Kwal_23.548811126426271e-66
CAGL0J00803g13145325917e-62
YJL042W (MHP1)13987275882e-61
KLLA0E11847g12647375835e-61
ACR059W12164444586e-46
AEL043W953157920.012
Kwal_56.2415148082770.70
Scas_674.261057127770.80
CAGL0M09130g112585723.1
KLLA0A03399g84571723.2
KLLA0E06006g123983713.5
Scas_660.3077469713.8
Scas_707.1385983713.9
Kwal_23.5859619113704.6
Sklu_2353.4616113704.9
Kwal_27.1024633979695.3
ADL064W64663695.5
KLLA0A10351g22882685.8
YJR090C (GRR1)115185696.1
KLLA0D13596g49274687.6
ADL239C89157688.0
Kwal_14.104291267688.8
KLLA0A02959g55989679.1
Kwal_23.492589788689.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J04026g
         (1180 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J04026g complement(376899..380495) similar to tr|Q12276 Sac...  2161   0.0  
YOR227W (YOR227W) [5018] chr15 (762825..766565) Protein of unkno...   819   0.0  
Scas_640.21                                                           804   0.0  
Scas_700.38                                                           757   0.0  
YPL137C (YPL137C) [5309] chr16 complement(292816..296646) Protei...   747   0.0  
CAGL0M02607g complement(298560..302174) similar to tr|Q03016 Sac...   713   0.0  
Kwal_26.8687                                                          694   0.0  
KLLA0D07216g 614450..618286 weakly similar to sgd|S0006058 Sacch...   684   0.0  
ACR113W [1160] [Homologous to ScYOR227W - SH; ScYPL137C - SH] co...   644   0.0  
Scas_690.33                                                           249   2e-67
Kwal_23.5488                                                          246   1e-66
CAGL0J00803g complement(83483..87427) similar to sp|P43638 Sacch...   232   7e-62
YJL042W (MHP1) [2870] chr10 (361165..365361) Microtubule-interac...   231   2e-61
KLLA0E11847g complement(1044591..1048385) some similarities with...   229   5e-61
ACR059W [1107] [Homologous to ScYJL042W (MHP1) - SH] complement(...   181   6e-46
AEL043W [2463] [Homologous to ScYCR017C (CWH43) - SH] complement...    40   0.012
Kwal_56.24151                                                          34   0.70 
Scas_674.26                                                            34   0.80 
CAGL0M09130g 914811..918188 similar to sp|P24814 Saccharomyces c...    32   3.1  
KLLA0A03399g 305616..308153 weakly similar to sp|P39720 Saccharo...    32   3.2  
KLLA0E06006g 545879..549598 some similarities with sp|P24814 Sac...    32   3.5  
Scas_660.30                                                            32   3.8  
Scas_707.13                                                            32   3.9  
Kwal_23.5859                                                           32   4.6  
Sklu_2353.4 YER068W, Contig c2353 8340-10190                           32   4.9  
Kwal_27.10246                                                          31   5.3  
ADL064W [1677] [Homologous to ScYER068W (MOT2) - SH] complement(...    31   5.5  
KLLA0A10351g complement(906401..907087) similar to sp|Q9A7D3 Cau...    31   5.8  
YJR090C (GRR1) [2981] chr10 complement(590786..594241) F-box pro...    31   6.1  
KLLA0D13596g complement(1172223..1173701) similar to sp|P39937 S...    31   7.6  
ADL239C [1502] [Homologous to ScYIL109C (SEC24) - SH; ScYNL049C ...    31   8.0  
Kwal_14.1042                                                           31   8.8  
KLLA0A02959g 260627..262306 similar to sp|Q02206 Saccharomyces c...    30   9.1  
Kwal_23.4925                                                           31   9.4  

>CAGL0J04026g complement(376899..380495) similar to tr|Q12276
            Saccharomyces cerevisiae YOR227w or tr|Q03016
            Saccharomyces cerevisiae YPL137c, hypothetical start
          Length = 1198

 Score = 2161 bits (5599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1082/1180 (91%), Positives = 1082/1180 (91%)

Query: 1    MASIEVLKNQVDVQIEWLYKGKKRKLPKAGSVDPMRSDPMDGNRLGRRATISVRETMPEG 60
            MASIEVLKNQVDVQIEWLYKGKKRKLPKAGSVDPMRSDPMDGNRLGRRATISVRETMPEG
Sbjct: 1    MASIEVLKNQVDVQIEWLYKGKKRKLPKAGSVDPMRSDPMDGNRLGRRATISVRETMPEG 60

Query: 61   VARRRPRSSSISNGDLSNDKSAQREAPATDYSRRXXXXXXXXXXXXXIFGSLFGKKSDST 120
            VARRRPRSSSISNGDLSNDKSAQREAPATDYSRR             IFGSLFGKKSDST
Sbjct: 61   VARRRPRSSSISNGDLSNDKSAQREAPATDYSRRHSVSHSEKEKKKSIFGSLFGKKSDST 120

Query: 121  DKKPPQXXXXXXXXXXXXXXXXXXXXXXXININVNRXXXXXXXXXXXXXXLRLFHFGQSN 180
            DKKPPQ                       ININVNR              LRLFHFGQSN
Sbjct: 121  DKKPPQSSAKSPVSVKTSTSSASPTASVPININVNREKPKSHEPKSPSSPLRLFHFGQSN 180

Query: 181  SESHAAPISRGSPSPSMDPLDERIESSKHHHSHHDQGQSRDKESIEKLNKIDLKRVSFAL 240
            SESHAAPISRGSPSPSMDPLDERIESSKHHHSHHDQGQSRDKESIEKLNKIDLKRVSFAL
Sbjct: 181  SESHAAPISRGSPSPSMDPLDERIESSKHHHSHHDQGQSRDKESIEKLNKIDLKRVSFAL 240

Query: 241  DKFHHEPAQQLPSRKPKMGDIVVPEDMISEEPKISVGITTTSDNKASSAPKRKYSKDSQE 300
            DKFHHEPAQQLPSRKPKMGDIVVPEDMISEEPKISVGITTTSDNKASSAPKRKYSKDSQE
Sbjct: 241  DKFHHEPAQQLPSRKPKMGDIVVPEDMISEEPKISVGITTTSDNKASSAPKRKYSKDSQE 300

Query: 301  YKMVLENYKRLQKESERQQLEAHRVAERIANEVTGYRIRSGSLFEAAHNAVVNKVLSPSS 360
            YKMVLENYKRLQKESERQQLEAHRVAERIANEVTGYRIRSGSLFEAAHNAVVNKVLSPSS
Sbjct: 301  YKMVLENYKRLQKESERQQLEAHRVAERIANEVTGYRIRSGSLFEAAHNAVVNKVLSPSS 360

Query: 361  PTEASVIDSDPTVALDSRVAELTIDKPIHAHETFFETEGYDSSTSQVNSNPDLHQHHHEL 420
            PTEASVIDSDPTVALDSRVAELTIDKPIHAHETFFETEGYDSSTSQVNSNPDLHQHHHEL
Sbjct: 361  PTEASVIDSDPTVALDSRVAELTIDKPIHAHETFFETEGYDSSTSQVNSNPDLHQHHHEL 420

Query: 421  PLDVVYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPKPTLIDILSFCDFISITPIQ 480
            PLDVVYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPKPTLIDILSFCDFISITPIQ
Sbjct: 421  PLDVVYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPKPTLIDILSFCDFISITPIQ 480

Query: 481  VVVFDNVALNSDMIQIVLSSLINSKSIEKLGIRNVVLSSKDWEMLCKFLLVNKSIIRLDL 540
            VVVFDNVALNSDMIQIVLSSLINSKSIEKLGIRNVVLSSKDWEMLCKFLLVNKSIIRLDL
Sbjct: 481  VVVFDNVALNSDMIQIVLSSLINSKSIEKLGIRNVVLSSKDWEMLCKFLLVNKSIIRLDL 540

Query: 541  SQTKIKPDLPAECYRHNMNWKLFCNVLRERTGRPLEELLLNGVHFDEMSFDDYQDLLLTF 600
            SQTKIKPDLPAECYRHNMNWKLFCNVLRERTGRPLEELLLNGVHFDEMSFDDYQDLLLTF
Sbjct: 541  SQTKIKPDLPAECYRHNMNWKLFCNVLRERTGRPLEELLLNGVHFDEMSFDDYQDLLLTF 600

Query: 601  ASKNSSPNKRLGMAAASFSEKCMSFLFDVISQFSVQGVDLGFNELEPYIHIIIDKLSTLP 660
            ASKNSSPNKRLGMAAASFSEKCMSFLFDVISQFSVQGVDLGFNELEPYIHIIIDKLSTLP
Sbjct: 601  ASKNSSPNKRLGMAAASFSEKCMSFLFDVISQFSVQGVDLGFNELEPYIHIIIDKLSTLP 660

Query: 661  YNNLEYFTLNSSSFSCTQNIGSLLKYLSRLPNLRFLDMSNIPEMFPSVFAYLYKYLPLFP 720
            YNNLEYFTLNSSSFSCTQNIGSLLKYLSRLPNLRFLDMSNIPEMFPSVFAYLYKYLPLFP
Sbjct: 661  YNNLEYFTLNSSSFSCTQNIGSLLKYLSRLPNLRFLDMSNIPEMFPSVFAYLYKYLPLFP 720

Query: 721  SLQRIHFDSNCLTYKQCIMLCEILQKCPKLAHVSMKNELTYPEAIKDQEKEDGSDDKSTK 780
            SLQRIHFDSNCLTYKQCIMLCEILQKCPKLAHVSMKNELTYPEAIKDQEKEDGSDDKSTK
Sbjct: 721  SLQRIHFDSNCLTYKQCIMLCEILQKCPKLAHVSMKNELTYPEAIKDQEKEDGSDDKSTK 780

Query: 781  EFAARTLGATLYGFCRDRSTLLGLDVDYGDISDEIQSRIAVTLMINMKKTIDSNFSQDEV 840
            EFAARTLGATLYGFCRDRSTLLGLDVDYGDISDEIQSRIAVTLMINMKKTIDSNFSQDEV
Sbjct: 781  EFAARTLGATLYGFCRDRSTLLGLDVDYGDISDEIQSRIAVTLMINMKKTIDSNFSQDEV 840

Query: 841  TSQDDLLFDGKVISENAEGILHRLTSNLGDQSDPTKMYLLKKFVEKIESLHYEVQKKIDI 900
            TSQDDLLFDGKVISENAEGILHRLTSNLGDQSDPTKMYLLKKFVEKIESLHYEVQKKIDI
Sbjct: 841  TSQDDLLFDGKVISENAEGILHRLTSNLGDQSDPTKMYLLKKFVEKIESLHYEVQKKIDI 900

Query: 901  MFEKRETGTLPXXXXXXXXXXXXXXXXXXXIMQLFASTSSMKIMETPEAELIGKXXXXXX 960
            MFEKRETGTLP                   IMQLFASTSSMKIMETPEAELIGK      
Sbjct: 901  MFEKRETGTLPLKEKENLLRLVLLEKNLSNIMQLFASTSSMKIMETPEAELIGKANFADD 960

Query: 961  XXXXXXEKNNSTNTSHIRPFLKHLDSDRIFGFASHHSPKSPDVDASQIPHSMATESGKVV 1020
                  EKNNSTNTSHIRPFLKHLDSDRIFGFASHHSPKSPDVDASQIPHSMATESGKVV
Sbjct: 961  SNDSADEKNNSTNTSHIRPFLKHLDSDRIFGFASHHSPKSPDVDASQIPHSMATESGKVV 1020

Query: 1021 DATTGXXXXXXXXXXXXXXXXXQEHEEGEFHKWGFFVHQKGTTNPDTDDKKSGPEKTPNV 1080
            DATTG                 QEHEEGEFHKWGFFVHQKGTTNPDTDDKKSGPEKTPNV
Sbjct: 1021 DATTGKALLYKTSSSTSLLVKKQEHEEGEFHKWGFFVHQKGTTNPDTDDKKSGPEKTPNV 1080

Query: 1081 SENTNAPERVTVPKIQTVPSGNELREAIIKAKGIDSIEDLIKKVSKDDHGLKKIYGESLK 1140
            SENTNAPERVTVPKIQTVPSGNELREAIIKAKGIDSIEDLIKKVSKDDHGLKKIYGESLK
Sbjct: 1081 SENTNAPERVTVPKIQTVPSGNELREAIIKAKGIDSIEDLIKKVSKDDHGLKKIYGESLK 1140

Query: 1141 PFPILGAQDVDYTSRNASEGNTEASGRSTSTDSKTDELVT 1180
            PFPILGAQDVDYTSRNASEGNTEASGRSTSTDSKTDELVT
Sbjct: 1141 PFPILGAQDVDYTSRNASEGNTEASGRSTSTDSKTDELVT 1180

>YOR227W (YOR227W) [5018] chr15 (762825..766565) Protein of unknown
            function, interacts with Glc7p [3741 bp, 1246 aa]
          Length = 1246

 Score =  819 bits (2116), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/937 (46%), Positives = 592/937 (63%), Gaps = 52/937 (5%)

Query: 222  KESIEKLNKIDLKRVSFALDKFHHEPAQQLPSRKPKMGDIVVPEDMISEEPKISVGITTT 281
            ++ ++K++K++LKRV+ A+ +F+ +P QQLPSRKPK G++++PEDMIS  P IS+GIT +
Sbjct: 295  QKQLQKVSKVNLKRVTIAVQEFNSDPPQQLPSRKPKRGNVLIPEDMISAPPLISLGITNS 354

Query: 282  SDNKA-SSAPKRKYSKDSQEYKMVLENYKRLQKESERQQLEAHRVAERIANEVTGYRIRS 340
            SD  +  S     YSKDS+EYK+ LEN+K+  KE+E+ Q +A+ VAER+A EV  Y+ R 
Sbjct: 355  SDQSSFQSNISPSYSKDSKEYKLALENFKKAAKEAEKHQKDAYYVAERMAQEVANYKARQ 414

Query: 341  GSLFEAAHNAVVNKVLSPSSPTEASVIDSDPTVALDSRVAELTIDKPIHAHETFFETEGY 400
              L  +      N     ++  E+S        +LD+R ++L IDKPI+     FET   
Sbjct: 415  --LKTSPLTGATNSAADSATDQESS--------SLDARASKLHIDKPINVGAHPFETHQD 464

Query: 401  DSSTSQVNSNPDLHQHHHELPLDVVYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNP 460
            D+           +  H E  LDV YTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNP
Sbjct: 465  DNIK---------YSSHLEQTLDVAYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNP 515

Query: 461  KPTLIDILSFCDFISITPIQVVVFDNVALNSDMIQIVLSSLINSKSIEKLGIRNVVLSSK 520
            KPTL+DILSFCDFI+ITPI  ++FDNV+L  DM +IV+ SL+ S  +EKLG+RNVV++ +
Sbjct: 516  KPTLVDILSFCDFIAITPIHNIIFDNVSLTHDMFKIVICSLVTSPVVEKLGLRNVVINEQ 575

Query: 521  DWEMLCKFLLVNKSIIRLDLSQTKIKPDLPAECYRHNMNWKLFCNVLRERTGRPLEELLL 580
             W++LCKFLL NK++I+LD+SQTK + DL    YR  M+W+LFC VLR R GRPLEELLL
Sbjct: 576  SWKLLCKFLLQNKTLIKLDISQTKARTDLNDSNYRDQMDWELFCEVLRNREGRPLEELLL 635

Query: 581  NGVHFDEMSFDDYQDLLLTFASKNSSPNKRLGMAAASFSEKCMSFLFDVISQFSVQGVDL 640
            NG+ FD+MSF  ++++LLTFA  N     RLGMA   FS +C  FLF+ +S+++VQGVDL
Sbjct: 636  NGLRFDKMSFSHFKNILLTFAQMNPKNPIRLGMANVEFSTECFDFLFNWMSEYNVQGVDL 695

Query: 641  GFNELEPYIHIIIDKLSTLPYNNLEYFTLNSSSFSCTQNIGSLLKYLSRLPNLRFLDMSN 700
             +N LE     +I KL+ LPY +LEYFTLNS++ +   ++  +LKYLSRLP+++FLD+SN
Sbjct: 696  AYNNLESLAKRMIKKLARLPYKHLEYFTLNSTNITSVDDMSYILKYLSRLPSIKFLDLSN 755

Query: 701  IPEMFPSVFAYLYKYLPLFPSLQRIHFDSNCLTYKQCIMLCEILQKCPKLAHVSMKNELT 760
            +P++FP +    YKY P FP L+RIHFD + L+ K+  ML  IL KC  L+HVS+  +  
Sbjct: 756  LPQLFPGILTSGYKYFPQFPQLKRIHFDFDDLSIKETTMLVSILAKCETLSHVSLIGQSP 815

Query: 761  YPEAIKDQEKEDGSDDKSTKE------FAARTLGATLYGFCRDRSTLLGLDVDYGDISDE 814
             P+A K  +  D   DKS  E      F   TL A+LY F RD   L+ LDVDY  + DE
Sbjct: 816  MPDASKISDSTD-EPDKSKDEKKEQIVFMRNTLWASLYAFVRDSHNLVSLDVDYDQVPDE 874

Query: 815  IQSRIAVTLMINMKKTIDSNFSQDEVTSQDDLLFDGKVISENAEGILHRLTSNLGDQSDP 874
            IQSRIA+ LM NMK+ +DS+F  DE+T QDDL+FDG +I+E AE +L RL      Q+D 
Sbjct: 875  IQSRIALCLMHNMKRIMDSSFKLDELTVQDDLIFDGSLITETAEEVLKRLNDKSLLQNDV 934

Query: 875  TKMYLLKKFVEKIESLHYEVQKKIDIMFEKRETGTLPXXXXXXXXXXXXXXXXXXXIMQL 934
             K YLLKK+ EK+E +H+ VQ  ID MFEKR++G LP                   I+ +
Sbjct: 935  GKKYLLKKYFEKMEKVHHNVQNTIDSMFEKRKSGELPLQEKENLLRLLLLEKNLSNILDI 994

Query: 935  FASTSSMKIMETPEAELIGKXXXXXXXXXXXXEKNNSTNTSHIRPFLKHLDSDRIFGFAS 994
            FAS  ++       A+++                 ++     IRP LKHLDSDR+    S
Sbjct: 995  FASMPNI-------ADVVPFSKADNSFPNIGDSTVSANYNDGIRPSLKHLDSDRLINDVS 1047

Query: 995  HHSPKSPDVDASQIPHSMATESGKVVDATTGXXXXXXXXXXXXXXXXXQEHEEGEFHKWG 1054
                  P+ D+S  PH MAT+SG+++D TTG                 QE EEGE HKWG
Sbjct: 1048 -----IPENDSSIRPHLMATDSGRIIDVTTGKALLFKSSSNTSLAGKRQEEEEGELHKWG 1102

Query: 1055 FFV------HQKGTTNPDTDDKKSGPEKTPNVS-----ENTNAPERVTVPKI-QTVPSGN 1102
             FV      H  G  +     + SG   TP+ S     +  ++    T PKI   +P+G 
Sbjct: 1103 VFVQHQSSRHNSGLPSSANSSRISG-SLTPDSSVAGGKKGESSRTSGTRPKILPKIPTGA 1161

Query: 1103 ELREAIIKAKGIDSIEDLIKKVSKDDHGLKKIYGESL 1139
            ELR+AIIKAKGIDS++DLIK V+ +  GL+ +YG+ L
Sbjct: 1162 ELRDAIIKAKGIDSVDDLIKNVTSEKVGLESLYGDEL 1198

 Score = 37.4 bits (85), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 37/74 (50%), Gaps = 4/74 (5%)

Query: 11 VDVQIEWLYKGKKRKLPKAGSVDPMRSDPMDGNRLGRRATISVRETMPEG--VARRRPRS 68
          +DV ++WLYKGK+R   K+ +    R+       + + AT+     +P     + +RP S
Sbjct: 10 IDVPLDWLYKGKRRNRTKSAA--STRTSEATTTSVKKTATLPSTAAVPTKTIASPQRPLS 67

Query: 69 SSISNGDLSNDKSA 82
              N +LSN K A
Sbjct: 68 GQNVNNELSNSKPA 81

>Scas_640.21
          Length = 1199

 Score =  804 bits (2077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/984 (44%), Positives = 604/984 (61%), Gaps = 64/984 (6%)

Query: 221  DKESIEKLNKIDLKRVSFALDKFHHEPAQQLPSRKPKMGDIVVPEDMISEEPKISVGITT 280
            D   +  ++ I L+RV F++DKF  +P QQLPSRKPK+GD+++P DMISE P ISVGITT
Sbjct: 242  DDALLNTISNISLRRVKFSVDKFTDDPPQQLPSRKPKLGDVLIPNDMISEVPPISVGITT 301

Query: 281  TSDNKASSAPKRK---YSKDSQEYKMVLENYKRLQKESERQQLEAHRVAERIANEV-TGY 336
            T +N  S+    +   Y+KDS+EYK+ LE YK+  KE ER Q EA + AERIA EV +  
Sbjct: 302  TDNNSGSTLITNQHPMYTKDSKEYKIALERYKKSLKEGERHQEEAQKAAERIAREVYSSS 361

Query: 337  RIRSGSLFEAAHNAVVNKVLSPSSPTEASVIDSDPTVALDSRVAELTIDKPIHAHETFFE 396
            R R+ SL  +      N   +P S   ++ +D+     +D +   L+IDKPIH H+  F 
Sbjct: 362  RHRANSLTSSLTKTTSNTSSNPLSKQNSNELDT----KVDVKAKTLSIDKPIHMHQNNF- 416

Query: 397  TEGYDSSTSQVNSNPDLHQHHHELPLDVVYTRCCHLREILPIPSTLRQVKGKTAPLQTLK 456
              G D ST   N          E+ LDV+YTRCCHLREILPIPSTLRQVKGKTAPLQTLK
Sbjct: 417  --GDDFSTHNTN----------EVTLDVIYTRCCHLREILPIPSTLRQVKGKTAPLQTLK 464

Query: 457  FLNPKPTLIDILSFCDFISITPIQVVVFDNVALNSDMIQIVLSSLINSKSIEKLGIRNVV 516
            FLNP+PTLIDILSFCDFISI PI  +VFDNVAL S+M +IVLSS++NS  +EKLG+RNV 
Sbjct: 465  FLNPRPTLIDILSFCDFISIIPIHTIVFDNVALTSEMFRIVLSSIVNSNVLEKLGLRNVT 524

Query: 517  LSSKDWEMLCKFLLVNKSIIRLDLSQTKIKPDLPAECYRHNMNWKLFCNVLRERTGRPLE 576
            +  +DW++ CKFL+ NKS+I+LD+SQTKI+P+    CYR NM+W LFC VL+ R G+PLE
Sbjct: 525  IDEEDWKIFCKFLIDNKSLIKLDISQTKIRPESSISCYRENMDWSLFCQVLKRRKGKPLE 584

Query: 577  ELLLNGVHFDEMSFDDYQDLLLTFASKNSSPNKRLGMAAASFSEKCMSFLFDVISQFSVQ 636
            ELLLNGV F+ +    +QDLL  FA  N   N RLG+A +  S  C+  LF  +S++SV+
Sbjct: 585  ELLLNGVKFNRIPLGIFQDLLHVFAKMNPKTNVRLGLAVSDISLGCLKILFPWMSKYSVE 644

Query: 637  GVDLGFNELEPYIHIIIDKLSTLPYNNLEYFTLNSSSFSCTQNIGSLLKYLSRLPNLRFL 696
            GVDL FN L   +  II+ LSTL + +L+YFTLNS++ S   ++  L+KYLS+LPNL+FL
Sbjct: 645  GVDLAFNNLADLLKPIIESLSTLDFKHLKYFTLNSTNISSVDDMALLIKYLSKLPNLQFL 704

Query: 697  DMSNIPEMFPSVFAYLYKYLPLFPSLQRIHFDSNCLTYKQCIMLCEILQKCPKLAHVSMK 756
            D+SN+P++FP++   L+KYLP FPSL+RI+F++N LTY++  M+C ILQKC  ++HVS+ 
Sbjct: 705  DLSNLPQLFPNIIPDLHKYLPQFPSLKRIYFENNDLTYREISMICNILQKCKLISHVSLL 764

Query: 757  NELTYPEAIKDQEK----EDGSDDKSTKEFAARTLGATLYGFCRDRSTLLGLDVDYGDIS 812
            ++  +P +  + E     E G DD +   F   TL ATLY   R    L+ LD+DY ++S
Sbjct: 765  SQ--HPPSTLENENHIDTELGKDDSNKDLFNRHTLWATLYSLARSSPNLVSLDIDYDELS 822

Query: 813  DEIQSRIAVTLMINMKKTIDSNFSQDEVTSQDDLLFDGKVISENAEGILHRLTSNLGDQS 872
            +E++SRIA+ LM NM++T+DS+F  DE   QD+LLFDG +ISE A+ +L++L     D  
Sbjct: 823  EEMRSRIALCLMRNMQRTMDSSFELDEALLQDNLLFDGSLISETADTVLNKLNDESKDDI 882

Query: 873  DPTKMYLLKKFVEKIESLHYEVQKKIDIMFEKRETGTLPXXXXXXXXXXXXXXXXXXXIM 932
            DPT+ YLLKK++EK+E+LH  VQ+ ID MFEKR++G LP                   I+
Sbjct: 883  DPTRKYLLKKYLEKLENLHNSVQQTIDSMFEKRKSGELPLEEKENLVRLLLLEKNLSNIL 942

Query: 933  QLFASTSSMKIMETPEAELIGKXXXXXXXXXXXXEKNNSTNTSHIRPFLKHLDSDRIFGF 992
            ++F+    +       +++                          RP LKHLDS R+   
Sbjct: 943  EIFSKIPFL-------SDVFNSTLASSPIQTNQTTAITDDEVPVRRPQLKHLDSARLL-- 993

Query: 993  ASHHSPKSPDVDASQIPHSMATESGKVVDATTGXXXXXXXXXXXXXXXXXQEHEEGEFHK 1052
               H    P  + +  PH MATE+G V+D  TG                 QE EEGE HK
Sbjct: 994  ---HQAIVPSSENTGDPHIMATEAGSVIDTYTGKPVLHKSSSNTSLFSKKQEEEEGELHK 1050

Query: 1053 WGFFVHQKGTTNPDTDDKKSGPEKTPNVSENT----------NAP------ERVTVPKI- 1095
            WG FV QK       ++   G E + N+S+ +          ++P      ++   PKI 
Sbjct: 1051 WGVFVQQKQ----QQENAVPGSESSSNLSKESISSQASPTHRSSPTSLQLEDKTATPKIL 1106

Query: 1096 QTVPSGNELREAIIKAKGIDSIEDLIKKVSKDDHGLKKIYGESLKPFPILGAQDVDYTSR 1155
              +PSG +LREAII AKGI SI+DLI+ V++    ++ I G+    F  +     + T+ 
Sbjct: 1107 PKIPSGPQLREAIINAKGIASIDDLIQNVNEKRVEVESINGD----FVPIDCNKKNDTNI 1162

Query: 1156 NASEGNTEASGRSTSTDSKTDELV 1179
            +    NT ++    +   K DE++
Sbjct: 1163 SRQPTNTSSANEDETVTEKYDEIL 1186

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 20/27 (74%)

Query: 6  VLKNQVDVQIEWLYKGKKRKLPKAGSV 32
          ++ + +DV ++WLYKGK++   KA S+
Sbjct: 24 IISSDIDVPLDWLYKGKRKSRTKAASL 50

>Scas_700.38
          Length = 1239

 Score =  757 bits (1954), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/998 (43%), Positives = 594/998 (59%), Gaps = 106/998 (10%)

Query: 219  SRDKESIEKLNKIDLKRVSFALDKFHHEPAQQLPSRKPKMGDIVVPEDMISEEPKISVGI 278
            S +K +I+KL+ I LKRV+FA+DKF  +PAQQLPSR PK G+++VP+DMISE P IS+GI
Sbjct: 252  SEEKLAIQKLSSIKLKRVTFAVDKFEADPAQQLPSRTPKQGNVLVPDDMISEVPSISMGI 311

Query: 279  TTTSDNKASSAPKRKYSKDSQEYKMVLENYKRLQKESERQQLEAHRVAERIANEVTGYRI 338
               S N   S     +SK+S+EY++ LEN +   KE+E+ Q EAH  A+RIA+EV  ++ 
Sbjct: 312  ---SANTPQSTKTPSFSKNSKEYRLALENQRFAIKEAEKHQKEAHFAAKRIADEVANFKA 368

Query: 339  RSGSLFEAAHNAVVNKVLSPSSPTEASVIDSDPTVALDSRVAEL--TIDKPIHAHETFFE 396
             S     +   + +   L PS            T A DS + E    IDKPIH HE  FE
Sbjct: 369  TS-----SEQKSSIPVTLLPS------------TTAADSELNEKINNIDKPIHVHEHHFE 411

Query: 397  TEGYDSSTSQVNSNPDLHQHHHELPLDVVYTRCCHLREILPIPSTLRQVKGKTAPLQTLK 456
             E    ST +V              LD+VYTRCCHLREILPIPSTLRQVKGKTAPLQTLK
Sbjct: 412  QE---ISTGEVT-------------LDIVYTRCCHLREILPIPSTLRQVKGKTAPLQTLK 455

Query: 457  FLNPKPTLIDILSFCDFISITPIQVVVFDNVALNSDMIQIVLSSLINSKSIEKLGIRNVV 516
            FLNPKPTLIDILSFCDFISI PI  ++FDNV+L S+M +I++SS++ S  +EKLG+RNV+
Sbjct: 456  FLNPKPTLIDILSFCDFISIVPINTIIFDNVSLTSEMFKIIISSVVKSTVLEKLGLRNVI 515

Query: 517  LSSKDWEMLCKFLLVNKSIIRLDLSQTKIKP---DLPAECYRHNMNWKLFCNVLRERTGR 573
            +  ++W++LCKF+L NKSI++LD+SQTKI+    DL    YRHNM+W+LF NVL+ R G+
Sbjct: 516  IDKENWKLLCKFMLNNKSIVKLDISQTKIRTESNDL-ENIYRHNMDWELFANVLQYRLGK 574

Query: 574  PLEELLLNGVHFDEMSFDDYQDLLLTFASKN--SSPNKRLGMAAASFSEKCMSFLFDVIS 631
            PLEE+LLNG+ F+ +    ++DLL + +S+   +S   R+G+A +  S  C+  + + IS
Sbjct: 575  PLEEILLNGIKFNNIPVHIFKDLLHSISSQRNATSVGIRVGLATSDISLDCLKAVMNWIS 634

Query: 632  QFSVQGVDLGFNELEPYIHIIIDKLSTLPYNNLEYFTLNSSSFSCTQNIGSLLKYLSRLP 691
              +VQGVDL FN+L  ++  ++ KLS+L + NLEYFTLN+++ S + ++  +LKYL +LP
Sbjct: 635  ANNVQGVDLSFNDLAAFVKPLVGKLSSLTFPNLEYFTLNNTNISSSYDVALILKYLCKLP 694

Query: 692  NLRFLDMSNIPEMFPSVFAYLYKYLPLFPSLQRIHFDSNCLTYKQCIMLCEILQKCPKLA 751
            NL+FLD+SN+P+++P V  Y+YKYLP FP L+RIHFD+N L++K+  ++C IL KC  LA
Sbjct: 695  NLKFLDLSNLPQIYPDVLPYMYKYLPRFPQLKRIHFDNNNLSFKELTVVCNILLKCHSLA 754

Query: 752  HVSMKNELTYPEAIKDQEKEDGSDDKSTKEFAARTLGATLYGFCRDRSTLLGLDVDYGDI 811
            HVSM ++L  P A       +    +S  +FA   L ATLY   +D   L+GLD+DY  I
Sbjct: 755  HVSMLSQLQSPTAAASDSSTNVVGPESQSQFARNNLWATLYALAKDSPNLVGLDIDYDRI 814

Query: 812  SDEIQSRIAVTLMINMKKTIDSNFSQDEVTSQDDLLFDGKVISENAEGILHRL------T 865
             +EIQ RIA+ LM NM + +DS F  DE+ SQDDLLFDG +I+E AE +L +L      T
Sbjct: 815  PEEIQQRIALCLMRNMNRAMDSTFQLDELASQDDLLFDGTLITETAEDVLTKLNKLNENT 874

Query: 866  SNLGDQSDPTKMYLLKKFVEKIESLHYEVQKKIDIMFEKRETGTLPXXXXXXXXXXXXXX 925
            S   D+ D TK YLLKK++EK+  +H+  Q KID MFEKR +G L               
Sbjct: 875  SASTDKKDVTKRYLLKKYLEKLHRVHFNTQHKIDCMFEKRNSGELTLQEKENLLRLLLLE 934

Query: 926  XXXXXIMQLFASTSSMKIMETPEAELIGKXXXXXXXXXXXXEKNNSTNTS------HIRP 979
                 +M++  +   +       + ++G              +  ST TS          
Sbjct: 935  KNLSNLMEILGALPQV-------SSVLGSNKEDSMQPVYQQSQEGSTVTSGTSSESVSSV 987

Query: 980  FLKHLDSDRIFGFASHHSPKSPDVDASQIPHSMATESGKVVDATTGX-XXXXXXXXXXXX 1038
             LKH++S                V     PH MAT+SG+ VD  TG              
Sbjct: 988  VLKHVESVEPIV-----------VPPETRPHLMATDSGRTVDVLTGKPVLFRRGSSSTSV 1036

Query: 1039 XXXXQEHEEGEFHKWGFFVHQKGTTNPDTDDKKSGPEKTPNVSENTNAPER--------- 1089
                Q  EEGE HKWG+FV Q+ +  P+ +  KS  ++T N    T              
Sbjct: 1037 VGKKQIEEEGELHKWGYFVQQQCSIYPENEVTKS--KETVNPPTPTTPTTASTSTTSTAT 1094

Query: 1090 ------------VTVPKIQTVPSGNELREAIIKAKGIDSIEDLIKKVSKDDHGLKKIYGE 1137
                        + VPKI   PSG ELR+AIIKAKGIDSI+DLI+ V++D+  L  IYG+
Sbjct: 1095 HTPTPTTSKTPIIIVPKI---PSGTELRKAIIKAKGIDSIDDLIQNVNQDEDELINIYGK 1151

Query: 1138 SLKP---FPI--LGAQDVDYTSRNASEGNTEASGRSTS 1170
            S++P    P   L   D+   +R   + NT A+  +T+
Sbjct: 1152 SVQPKLNHPTGKLVEDDISSITRITPKTNTPAANGNTA 1189

>YPL137C (YPL137C) [5309] chr16 complement(292816..296646) Protein of
            unknown function, has low similarity to a region of S.
            cerevisiae Mhp1p, which is a microtubule-interacting
            protein that functions in stabilization of microtubules
            [3831 bp, 1276 aa]
          Length = 1276

 Score =  747 bits (1929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/998 (43%), Positives = 596/998 (59%), Gaps = 87/998 (8%)

Query: 224  SIEKLNKIDLKRVSFALDKFHHEPAQQLPSRKPKMGDIVVPEDMISEEPKISVGITTTSD 283
            +++ L+ + LKRVSFA+DKF  +P QQLPSR PK G+I++P+DMISE P ISVGI++++ 
Sbjct: 273  AVKDLSTVSLKRVSFAVDKFESDPPQQLPSRTPKKGNILIPDDMISEVPSISVGISSSNQ 332

Query: 284  NKASSAPKRK---YSKDSQEYKMVLENYKRLQKESERQQLEAHRVAERIANEVTGYRIRS 340
            +  S+    K   Y+K S+EY + LEN K   +E+ + Q EAH  A RIA EV  ++  S
Sbjct: 333  SAKSTNSNIKGPLYTKKSKEYILALENQKLALREAAKHQQEAHFAANRIAFEVANFKTAS 392

Query: 341  ---GSLFEAAHNAVVNKVLSPSSPTEASVIDSDPTVALDSRVAELTIDKPIHAHETFFET 397
               G L E +    + K     SP             L   +++  IDKPIH HE +F+ 
Sbjct: 393  DAGGKLTEKSSEGTITKQREEVSPPNVEADRELENNKLAENLSKAGIDKPIHMHEHYFKE 452

Query: 398  EGYDSSTSQVNSNPDLHQ-HHHELPLDVVYTRCCHLREILPIPSTLRQVKGKTAPLQTLK 456
               D          D H   ++E+ LDV+YTRCCHLREILPIPSTLRQVK KTAPLQ LK
Sbjct: 453  PDQDKYQ-------DGHSIENNEVTLDVIYTRCCHLREILPIPSTLRQVKDKTAPLQILK 505

Query: 457  FLNPKPTLIDILSFCDFISITPIQVVVFDNVALNSDMIQIVLSSLINSKSIEKLGIRNVV 516
            FLNPKPTLIDILSFCDFI+I PI  +VFDNVALN DM +I++S+L+NS  ++KL +RNV 
Sbjct: 506  FLNPKPTLIDILSFCDFITIAPIHTIVFDNVALNQDMFRIIISALVNSTVLDKLSLRNVR 565

Query: 517  LSSKDWEMLCKFLLVNKSIIRLDLSQTKIKPDLPAECYRHNMNWKLFCNVLRERTGRPLE 576
            +    W++LCKFLL+NKS+ +LD+SQTKIK DL    YRHNM+W LF +VL +R+ +P+E
Sbjct: 566  IDQDGWKLLCKFLLLNKSLNKLDISQTKIKSDLAESLYRHNMDWNLFTDVLSQRSHKPIE 625

Query: 577  ELLLNGVHFDEMSFDDYQDLLLTFASKNSSPNK--RLGMAAAS---FSEKCMSFLFDVIS 631
            ELL NG+ F ++ +  +  LL +FA++ + P    RLG+A A+    S+ C+ F+F+ +S
Sbjct: 626  ELLFNGIQFSKIPYSCFARLLTSFATQKNFPESGIRLGLAGATTSNISQDCLKFIFNWMS 685

Query: 632  QFSVQGVDLGFNELEPYIHIIIDKLSTLPYNNLEYFTLNSSSFSCTQNIGSLLKYLSRLP 691
            Q++VQGVDL FN+L   I  ++ KLS L Y+NL YF LNS++ S + ++  LLKYLS+LP
Sbjct: 686  QYNVQGVDLAFNDLSTMIKPMVGKLSALSYDNLRYFILNSTNISTSYDLALLLKYLSKLP 745

Query: 692  NLRFLDMSNIPEMFPSVFAYLYKYLPLFPSLQRIHFDSNCLTYKQCIMLCEILQKCPKLA 751
            NL FLD+SN+ + FP +  Y+YKYLP FP+L+RIH DSN LT K+  ++C IL KC  L+
Sbjct: 746  NLIFLDLSNLSQCFPDILPYMYKYLPRFPNLKRIHLDSNNLTLKELAVVCNILIKCKSLS 805

Query: 752  HVSMKNE-------LTYPEAIKDQEKEDGSDDKSTK-----EFAARTLGATLYGFCRDRS 799
            HVSM N+       +   ++   Q   DG  D S+      +FA  +  +TLY F RD  
Sbjct: 806  HVSMTNQNVENFYLMNGTDSPVQQTNTDGDLDSSSTLDVKGQFAKNSFSSTLYAFARDSP 865

Query: 800  TLLGLDVDYGDISDEIQSRIAVTLMINMKKTIDSNFSQDEVTSQDDLLFDGKVISENAEG 859
             L+GLD DY  IS+EIQSRIA+ LM NMK+T+DS F  DE+ SQDDLLFDG +++  AE 
Sbjct: 866  NLIGLDFDYDLISEEIQSRIALCLMRNMKRTMDSTFQLDELDSQDDLLFDGSLVTMTAES 925

Query: 860  ILHRLTSNLGDQS-----DPTKMYLLKKFVEKIESLHYEVQKKIDIMFEKRETGTLPXXX 914
            +L +L   L D+S     D TK YLLKK++EK   LH+ VQ  ID MFEKR++G LP   
Sbjct: 926  VLEKLNL-LSDKSTKVKKDTTKRYLLKKYIEKFHILHHNVQHTIDTMFEKRKSGELPLQE 984

Query: 915  XXXXXXXXXXXXXXXXIMQLFASTSSMKIMETPEAELIGKXXXXXXXXXXXXEKNNSTNT 974
                            I++LF+   ++        +++G             E  +S+  
Sbjct: 985  KENLVRLLLLEQNLCNILELFSHNPNLN-------DVLG------SSRDDSKESVDSSED 1031

Query: 975  SHIRPFLKHLDSDRIFGFASHHSPK---SPDVDA-SQIPHSMATESGKVVDATTGX-XXX 1029
            S + P LKH++S        +H P+    P+ D  +  PH MAT+SGK +D  TG     
Sbjct: 1032 SKL-PALKHVES-------GYHVPEEKIQPENDVITARPHLMATDSGKTIDVFTGKPLVF 1083

Query: 1030 XXXXXXXXXXXXXQEHEEGEFHKWGFFVHQKGTTNPDTDDKKSGPEKTPNVSENTNAP-- 1087
                         QE EEGE HKWGFFV Q+ +  P+ +  +  P  + +   NT     
Sbjct: 1084 KHTSSSTSVGCKKQEEEEGELHKWGFFVQQQRSLYPENESTRQTPFASGDTPINTETAGK 1143

Query: 1088 ------------ERVTV-------PKI-QTVPSGNELREAIIKAKGIDSIEDLIKKVSKD 1127
                        E  T        PKI   +PSG  LR AI+KAKGIDSI+DLI+ V+ +
Sbjct: 1144 STSSPSVSTSNNETATTSLFSPANPKILPKIPSGAVLRSAIMKAKGIDSIDDLIQNVNSN 1203

Query: 1128 DHGLKKIYGESLK--PFPILGAQDVDYTSRNASEGNTE 1163
            +  L+ IYGES++          D D ++ N  +G+ E
Sbjct: 1204 NIELENIYGESIQNSASTFTPGVDSDVSAPNTDKGSVE 1241

>CAGL0M02607g complement(298560..302174) similar to tr|Q03016
            Saccharomyces cerevisiae YPL137c, hypothetical start
          Length = 1204

 Score =  713 bits (1840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/1033 (41%), Positives = 615/1033 (59%), Gaps = 98/1033 (9%)

Query: 185  AAPISRGSPSPSMDPLDERIESSKHHHSHHDQGQSRDKESIEK-------------LNKI 231
            A+P+S  SPSP +       +S+K H + +    + DK + ++             L KI
Sbjct: 205  ASPVSANSPSPDIRRSTSITKSAKEHRARNSDNTTTDKNTHQETQKESGSRERPTDLTKI 264

Query: 232  DLKRVSFALDKFHHEPAQQLPSRKPKMGDIVVPEDMISEEPKISVGITTTSDNKASSAPK 291
             LKRV FA+DKF  +P QQLPSR PK G+I++P+DMISE P ISVGIT+ +  K +  P+
Sbjct: 265  SLKRVKFAVDKFETDPPQQLPSRTPKPGNIMIPDDMISELPAISVGITS-NQQKNNLGPQ 323

Query: 292  RKYSKDSQEYKMVLENYKRLQKESERQQLEAHRVAERIANEVTGYRIRSGSLFEAAHNAV 351
              ++KDS EYK  LE ++   KE+E+ Q EAH  A RIA+EV+ +   S     +A   +
Sbjct: 324  --FTKDSIEYKRALEIHQIALKEAEKHQQEAHHAARRIAHEVSNF---SNGKQASAPGFM 378

Query: 352  VNKVLSPSSPTE---ASVIDSDPTVALDSRVAELTIDKPIHAHETFFETEGYDSSTSQVN 408
            +N V           ++V D+D  + L  ++ +  ID PIH HE  F+  G   ST + N
Sbjct: 379  LNLVAQSDQSKRDQNSAVHDTDINIDLSEKLNKTGIDLPIHMHEHHFDDPG---STLEGN 435

Query: 409  SNPDLHQHHHELPLDVVYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPKPTLIDIL 468
                      E+ LDVVYTRCCHLREILPIPSTL+QV  KTAPLQTLKFLNPKPTLIDIL
Sbjct: 436  ---------QEITLDVVYTRCCHLREILPIPSTLKQVTDKTAPLQTLKFLNPKPTLIDIL 486

Query: 469  SFCDFISITPIQVVVFDNVALNSDMIQIVLSSLINSKSIEKLGIRNVVLSSKDWEMLCKF 528
            SFCDFI+I PIQ +VFDNV L+++M +IV+SS+  S  +EK+ +RNV ++ + W++LCKF
Sbjct: 487  SFCDFIAIVPIQTIVFDNVNLSTEMFKIVISSVAYSSVLEKISLRNVTMNKESWQLLCKF 546

Query: 529  LLVNKSIIRLDLSQTKIKPDLPAECYRHNMNWKLFCNVLRERTG--RPLEELLLNGVHFD 586
            LL ++S+ ++D+SQT+IKP+   E  R +M+W LF   L +R    RPLEE+L+NGV+FD
Sbjct: 547  LLTSQSLNKIDISQTRIKPETGTELLRSSMDWDLFAKTLAKRAEHLRPLEEILVNGVNFD 606

Query: 587  EMSFDDYQDLLLTFASKNSSPNK-RLGMAAAS---FSEKCMSFLFDVISQFSVQGVDLGF 642
             +  +D+Q+ L+TFA++    N  RLG+A A+    S +   FL + +S ++VQGVDLGF
Sbjct: 607  NIPLEDFQNFLITFATQKHLTNGIRLGLANATKSICSVQHYKFLLEWMSNYNVQGVDLGF 666

Query: 643  NELEPYIHIIIDKLSTLPYNNLEYFTLNSSSFSCTQNIGSLLKYLSRLPNLRFLDMSNIP 702
            N+L   I   + KLS+L Y NL YFTLNS++   T ++  LLK LS+LPNL FLD+SN+P
Sbjct: 667  NDLSNLIKPTLGKLSSLTYPNLHYFTLNSTNIQSTNDMALLLKALSKLPNLEFLDLSNLP 726

Query: 703  EMFPSVFAYLYKYLPLFPSLQRIHFDSNCLTYKQCIMLCEILQKCPKLAHVSMKNELTYP 762
            ++FP +  Y+YKYLP FP L+R+H D+  +TYK+  ++C +L KC  L HVSM ++   P
Sbjct: 727  QVFPDILPYMYKYLPRFPQLKRLHIDNENMTYKEMTVVCNLLAKCTGLIHVSMLSQ--KP 784

Query: 763  EAIKDQEKEDGS---DDKSTKEFAARTLGATLYGFCRDRSTLLGLDVDYGDISDEIQSRI 819
               + +  E+ S   D  S   FA     ATLY F RD   L+GLD+DY  ISDE+ SR+
Sbjct: 785  PMSETESAENLSTNGDSNSGTVFAKNNFSATLYAFVRDSPNLVGLDIDYSSISDEVSSRL 844

Query: 820  AVTLMINMKKTIDSNFSQDEVTSQDDLLFDGKVISENAEGILHRLTS----NLGDQSDPT 875
            A+ LM NM++T+DS+F  DE+ SQD+LLFDG +++  A+ +L RLT      + ++ D T
Sbjct: 845  ALCLMRNMRRTMDSSFQLDELDSQDELLFDGSLVTMTAKDVLERLTQLNTKQIIEKKDAT 904

Query: 876  KMYLLKKFVEKIESLHYEVQKKIDIMFEKRETGTLPXXXXXXXXXXXXXXXXXXXIMQLF 935
            K YLLKK+V+K+  +H  VQ+ ID +FEKR++G LP                   I+ +F
Sbjct: 905  KRYLLKKYVQKLHKIHNNVQQTIDNLFEKRKSGDLPMQEKENLVRLILLEKNLVHILDIF 964

Query: 936  ASTSSMKIMETPEAELIGKXXXXXXXXXXXXEKNNSTNTSHIRPFLKH-LDSDRIFGFAS 994
             +  ++       +E++G+             K  S+++    P L+H +++D +   ++
Sbjct: 965  DNMPNL-------SEVLGE------------NKIASSDSLVDHPNLRHVVETDNLNENSN 1005

Query: 995  HHSPKSPDVD-ASQIPHSMATESGKVVDATTGXXXXXXXXXXXXXXXXXQEHEEGEFHKW 1053
                +  + D   Q PH MATESG+ +D  TG                 QE EEG+FHKW
Sbjct: 1006 ERDLQVNENDNLQQRPHLMATESGRTIDTLTGRPVFSRRSSTTSLASKKQEEEEGDFHKW 1065

Query: 1054 GFFVHQKGTTNPDTDDKKSGPEKTPNVSENTNAPERVTVPKIQT--------VPSGNELR 1105
            GF++ Q+    PD      G  +    S  + +  + T+P I +        +PSG ELR
Sbjct: 1066 GFYIQQQKALYPD------GESQYGESSAVSASTSQTTLPSIDSKEKKIFTKLPSGPELR 1119

Query: 1106 EAIIKAKGIDSIEDLIKKVSKDDHGLKKIYGESLKPFPILGAQDVDYTSRNASEGNTEAS 1165
             AIIKAKG+ SIE+LI+K+  +D+    I  ESL  + IL         +N  EGN   +
Sbjct: 1120 TAIIKAKGVSSIEELIQKI--NDYHCCDI--ESL--YNIL--------KQNELEGNGIVT 1165

Query: 1166 GRSTSTDSKTDEL 1178
              S  TD++ + L
Sbjct: 1166 SESDLTDNEREHL 1178

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 28/72 (38%), Gaps = 18/72 (25%)

Query: 6  VLKNQVDVQIEWLYKGKKRKLPKAGSVDPMRSDPMDGNRLGRRATISVRETMPEGVARRR 65
          ++ N VDV ++WLYKG K                   ++  RR   S            R
Sbjct: 1  MITNDVDVPVDWLYKGSK------------------PHKKARRKNRSAVAVAGAAGKTER 42

Query: 66 PRSSSISNGDLS 77
           RS SISN  LS
Sbjct: 43 SRSLSISNASLS 54

>Kwal_26.8687
          Length = 1088

 Score =  694 bits (1792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/953 (41%), Positives = 551/953 (57%), Gaps = 101/953 (10%)

Query: 214  HDQGQ------SRDKESIEKLNKIDLKRVSFALDKFHHEPAQQLPSRKPKMGDIVVPEDM 267
            HD+ Q       R    I+ L K  L+RV+FA+DKF  +P QQ+PSRKPK G+++VP+DM
Sbjct: 160  HDERQILNRNPHRQSLPIQSLAKTSLRRVTFAVDKFSTDPPQQIPSRKPKRGNVLVPQDM 219

Query: 268  ISEEPKISVGITTTSDNKASSAPKRKYSKDSQEYKMVLENYKRLQKESERQQLEAHRVAE 327
            +   P ISVGIT T  N   SA    + ++S+EYK+ LE +++  +ESE+ Q EAH  A+
Sbjct: 220  MCPTPSISVGITNTQGNIEQSA--SPFDENSKEYKLALEEHRKALRESEKHQQEAHYAAQ 277

Query: 328  RIANEVTGYRIRSGSLFEAAHNAVVNKVLSPSSPTEASVIDSDPTVALDSRVAELTIDKP 387
            RIA+EV  ++ R   L  A H    +   S ++  E+S        A+D R   L IDKP
Sbjct: 278  RIAHEVLKFKTRP--LSGAPHQLTAS---SSNTNVESSAPSGTTNAAIDERAKNLEIDKP 332

Query: 388  IHAHETFFETEGYDSSTSQVNSNPDLHQHHHELPLDVVYTRCCHLREILPIPSTLRQVKG 447
            IH HE  F+    D+S+S  N +        +L LD +YTRCCHLREILPIPSTL+QVKG
Sbjct: 333  IHMHEHHFQD---DTSSSAENGD--------KLTLDKIYTRCCHLREILPIPSTLKQVKG 381

Query: 448  KTAPLQTLKFLNPKPTLIDILSFCDFISITPIQVVVFDNVALNSDMIQIVLSSLINSKSI 507
            K+APLQTLKFLNP+PTLID+LSFCDFI+I PI  VVFDNV+L S+M++ V+SSL+ SK I
Sbjct: 382  KSAPLQTLKFLNPRPTLIDVLSFCDFIAIVPIHNVVFDNVSLTSEMLKNVISSLVTSKVI 441

Query: 508  EKLGIRNVVLSSKDWEMLCKFLLVNKSIIRLDLSQTKIKPDLPAECYRHNMNWKLFCNVL 567
            EK+G RNVV +S  W +LCKFL+   S+++LD+SQTKIKPDL    YR NM+W LF +VL
Sbjct: 442  EKVGFRNVVFNSDTWILLCKFLMRTSSLLKLDISQTKIKPDLEKNLYRANMDWDLFIDVL 501

Query: 568  RERTGRPLEELLLNGVHFDEMSFDDYQDLLLTFASKNSSPNKRLGMAAASFSEKCMSFLF 627
            + R+GRPLEELL+NGV  +  SFD +  LL TFA+ ++   KRLG+A +  S   + FL 
Sbjct: 502  QRRSGRPLEELLINGVKIE--SFDSFVSLLNTFAAGSTQNGKRLGIAQSELSADHLKFLM 559

Query: 628  DVISQFSVQGVDLGFNELEPYIHIIIDKLSTLPYNNLEYFTLNSSSFSCTQNIGSLLKYL 687
              +S F +QGVD+ FN+    +  ++ KLS+LP+ +L+YFTLN+++     +   LL+ L
Sbjct: 560  SWMSDFKIQGVDMAFNDFSELVRPLVGKLSSLPFQHLQYFTLNNTNIPTAYDAALLLRAL 619

Query: 688  SRLPNLRFLDMSNIPEMFPSVFAYLYKYLPLFPSLQRIHFDSNCLTYKQCIMLCEILQKC 747
            SRLPNL FLD+SN+P++FP +F YL KYLP   +L+R+H DSN  T ++ +M+  +L KC
Sbjct: 620  SRLPNLYFLDLSNLPQVFPEIFPYLNKYLPRMANLKRLHLDSNEFTSREVVMITSVLSKC 679

Query: 748  PKLAHVSMKNELTYPEAIKDQEKEDGSDDKSTKEFAARTLGATLYGFCRDRSTLLGLDVD 807
             +L H+S+ N       I  +    G             + A LY   R  S L  LDV 
Sbjct: 680  NELLHLSLMN-------IPQESFTTG-------------MCANLYDCVRQCSKLTNLDVT 719

Query: 808  YGDISDEIQSRIAVTLMINMKKTIDSNFSQDEVTSQDDLLFDGKVISENAEGILHRLTSN 867
            Y  I +EI SRIA+ LM  M++    +F  D++T+QDDLLFDG ++SE AE +L +L + 
Sbjct: 720  YAYIPEEISSRIAICLMRRMQR----DFELDDLTNQDDLLFDGTLLSETAENVLEKLNNF 775

Query: 868  LGDQSDPTKMYLLKKFVEKIESLHYEVQKKIDIMFEKRETGTLPXXXXXXXXXXXXXXXX 927
               ++D T+ YLLKK+ EK   +H  VQ  ID MFEKR  G L                 
Sbjct: 776  EDLETDVTRRYLLKKYWEKFNRVHDNVQSTIDQMFEKRSAGELNLQSKENLLRLLFLENN 835

Query: 928  XXXIMQLFASTSSMKIMETPEAELIGKXXXXXXXXXXXXEKNNSTNTSHIRPFLKHLDSD 987
               I+ +  S   +       A++ G                       I P  +   SD
Sbjct: 836  LSHILDVLKSYPQV-------ADVAG-----------------------IEPNARSAGSD 865

Query: 988  RIFGFASHHSPKSPDVDASQIPHSMATESGKVVDATTGXXXXXXXXXXXXXXXXXQEHEE 1047
             +    +  +  +  V     PH MAT+SG+ +D TTG                 QE EE
Sbjct: 866  HLLKGITSEAENNSHVR----PHLMATDSGRTIDVTTGTPVLVKTPSHVSLVGKRQEEEE 921

Query: 1048 GEFHKWGFFVHQKGTTNPDTDDKKSG---PEKTPNVSENTNAPERVTVPK---------- 1094
            GEFHKWGFFV Q+ +  PD   + +    PEK P  + ++    + + P           
Sbjct: 922  GEFHKWGFFVQQQNSIYPDHHSRNTNDEPPEKRPGSAASSTESPKSSQPSAISQTASQAA 981

Query: 1095 ----IQTVPSGNELREAIIKAKGIDSIEDLIKKVSKDDHGLKKIYGESLKPFP 1143
                I  +PSG ELREA+++AKGIDSIE+LI+ V+ +   L  IYG  L P P
Sbjct: 982  AHALISKIPSGAELREAVMRAKGIDSIEELIENVNGNRVTLDNIYGVPLHPMP 1034

>KLLA0D07216g 614450..618286 weakly similar to sgd|S0006058
            Saccharomyces cerevisiae YPL137c, start by similarity
          Length = 1278

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/990 (40%), Positives = 566/990 (57%), Gaps = 118/990 (11%)

Query: 225  IEKLNKIDLKRVSFALDKFHHEPAQQLPSRKPKMGDIVVPEDMISEEPKISVGITTTS-- 282
            I++L +I+LKRV+FA+D+F  +P QQ+PSRKPK+G+++VP DMIS+ P IS GITTT+  
Sbjct: 263  IKELTEINLKRVTFAVDEFGMDPPQQIPSRKPKLGNVLVPNDMISDIPSISQGITTTAQP 322

Query: 283  ----DNKASSAPKRKYSKDSQEYKMVLENYKRLQKESERQQLEAHRVAERIANEVTGYRI 338
                +++  + P   Y+KDS+EY++ LEN+K+  KESE+ Q EAH  A+RIA+EV G+++
Sbjct: 323  SSHGNDQHGALPASAYTKDSKEYQLALENHKKCLKESEKHQQEAHYAAQRIASEVAGFKL 382

Query: 339  RSGSLFEAAHNAVVNKVLSPSSPTEASVIDSDPTVALDSRVAELTIDKPIHAHETFF--- 395
            +  +  +   +A  N  +  S        +++  V  D ++  L IDKPIH HE  F   
Sbjct: 383  KPSTSTDLKPSA--NGTVPKSGAATDDEANAEAGVVADEKIKSLEIDKPIHMHEHHFKES 440

Query: 396  ---------ETEGYDSSTSQVNSNPDLHQHHHELPLDVVYTRCCHLREILPIPSTLRQVK 446
                     E     SSTS         ++ +EL LDVVYTRCCHLREILPIPSTLRQ+K
Sbjct: 441  SGSSNGTGSEHGANPSSTSGTQD-----ENGNELMLDVVYTRCCHLREILPIPSTLRQLK 495

Query: 447  GKTAPLQTLKFLNPKPTLIDILSFCDFISITPIQVVVFDNVALNSDMIQIVLSSLINSKS 506
             K APLQTLKFLNP+PTLIDILSF DFI+I PI  VVFDNV L+ +M +IV+SSL+ S +
Sbjct: 496  EKKAPLQTLKFLNPRPTLIDILSFSDFIAIVPIHNVVFDNVGLSPEMFKIVISSLVKSIT 555

Query: 507  IEKLGIRNVVLSSKDWEMLCKFLLVNKSIIRLDLSQTKIKPDLPAECYRHNMNWKLFCNV 566
            +E+L +RNVV   + W++LCKFL+ NKS+ +LD+SQTKI+ DL  + +R  M+W LF +V
Sbjct: 556  LERLSMRNVVFDERGWKLLCKFLMRNKSLTKLDISQTKIRHDLDLKLHRSQMDWSLFIDV 615

Query: 567  LRERTGRPLEELLLNGVHFDEMSFDDYQDLLLTFAS-KNSSPNKR-LGMAAASF-SEKCM 623
            L +R G+PLEELLLNGV F   +   +++++  F+S KN    KR LG+A +   S + +
Sbjct: 616  LHKRQGKPLEELLLNGVSFAN-NLHTFENMINAFSSTKNEFSRKRKLGLAQSQIASSEQL 674

Query: 624  SFLFDVISQFSVQGVDLGFNELEPYIHIIIDKLSTLPYNNLEYFTLNSSSFSCTQNIGSL 683
              LF  +S+  + GVDL FN+ E     II +LS   +++L+YFTLNS++    Q    +
Sbjct: 675  EILFRWMSENDIIGVDLAFNDFENLTKPIIKELSQRSFDSLQYFTLNSTNIQSVQEAALI 734

Query: 684  LKYLSRLPNLRFLDMSNIPEMFPSVFAYLYKYLPLFPSLQRIHFDSNCLTYKQCIMLCEI 743
            ++ LS+LP L FLD+S +P +FP++F YL KYLP FPSL+R+HFDSN  TYK   ++ +I
Sbjct: 735  IRELSKLPKLYFLDLSGLPSLFPAIFPYLNKYLPRFPSLKRLHFDSNEWTYKDISLVTQI 794

Query: 744  LQKCPKLAHVSMKNELTYPEAIKDQEKEDGSDDKSTKEFAARTLGATLYGFCRDRSTLLG 803
            L KC +L HVSM N+                     +E  A +    LY   ++   L+ 
Sbjct: 795  LPKCKELLHVSMMNQ--------------------PQESWAMSAAVFLYDCIKNSDKLIN 834

Query: 804  LDVDYGDISDEIQSRIAVTLMINMKKTIDSNFSQDEVTSQDDLLFDGKVISENAEGILHR 863
            LD +Y +I +EI SRIA+ L+ N +K+IDSN+  DE++SQDDLLFDG++ISE A  IL +
Sbjct: 835  LDFNYENIPEEINSRIAIALVRNAQKSIDSNWQLDELSSQDDLLFDGELISETAGNILDK 894

Query: 864  LTSNLGDQSDPTKMYLLKKFVEKIESLHYEVQKKIDIMFEKRETGTLPXXXXXXXXXXXX 923
            L  +   Q D TK YLLK++ EKI ++H  VQK ID MFE+R +  L             
Sbjct: 895  LNDSAKLQEDSTKRYLLKRYWEKIHTIHANVQKTIDSMFEQRISKELSLQSKENLLRLIF 954

Query: 924  XXXXXXXIMQLFASTSSMKIMETPEAELIGKXXXXXXXXXXXXEKNNSTNTSHIRPFLKH 983
                   I++  ++   ++ +                      + +++ ++S  RP LKH
Sbjct: 955  MENTLGNILEYLSTNPYIQELN-----------------YAKNKDDDNYSSSDERPVLKH 997

Query: 984  LDSDRIFGFASHHSPKSPDVDA---------SQIPHSMATESGKVVDATTGXXXXXXXXX 1034
            +DS+RI        P   D+D          S  PH MAT+SG+ +D TTG         
Sbjct: 998  VDSERIMYAKPLVDPIDQDIDQELEHEQDSNSAKPHLMATDSGRTIDVTTGRPILTKTSS 1057

Query: 1035 XXXXXXXXQEHEEGEFHKWGFFVHQKGTTNPD---------------------------- 1066
                    QE EEGE HKWGFFV Q+ +  P+                            
Sbjct: 1058 QRSIFGKKQEEEEGELHKWGFFVQQQRSIYPENTPMSKYQQQQQHKHAQRKEPQLSQIVE 1117

Query: 1067 -------TDDKKSGPEKTPNVSENTNAPERV--------TVPKIQTVPSGNELREAIIKA 1111
                   T  K   P  TP  S    +   +        +   I  +PSG ELREAIIKA
Sbjct: 1118 KPREQVQTSQKTGQPAATPTASTPPTSSNSIPALSKSAASAKLIGKIPSGTELREAIIKA 1177

Query: 1112 KGIDSIEDLIKKVSKDDHGLKKIYGESLKP 1141
            KGI+SIEDLI  V+     L  IYG  ++P
Sbjct: 1178 KGINSIEDLIDNVNCQQVKLDNIYGIQVEP 1207

>ACR113W [1160] [Homologous to ScYOR227W - SH; ScYPL137C - SH]
            complement(550378..553686) [3309 bp, 1102 aa]
          Length = 1102

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/965 (39%), Positives = 542/965 (56%), Gaps = 107/965 (11%)

Query: 224  SIEKLNKIDLKRVSFALDKFHHEPAQQLPSRKPKMGDIVVPEDMISEEPKISVGITTTSD 283
            S++ L+ + L+RV+FA+DKF  +P QQ+PSR+P+ G++++P++++ E P IS GI+    
Sbjct: 204  SLQLLSGVQLRRVAFAVDKFSTDPPQQIPSRRPRRGNVLIPDEILGEVPTISQGISNPEG 263

Query: 284  NKASSAPKRKYSKDSQEYKMVLENYKRLQKESERQQLEAHRVAERIANEVTGYRIRSGSL 343
                   + + +KDS+EYK+ LENY++  KES++ Q EAH  A R ANEV  ++      
Sbjct: 264  --ICGQKESQLTKDSKEYKIALENYRKALKESKKHQQEAHMAALRTANEVAAFK------ 315

Query: 344  FEAAHNAVVNKVLSPSSPTEASVIDSDPTVALDSRVAELTIDKPIHAHETFFETEGYDSS 403
            ++ +H             ++  ++   P  A+D R   L IDKP  A+ET F+ E  +  
Sbjct: 316  YKQSH-------------SQRELV---PEAAVDDRAKHLEIDKPTQANETSFDGEDTECG 359

Query: 404  TSQVNSNPDLHQHHHELPLDVVYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPKPT 463
                       +   EL LD +YTRCCHLREILPIPSTL+QVK KTAPL TLKFLNPKPT
Sbjct: 360  ----------DESGKELTLDQIYTRCCHLREILPIPSTLKQVKNKTAPLHTLKFLNPKPT 409

Query: 464  LIDILSFCDFISITPIQVVVFDNVALNSDMIQIVLSSLINSKSIEKLGIRNVVLSSKDWE 523
            LID+LSFCDFI++ PI  VVFDNV L  +M +I+++SL+NS ++E+L IRNVV  +  W 
Sbjct: 410  LIDLLSFCDFIAVVPIHNVVFDNVNLTPEMFKIMITSLVNSTALERLSIRNVVTDADCWA 469

Query: 524  MLCKFLLVNKSIIRLDLSQTKIKPDLPAECYRHNMNWKLFCNVLRERTGRPLEELLLNGV 583
             LCKF+L N+S+I+LD+SQTK++ DL    YR NMNW LF  VL+ R   PLEELLLNG+
Sbjct: 470  ALCKFILSNRSLIKLDISQTKVRQDLARTLYRSNMNWPLFIEVLQRRQHAPLEELLLNGI 529

Query: 584  HFDEMSFDDYQDLLLTFASKNSSPNKRLGMAAASFSEKCMSFLFDVISQFSVQGVDLGFN 643
             F ++S   +  LL  F  + +S  KRLG+A +   E+ +  LFD  S ++VQG+DL FN
Sbjct: 530  QFFDLSI--FNGLLHAFTLRPAS-KKRLGVAHSFLKEEHLKLLFDWASTYNVQGIDLAFN 586

Query: 644  ELEPYIHIIIDKLSTLPYNNLEYFTLNSSSFS-CTQNIGSLLKYLSRLPNLRFLDMSNIP 702
             L   +  ++ KL+T+ +++L YFTLNS++   C   +   L+ LS+LPNL FLD+S++P
Sbjct: 587  NLTDLVKPMVSKLTTMNFDHLHYFTLNSTALGFCDAAL--CLRALSKLPNLYFLDLSSLP 644

Query: 703  EMFPSVFAYLYKYLPLFPSLQRIHFDSNCLTYKQCIMLCEILQKCPKLAHVSMKNELTYP 762
             +FP +F +L KYLP FP L+R+H DSN        +L +ILQKC +L H+SM   L  P
Sbjct: 645  AIFPEIFPFLNKYLPRFPFLKRLHLDSNDFMMDHISLLSQILQKCKELLHLSM---LYQP 701

Query: 763  EAIKDQEKEDGSDDKSTKEFAARTLGATLYGFCRDRSTLLGLDVDYGDISDEIQSRIAVT 822
            E              S+   +A    A LY F  +   L  LDVDY  I +EI SRIAV 
Sbjct: 702  E--------------SSYGMSA---CAALYDFVANSPKLKNLDVDYEYIPEEISSRIAVC 744

Query: 823  LMINMKKTIDSNFSQDEVTSQDDLLFDGKVISENAEGILHRL-TSNLGDQSDPTKMYLLK 881
            L+ N +K+++ +F  DE+TSQDDLLFDG++I++ A GIL +L TS+     D ++ YLLK
Sbjct: 745  LIRNAQKSLNEDFELDELTSQDDLLFDGELITKTAGGILSKLGTSSEKSNDDSSRRYLLK 804

Query: 882  KFVEKIESLHYEVQKKIDIMFEKRETGTLPXXXXXXXXXXXXXXXXXXXIMQLFASTSSM 941
            K+ +KI  +H  VQ  ID +FEKR    L                    I+++ A +  +
Sbjct: 805  KYWQKINRVHTNVQSTIDDLFEKRSKDELTLQGKENLLRLLFVENTLSKILEILADSQEV 864

Query: 942  KIMETPEAELIGKXXXXXXXXXXXXEKNNSTNTSHIRPFLKHLDSDRIFGFASHHSPKSP 1001
              +     E I                          P L+ +DS  +   A+       
Sbjct: 865  ASLLDDNPEGISA------------------------PNLEAVDSSTLLMPATRLEDGYL 900

Query: 1002 DVD----ASQI--PHSMATESGKVVDATTGXXXXXXXXXXXXXXXXXQEHEEGEFHKWGF 1055
            D      ++Q+  PH MAT+SG+ +D TTG                 QE EEGE HKWG+
Sbjct: 901  DTQGISASTQVDRPHFMATDSGRTIDVTTGRPVVLRQSSQTSIVCKKQEEEEGELHKWGY 960

Query: 1056 FVHQKGTTNPDTDDKKSGPEKTPNVSENTNAPERVTVPKIQTVPSGNELREAIIKAKGID 1115
            FV QK +  P        P ++     +     RV + KI   PSG EL+ AIIKAKGI 
Sbjct: 961  FVAQKRSGLPLPQYVSEHPAQSQPSQADNATDMRVIISKI---PSGAELKAAIIKAKGIA 1017

Query: 1116 SIEDLIKKVSKDDHGLKKIYGESLKPFPILGAQDVDYTSRNASEGNTEASGRSTSTDSKT 1175
            S+EDLI  V+ +   L  IYG             + Y++R  S      S +S S  +  
Sbjct: 1018 SMEDLIDNVNHNRVHLDNIYG-------------IPYSTRPVSADRASVSSQSRSVCTPN 1064

Query: 1176 DELVT 1180
            +E V+
Sbjct: 1065 EEPVS 1069

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 52/124 (41%), Gaps = 27/124 (21%)

Query: 12  DVQIEWLYKGKKR-KLPKAGSVDPMRSDPMDGNRLGRRATISVRETMPEGVARRRPRSSS 70
           DV + WLY+GKKR K  KAG          DG R GR +++S  E        R+  S  
Sbjct: 24  DVDVAWLYRGKKRGKQRKAGE---------DGTR-GRASSVSNAEL------SRQADSGQ 67

Query: 71  ISNGDLS-NDKSAQREA--PATDYSRRX-------XXXXXXXXXXXXIFGSLFGKKSDST 120
              G  S +++SAQ  A  PA    R+                    +FGSLF ++  S+
Sbjct: 68  AGTGSASGSERSAQSAATEPAAVPERQSGGIGFLKRSNSVGERPKKSLFGSLFSRRLASS 127

Query: 121 DKKP 124
              P
Sbjct: 128 SGVP 131

>Scas_690.33
          Length = 1423

 Score =  249 bits (636), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 212/729 (29%), Positives = 352/729 (48%), Gaps = 91/729 (12%)

Query: 233  LKRVSFALDKFHHEPAQQLPSRKPKMGDI-------VVPEDMISEEPK-----ISVGITT 280
            LK VSF+ + + ++P QQ+ S+ P+ G++       V+   +  +E K      S GI  
Sbjct: 455  LKHVSFSTNTYFNDPPQQICSKNPRKGEVEVKSNGSVIIHRLTPQERKKILESTSCGIVV 514

Query: 281  TSDNK----ASSAPKRKYSKDSQEYKMVLENYKRLQKESERQQLEAHRVAERIANE---V 333
                +    ++   +   +  S+     L +  +   E+     EA  + +  A E   V
Sbjct: 515  GGSGQLKLLSTLQEQSAATPGSENINQKLLDEGKKPNETLIVDKEAAEMDDEQAEEDGNV 574

Query: 334  TGYRIRSGSLFEAAHNAVVNKVLSPSSPTEASVIDSDPTVALDSRVAELTIDKPIHAHE- 392
               + RS  L  A   A      +P+   + ++ +++  V ++   + LTIDKP+ +   
Sbjct: 575  NDSKKRSLVLAAAEAAAEARAQDAPNE-LKRTMTNNEEEVTVNKLASHLTIDKPMISRRS 633

Query: 393  -TFFETEGYDSSTSQVNSNPDLHQHHHELPLDVVYTRCCHLREILPIPSTLRQVK-GKTA 450
             T    E   S  S  +        + ++P DVVYTRCCHLREILPIP+TL+Q+K G T 
Sbjct: 634  GTSLSLESMTSQDSVESDATVFPSPNLKIPYDVVYTRCCHLREILPIPATLKQLKPGSTD 693

Query: 451  PLQTLKFLNPKPTLIDILSFCDFISITPIQVVVFDNVALNSDMIQIVLSSLINSKSIEKL 510
            P+  L+  NP+P++++I SF DF+SI P+  +  D V+L  DM++++L+SL   +++EK+
Sbjct: 694  PIPLLQLRNPRPSMVEIWSFSDFLSIAPVSCLSLDGVSLTVDMLKVLLASLSAKRNLEKI 753

Query: 511  GIRNVVLSSKDWEMLCKFLLVNKSIIRLDL-------------SQTKIKPD-LPAEC--- 553
             +RN  L  + W++LC F+  ++S++ +DL             S++ +K + +  EC   
Sbjct: 754  SLRNTPLDDEGWKLLCYFISKSRSLVSIDLTMVPHIKTNVQKPSKSSLKSNIIRMECDLD 813

Query: 554  YRHNMNWKLFCNVLRERTGRPLEELLLNGVHFDEMSFDDYQDLLLTFASKNSSPNKRLGM 613
             R   NW L    +  + G  LEEL+++GV   +MS + +++    F        +RLG+
Sbjct: 814  NRTKRNWNLLAGSIAMKGG--LEELVVSGV---KMSLNHFKN----FIEVACISTERLGL 864

Query: 614  AAASFSEKCMSFLFDVISQFSVQGVDLGFNELEPYIHIIIDKL-----STLPYNNLEYFT 668
            A  + S++    L   + +  V G+DLGFN+L   +    D +     S    N  +Y +
Sbjct: 865  AYNNLSKEQCDILAKWLVKSKVTGLDLGFNDLRGKLTTFSDAVWQKIQSNEVKNVFKYLS 924

Query: 669  LNSSSF-------SCTQNIGSLLKYLSRLPNLRFLDMSNIPEMFPSVFAYLYKYLPLFPS 721
            LN +S        S T  +  LL  L    +L+FLD+SN P+ FP     L K LP+F +
Sbjct: 925  LNDTSLEVEEGATSETNEVLRLLSILCYSEDLKFLDLSNNPKCFPHCLDTLVKCLPVFVN 984

Query: 722  LQRIHFDSNCLTYKQCIMLCEILQKCPKLAHVSMKNELTYPEAIKDQEKEDGSDDKSTKE 781
            L RIH D+  LT    IML E L  C +L H SM   L  P            D  S K 
Sbjct: 985  LVRIHLDNEQLTSTNIIMLAEALPLCSRLIHFSM---LGTP-----------LDLASCKA 1030

Query: 782  FAARTLGATLYGFCRDRSTLLGLDVDYGDISDEIQSRIAVTLMINMKKTIDSNFSQDEVT 841
             A          F R  ++LL LDV+Y  + D I+ +I +  M NM+  +    S++E  
Sbjct: 1031 LAE--------AF-RRSTSLLTLDVNYVYMPDNIKEKITMYSMRNMQNELRKVNSENEA- 1080

Query: 842  SQDDLLFDGKVISENAEGILHRLTSNLGDQSDPTKMYLLKKFVEKIESLHYEVQKKIDIM 901
              D    DG  +S   + +   LT N   ++D TK   +  F+ +IE +  ++ + ++ +
Sbjct: 1081 --DGKATDGFHLSNLQQELSELLTENY--EADSTKNADI--FITRIEQIRSKISRVVEDL 1134

Query: 902  FEKRETGTL 910
            F  +  G L
Sbjct: 1135 FNLKVQGQL 1143

>Kwal_23.5488
          Length = 1112

 Score =  246 bits (627), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 186/642 (28%), Positives = 323/642 (50%), Gaps = 95/642 (14%)

Query: 233 LKRVSFALDKFHHEPAQQLPSRKPKMGDIVVPED-------MISEEPKISVGITTTSDNK 285
            ++VSFA + + ++P QQ+ S+ P+ G++ V  D       +  EE +  +  T+T    
Sbjct: 389 FRKVSFATNTYFNDPPQQICSKNPRRGEVEVKPDGSVIIHRLTPEEKREILQKTSTGIVV 448

Query: 286 ASSAPKRKYSKDSQEYKMVLENYKRLQKESERQQLEAHRVAERIANEVTGYRIRSGSLFE 345
             S   +  S  +        + + ++++ E++ + A++ AE+      G      +  +
Sbjct: 449 GGSGHLKLLSDPTL-------SEEEVKRKEEKKPVNANKCAEQ-----DGTMTDPSASEK 496

Query: 346 AAHNAVVN---KVLSPSSPTEASVIDSDPTVALDSRVAELTIDKPIHAHETF--FETEGY 400
           AA  A  +   +V  PS   E  VI       +    +E+ IDKP+ +  +     T   
Sbjct: 497 AAQKAAESTSEQVNQPSGDNEEEVI-------ISKSASEVKIDKPMISRRSASSLSTMIP 549

Query: 401 DSSTSQVNSNPDLHQHHHELPLDVVYTRCCHLREILPIPSTLRQVK-GKTAPLQTLKFLN 459
            +   + + +        ++P D+VYTRCCHLREILPIP+TL+Q+K G T P+  L+  N
Sbjct: 550 AADPEEDDDDNIFPPPGMKIPHDLVYTRCCHLREILPIPATLKQLKKGSTDPIPLLQMRN 609

Query: 460 PKPTLIDILSFCDFISITPIQVVVFDNVALNSDMIQIVLSSLINSKSIEKLGIRNVVLSS 519
           PKP+LI++LSF DF+ ITP+  +  D V L++ M++I+L SL+N K  EKL +RN  L  
Sbjct: 610 PKPSLIEVLSFSDFLGITPVLCLSLDGVNLSAGMLRIILCSLMNKKQFEKLSLRNTPLDH 669

Query: 520 KDWEMLCKFLLVNKSIIRLDLSQT---KIKPDLPAE-----------CY---RHNMNWKL 562
           + W++LC F+   KS+  +DL+      I    P++           C    R  MNW L
Sbjct: 670 EGWKILCYFISQCKSLNSIDLTMVPGISINVQKPSKSSQRSRVVRMTCSMTDRKEMNWNL 729

Query: 563 FCNVLRERTGRPLEELLLNGVHFDEMSFDDYQDLLLTFASKNSSPNKRLGMAAASFSEKC 622
               L    G  LEE++++G    +MS  +++D L    +K      RLG+A    + + 
Sbjct: 730 LVASLISVEG--LEEIIISGA---KMSLKEFKDFLQLGCTK----TLRLGLAYNELTTEQ 780

Query: 623 MSFLFDVISQFSVQGVDLGFNELE----PYIHIIIDKLSTLPYNNLEYFTLNSSSFSCTQ 678
            + L   ++  +V G+D+GFN+L      +   IID+  +   N  +YF+L+S++   ++
Sbjct: 781 CNVLAGWLAHSNVTGIDIGFNDLRGKLGAFASGIIDRTKS-SRNVFKYFSLSSTNLEVSE 839

Query: 679 -------NIGSLLKYLSRLPNLRFLDMSNIPEMFPSVFAYLYKYLPLFPSLQRIHFDSNC 731
                  +   L+  L    +L+ LD+SN P++FP V ++L  Y+P+F +L R+H D+N 
Sbjct: 840 DSTPENDDFLKLISVLCYCEDLKLLDISNNPKLFPYVTSHLTNYMPVFVNLLRLHMDNNN 899

Query: 732 LTYKQCIMLCEILQKCPKLAHVSMKN-ELTYPEAIKDQEKEDGSDDKSTKEFAARTLGAT 790
           +     + L E+L  C KL+HVSM+  +L Y                          G  
Sbjct: 900 IPAPSVVALAEVLPMCQKLSHVSMRGTKLDY------------------------ATGCA 935

Query: 791 LYGFCRDRSTLLGLDVDYGDISDEIQSRIAVTLMINMKKTID 832
           L    R  S+LL +D+D  ++ ++I+ ++++  M NM+KT++
Sbjct: 936 LAAAMRQSSSLLTIDLDAENLPNKIKDKMSLYSMKNMEKTLN 977

>CAGL0J00803g complement(83483..87427) similar to sp|P43638
            Saccharomyces cerevisiae YJL042w MHP1, hypothetical start
          Length = 1314

 Score =  232 bits (591), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 161/532 (30%), Positives = 270/532 (50%), Gaps = 79/532 (14%)

Query: 419  ELPLDVVYTRCCHLREILPIPSTLRQVK-GKTAPLQTLKFLNPKPTLIDILSFCDFISIT 477
            ++P DVVYTRCCHLREILPIP+TL+Q+K G T P+  L+  NP+P+L++I SF DF+SI+
Sbjct: 506  KIPHDVVYTRCCHLREILPIPATLKQIKKGSTDPIPLLQLRNPRPSLLEIWSFSDFLSIS 565

Query: 478  PIQVVVFDNVALNSDMIQIVLSSLINSKSIEKLGIRNVVLSSKDWEMLCKFLLVN-KSII 536
            P+  V  D V+L  +M++I+LSSL+++  +EKL +RN  L+   W++L  F+    K+ +
Sbjct: 566  PVLCVSLDGVSLTEEMLRIILSSLVSNPHLEKLTMRNTPLNEDGWKILSYFITKQKKNFV 625

Query: 537  RLDLS-----QTKIK-------------PDL--PAECYRHN---MNWKLFCNVLRERTGR 573
             LDL+     +T ++             P+L    EC  HN   MNW L    +  + G 
Sbjct: 626  ALDLTMVPTIKTNVQKPSKSSLAKNANNPNLLKRMECNTHNRSDMNWDLLTAAVATKEGG 685

Query: 574  PLEELLLNGVHFDEMSFDDYQDLLLTFASKNSSPNKRLGMAAASFSEKCMSFLFDVISQF 633
             +EE +L G       F ++ +L  T          RLG+A    + +    L + I   
Sbjct: 686  -IEEFVLAGACMSYTQFKNFIELACTNTD-------RLGLAYNKLTMEQCKVLAEWIVTS 737

Query: 634  SVQGVDLGFNELEPYIHIIIDKLSTL-----PYNNLEYFTLNSSSFSC-------TQNIG 681
            +++G+DLGFN+L+    +  D ++         N ++Y +LNS++ S           + 
Sbjct: 738  NIRGLDLGFNDLKGKTSVFTDAVANKVQNVGEKNEMKYISLNSTNLSVEADTTPENNEVL 797

Query: 682  SLLKYLSRLPNLRFLDMSNIPEMFPSVFAYLYKYLPLFPSLQRIHFDSNCLTYKQCIMLC 741
             LL  L    NL+FLD+SN P++FP     L   LP++ +L R+H D N L     ++L 
Sbjct: 798  RLLSVLCYSENLKFLDLSNNPKIFPHCIKTLTTSLPVYVNLIRLHLDYNDLDCASIVVLA 857

Query: 742  EILQKCPKLAHVSMKNELTYPEAIKDQEKEDGSDDKSTKEFAARTLGATLYGFCRDRSTL 801
            E L  C KL H+S+              K + +  K+  E   ++            +TL
Sbjct: 858  ESLPLCSKLHHLSLLG-----------SKLNLASAKALTEAVNKS------------NTL 894

Query: 802  LGLDVDYGDISDEIQSRIAVTLMINMKKTID--------SNFSQDEVTSQDDLLFDGKVI 853
            + LD++Y  + + I+ R+++  M N++  +D        +  S   V  Q+++  + K I
Sbjct: 895  MTLDLEYNTVPESIKERMSLYTMRNIQNELDNVQKTKRKAGLSLPSV-PQEEMAANEKQI 953

Query: 854  SENAEGILHRLTSNLGDQSDPTKMYLLKKFVEKIESLHYEVQKKIDIMFEKR 905
            S   E +   LT    D  +  K+ +  +F+EKI  +  +++K +  +F+ R
Sbjct: 954  STLQEELSSLLTDKFEDSLEYDKLVV--EFIEKITKVRTKIEKVVSDLFDLR 1003

>YJL042W (MHP1) [2870] chr10 (361165..365361) Microtubule-interacting
            protein, functions in stabilization of microtubules [4197
            bp, 1398 aa]
          Length = 1398

 Score =  231 bits (588), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 202/727 (27%), Positives = 345/727 (47%), Gaps = 106/727 (14%)

Query: 233  LKRVSFALDKFHHEPAQQLPSRKPKMGDIVVPEDMISEEPKISVGITTTSDNKASSAPKR 292
            LK VSFA + + ++P QQ+ S+ P+ G++ V       +P  SV I   +  +      R
Sbjct: 446  LKHVSFATNTYFNDPPQQICSKNPRKGEVEV-------KPNGSVVIHRLTPQE------R 492

Query: 293  KYSKDSQEYKMVLENYKRLQ----KESERQQLEAHRVAERIANEVTGY------RIRSGS 342
            K   +S    +V+    +L+    +E +        +A +  NEV  +        R   
Sbjct: 493  KKIMESTSLGVVVGGTGQLKLLNPEEDDANAKSKEEMAPQKQNEVEAHDEEDNNSQRRNI 552

Query: 343  LFEAAHNAVVNKVLSPSSPTEASVIDSDPTVALDSRVAELTIDKPI---HAHETFFETEG 399
            +  AA  A   +     +  +  V +++  V +    + LTIDKP+       T      
Sbjct: 553  VMAAAEAAAEARAKEAPNELKRIVTNNEEEVTVSKTASHLTIDKPMISRRGASTSSLASM 612

Query: 400  YDSSTSQVNSNPD---LHQHHHELPLDVVYTRCCHLREILPIPSTLRQVK-GKTAPLQTL 455
              S T+  N++ +   L     ++P D+VYTRCCHLREILPIP+TL+Q+K G T P+  L
Sbjct: 613  VSSDTNGTNADDEGEILPPPSLKIPHDIVYTRCCHLREILPIPATLKQLKKGSTDPIPIL 672

Query: 456  KFLNPKPTLIDILSFCDFISITPIQVVVFDNVALNSDMIQIVLSSLINSKSIEKLGIRNV 515
            +  NP+P++++I SF DF+SI P+  +  D V L   M++I+LSSL+  +  +KL +RN 
Sbjct: 673  QLRNPRPSMVEIWSFSDFLSIAPVLCLSLDGVQLTVQMLRIILSSLVYKQHFQKLSLRNT 732

Query: 516  VLSSKDWEMLCKFLLVNKSIIRLDLSQT-KIKPD-------------LPAEC---YRHNM 558
             L  + W++LC F+   KS+  +DL+    IK +             L  +C    R +M
Sbjct: 733  PLDEEGWKVLCYFVSKAKSLHSIDLTMVPSIKTNVQKPSKSSLKSKILRMQCNLENRSDM 792

Query: 559  NWKLFCNVLRERTGRPLEELLLNGVHFDEMSFDDYQDLLLTFASKNSSPNKRLGMAAASF 618
            NW L    +    G  LEE++++G   +   F ++  L+   A+      +RLG+A    
Sbjct: 793  NWDLLTASIALMGG--LEEIVISGAKMNSAQFKNFI-LVACIAT------ERLGLAYNGL 843

Query: 619  SEKCMSFLFDVISQFSVQGVDLGFNELE----PYIHIIIDKLSTLPYNNL-EYFTLNSSS 673
            S+     L   + Q  V G+D+GFN+L      +   ++ K+      N+ ++ +LN ++
Sbjct: 844  SKSQCDDLAKWMVQSKVTGLDVGFNDLNGKLSSFTDAVLGKIQKANEKNVFKFLSLNGTN 903

Query: 674  FSCTQN-------IGSLLKYLSRLPNLRFLDMSNIPEMFPSVFAYLYKYLPLFPSLQRIH 726
                ++       +  L+  L  L NL+FLD+SN P +FP     L  +LP+F +L R+H
Sbjct: 904  LRVNEHDTFENNEVLKLISVLCYLENLKFLDISNNPAIFPHCVPTLIDFLPVFVNLVRLH 963

Query: 727  FDSNCLTYKQCIMLCEILQKCPKLAHVSM-KNELTYPEAIKDQEKEDGSDDKSTKEFAAR 785
             D N L+    +ML EIL  C +L + SM   EL               D  S+K  A  
Sbjct: 964  IDYNNLSSTSVVMLAEILPMCSRLNYFSMLGTEL---------------DLASSKALAEA 1008

Query: 786  TLGATLYGFCRDRSTLLGLDVDYGDISDEIQSRIAVTLMINMKKTIDSNFSQDEVTSQDD 845
                      R  S+L+ LDVDY  + + I+ +I++  + N++  +        V S D 
Sbjct: 1009 V---------RKSSSLMTLDVDYVYMPENIKEKISLYALRNIQGEL------KRVNSDDK 1053

Query: 846  LLFDGKVISENAEGILHRLTSNLGDQSDPTKMY--LLKKFVEKIESLHYEVQKKIDIMFE 903
             + D +  S   +     L+  L +++D ++ Y  +++ F+ KI     ++ K +  +F+
Sbjct: 1054 DIKDSQFSSLQDQ-----LSLLLTEKADNSEHYNKMVENFMAKIALARIKISKVVHDLFD 1108

Query: 904  KRETGTL 910
             +  G L
Sbjct: 1109 LKLNGQL 1115

>KLLA0E11847g complement(1044591..1048385) some similarities with
            sp|P43638 Saccharomyces cerevisiae YJL042w MHP1
            microtubule-associated protein, hypothetical start
          Length = 1264

 Score =  229 bits (583), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 194/737 (26%), Positives = 338/737 (45%), Gaps = 134/737 (18%)

Query: 233  LKRVSFALDKFHHEPAQQLPSRKPKM--------GDIVV----PEDM--ISEEPKISVGI 278
            LKRV+FA + + ++P QQ+ SR P+         G +V+    PE+   I E+    + +
Sbjct: 435  LKRVAFAANTYFNDPPQQICSRNPRKGEVEVKADGSVVIHRLTPEEKREILEKSSCGIVV 494

Query: 279  TTTSDNKASSAPKRKYSKDSQEYKMVLENYKRLQKESERQQLEAHRVAERIANEVTGYRI 338
              T   K  +      S D  E   +     +L  E +      H               
Sbjct: 495  GGTGQLKLINQDAPATSPDQNEGAAL-----KLHAEDDHASQRRH--------------- 534

Query: 339  RSGSLFEAAHNAVVNKVLSPSSPT--EASVIDSDPTVALDSRVAELTIDKPIHAHETFFE 396
                  E A      +  +  +P   + +V +++  V +++ + ++TIDKP+ +      
Sbjct: 535  -----IELAAAEAAAEARAKDAPLDLQRTVTNNEEEVGVNNTLEKVTIDKPMTSRRKGSS 589

Query: 397  TE--GYDSSTSQV----NSNPDLHQHHHELPLDVVYTRCCHLREILPIPSTLRQVK-GKT 449
            T      SS S +    + N  L   + ++P DVVYTRCCHLREILPIP+T++Q+K G T
Sbjct: 590  TSLASMISSDSALVPSEDENELLPPRNIKIPHDVVYTRCCHLREILPIPATMKQLKKGST 649

Query: 450  APLQTLKFLNPKPTLIDILSFCDFISITPIQVVVFDNVALNSDMIQIVLSSLINSKSIEK 509
             P+  L+  NPKP+ +++LSF DF+SI P+  +  D V+L+ +M++I+LSS+      EK
Sbjct: 650  EPIPFLQLRNPKPSKVEVLSFSDFLSIAPVLCLSLDGVSLSVEMLRIILSSITYKDKFEK 709

Query: 510  LGIRNVVLSSKDWEMLCKFLLVNKSIIRLD------LSQTKIKPDLPAE--------C-- 553
            L +RN  +    W++L  F+   KS+  LD      L+    KP   +         C  
Sbjct: 710  LSLRNTPVDHDGWKVLSYFVSKCKSLNSLDVTMIPGLALNVQKPSKSSNGSTVPRMVCNM 769

Query: 554  -YRHNMNWKLFCNVLRERTGRPLEELLLNGVHFDEMSFDDYQDLLLTFASKNSSPNKRLG 612
              R +MNW L    +  + G  LEE++++G   +++   ++ D+  T          RLG
Sbjct: 770  ENRSDMNWSLLSAAVAAKGG--LEEMIVSGAFMNQVQLQNFIDIAWT-------KTLRLG 820

Query: 613  MAAASFSEKCMSFLFDVISQFSVQGVDLGFNELE----PYIHIIIDKLSTLPYNNLEYFT 668
            +A  + + +    L   ++   +QGVD+G+N+L     P+I  +I+K +    N  ++ +
Sbjct: 821  LAYNNLTLEQCQCLATWMTNSKIQGVDVGYNDLNGKLGPFISAVIEK-TKKGKNVFKFLS 879

Query: 669  LNSSSFSCTQN-------IGSLLKYLSRLPNLRFLDMSNIPEMFPSVFAYLYKYLPLFPS 721
            LNS++ S  +        + SLL  L    +L+FLD+SN P +FP     L   LP+F S
Sbjct: 880  LNSTNLSVPKGAKSEDNEVLSLLNGLCYCDSLKFLDLSNNPGLFPYGMRTLTAILPVFVS 939

Query: 722  LQRIHFDSNCLTYKQCIMLCEILQKCPKLAHVSMKNELTYPEAIKDQEKEDGSDDKSTKE 781
            L R+H D+N L+    +   E+L  C ++ ++S+                          
Sbjct: 940  LLRLHLDNNNLSTTAVMQFAEVLPMCQRINYISL-------------------------- 973

Query: 782  FAARTLGATL--------YGFCRDRSTLLGLDVDYGDISDEIQSRIAVTLMINMKKTIDS 833
                 LG  L            ++  T++ +D+DY  + D I+ +I+V  M N ++ ++ 
Sbjct: 974  -----LGTNLNIISASALAAAVKNSKTIITMDIDYAHVPDRIKEKISVYSMRNTQRELE- 1027

Query: 834  NFSQDEVTSQDDLLFDGKVISENAEGILHRLTSNLGDQSDPTKMYLLKKFVEKIESLHYE 893
               Q   +  DD     K + E    +L   +S   D        L+  F+E+I+++  +
Sbjct: 1028 ---QINKSGGDDGHEKLKSLQEELGRLLTEDSSTRSDYD-----TLVSNFLERIQTVRAK 1079

Query: 894  VQKKIDIMFEKRETGTL 910
            +   I+ +F+ R  G L
Sbjct: 1080 LHAAIEELFKLRLNGEL 1096

>ACR059W [1107] [Homologous to ScYJL042W (MHP1) - SH]
           complement(459751..463401) [3651 bp, 1216 aa]
          Length = 1216

 Score =  181 bits (458), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 129/444 (29%), Positives = 207/444 (46%), Gaps = 66/444 (14%)

Query: 420 LPLDVVYTRCCHLREILPIPSTLRQVK-GKTAPLQTLKFLNPKPTLIDILSFCDFISITP 478
           +P D++YTRCC+LREILPIP+ L+Q+K G + P+  L+  NPKP++I+ILS  DF+SI P
Sbjct: 472 IPNDMLYTRCCYLREILPIPAMLKQLKPGSSDPIPLLQLRNPKPSMIEILSLGDFLSIAP 531

Query: 479 IQVVVFDNVALNSDMIQIVLSSLINSKSIEKLGIRNVVLSSKDWEMLCKFLLVNKSIIRL 538
           +     D V+L+  M+ I+LSSL     +EKL +RN  L  + W+ L  F+  +K++  L
Sbjct: 532 VLCFSMDGVSLSVQMLHIILSSLRCMGRLEKLSMRNTPLDEEGWKTLAYFISSSKTLRGL 591

Query: 539 DLSQTKIKPDLP----------AEC----------YRHNMNWKLFCNVLRERTGRPLEEL 578
           DL+     P +P           +C           R   NW LF   +       LEEL
Sbjct: 592 DLTMI---PGIPLNVQKPSKSSGQCSIPRMKCDLTSRAEQNWNLFTAAIAINGN--LEEL 646

Query: 579 LLNGVHFDEMSFDDYQDLLLTFASKNSSPNKRLGMAAASFSEKCMSFLFDVISQFSVQGV 638
           +++G       F     +LL     +    +RLG+A    S      L   +    V G+
Sbjct: 647 IISGAKISLGQF----KILLDIGCHSL---ERLGLAFNDLSHGHCEALASWLPGCKVTGL 699

Query: 639 DLGFNELEPYIHIIIDKL---STLPYNNLEYFTLNSSSFSC-------TQNIGSLLKYLS 688
           D+GFN L   +  + + L   S +  N++   +LNS+  +        T ++ +LL  L 
Sbjct: 700 DIGFNPLNGKMRPLAEALMRKSKVGNNSIACISLNSTDLAIPPNATVETSDVVALLSALG 759

Query: 689 RLPNLRFLDMSNIPEMFPSVFAYLYKYLPLFPSLQRIHFDSNCLTYKQCIMLCEILQKCP 748
              NL+FL +SN P MF      L   LP+     R+  D N L+    I L E+L  C 
Sbjct: 760 YCENLKFLPLSNNPNMFIYGMKPLTDILPVLVGFARLQLDYNNLSSTSIITLAEVLPMCT 819

Query: 749 KLAHVSMKNELTYPEAIKDQEKEDGSDDKSTKEFAARTLGATLYGFCRDRSTLLGLDVDY 808
            + ++S+              K D S             GA L    +   +L  +D D+
Sbjct: 820 TIGYLSLVG-----------SKLDTSS------------GAALVLALKKSGSLFTIDADF 856

Query: 809 GDISDEIQSRIAVTLMINMKKTID 832
            ++ D I+  +++  + N++  ++
Sbjct: 857 SEMPDAIRHDVSIYSLKNLENVLE 880

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (67%)

Query: 233 LKRVSFALDKFHHEPAQQLPSRKPKMGDIVVPED 266
           LKRVSFA + + + P QQ+ SR P+ G++ V  D
Sbjct: 335 LKRVSFARNTYFNSPPQQICSRNPRKGEVEVKAD 368

>AEL043W [2463] [Homologous to ScYCR017C (CWH43) - SH]
           complement(553712..556573) [2862 bp, 953 aa]
          Length = 953

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 70/157 (44%), Gaps = 26/157 (16%)

Query: 578 LLLNGVHFDEMSFDDYQDLLLTFASKNSSPNKRLGMAAASFSEKCMSFLFDVISQFSVQG 637
           L++  + FD +S+ D +DL +TF ++ S P+            K  + L       S  G
Sbjct: 188 LIILDILFDGLSYADMEDLTITFGTQGSRPS------VGVLQSKTSTLL-------SSAG 234

Query: 638 VDLGFNELEPYIHIII-----DKLSTLP------YNNLEYFTLNS-SSFSCTQNIGSLLK 685
             LG   +E  +  +I     +KL  LP        +L Y  +++  SF    N+ +LL 
Sbjct: 235 KGLGGGAMEEMLEEVIITQEHEKLVYLPDEPITNQASLFYIVVSTFDSFMFWTNLTALLC 294

Query: 686 YLSRLPNLRFLDMSNIPEMFPSVFAYLYKYLPLFPSL 722
            +   P L ++ +S    +  +V + +  Y+P FP+L
Sbjct: 295 MIWFFP-LWYMGISGYEAVIAAVLSPVLLYVPFFPTL 330

>Kwal_56.24151
          Length = 480

 Score = 34.3 bits (77), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 17/82 (20%), Positives = 43/82 (52%), Gaps = 1/82 (1%)

Query: 512 IRNVVLSSKDWEMLCKFLLVNKSIIRLDLSQTKIKPDLPAECYRHNMNWKLFCNVLRERT 571
           ++++ L+ KD ++ CK+ L N  + RL ++  ++   L  +C   +  +   C + ++  
Sbjct: 383 LQSLFLTRKDNKLCCKYHLDNCQVHRLIIASIRLATKLLEDCVHSHTCFSRICGISKKLL 442

Query: 572 GRPLEELLLNGVHFDEMSFDDY 593
            + LE   LN ++F+ +   ++
Sbjct: 443 TK-LEIAFLNCINFEGLKITNH 463

>Scas_674.26
          Length = 1057

 Score = 34.3 bits (77), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 56/127 (44%), Gaps = 19/127 (14%)

Query: 634 SVQGVDLG--FNELEPYIHIIIDKLSTLPYNNLEYFTLNSSSFSCTQNIGSLLKY-LSRL 690
           ++Q +  G  FN  +  + +++   S + Y            F+C  N+ +   Y LS L
Sbjct: 571 NLQTIHFGHCFNITDQGVRVLVQACSRIQY----------VDFACCTNLTNRTLYELSDL 620

Query: 691 PNLRFLDMSNIPEMFPSVFAYLYKYLPLFPSLQRIH--FDSNCLTYKQCIMLCEILQKCP 748
           P L+ + +    +M       +        SL+R+H  + SN   Y     + E+L  CP
Sbjct: 621 PKLKRIGLVKCSQMTDEGLLNMISLRGRNDSLERVHLSYCSNLTIYP----IYELLMACP 676

Query: 749 KLAHVSM 755
           +L+H+S+
Sbjct: 677 RLSHLSL 683

>CAGL0M09130g 914811..918188 similar to sp|P24814 Saccharomyces
           cerevisiae YJR090c required for glucose repression and
           for glucose and cation transport, start by similarity
          Length = 1125

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 40/85 (47%), Gaps = 7/85 (8%)

Query: 674 FSCTQNIGSLLKY-LSRLPNLRFLDMSNIPEMFPSVFAYLYKYLPLFPSLQRIHFD--SN 730
           F+C  N+ +   Y LS L  L+ + +    +M       +        SL+R+HF   SN
Sbjct: 670 FACCTNLTNHTLYELSYLSRLKRIGLVKCSQMTDDGLLNMIALRGRNDSLERVHFSYCSN 729

Query: 731 CLTYKQCIMLCEILQKCPKLAHVSM 755
              Y     + E+L  CP+L+H+S+
Sbjct: 730 LTIYP----IYELLMACPRLSHLSL 750

>KLLA0A03399g 305616..308153 weakly similar to sp|P39720
           Saccharomyces cerevisiae YAL051w OAF1 peroxisome
           proliferating transcription factor, hypothetical start
          Length = 845

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 33/71 (46%), Gaps = 4/71 (5%)

Query: 576 EELLLNG---VHFDEMSFDDYQDLLLTFASKNSSPNKRLGMAAASFSEKCMSFLFDVISQ 632
           E +LL+    VHFDE  F    D + TF + + SPN R  M    F     S    +I+Q
Sbjct: 765 ENILLSANEFVHFDEAGFRLLLDTVNTFCTNSGSPNNRNTMPEQLFGYTATSSNV-LINQ 823

Query: 633 FSVQGVDLGFN 643
           FSV    L  N
Sbjct: 824 FSVDLAGLSAN 834

>KLLA0E06006g 545879..549598 some similarities with sp|P24814
           Saccharomyces cerevisiae YJR090c GRR1 required for
           glucose repression and for glucose and cation transport
           singleton, hypothetical start
          Length = 1239

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 40/83 (48%), Gaps = 3/83 (3%)

Query: 674 FSCTQNIGSLLKY-LSRLPNLRFLDMSNIPEMFPSVFAYLYKYLPLFPSLQRIHFDSNCL 732
           F+C  N+ +   Y L+ LP L+ + M    ++       +        +L+R+H  S C 
Sbjct: 793 FACCTNLTNKTLYELAELPKLKRIGMVKCSQITDEGLLTMISIRGRNDTLERVHL-SYC- 850

Query: 733 TYKQCIMLCEILQKCPKLAHVSM 755
           T      + E+L  CPKL+H+S+
Sbjct: 851 TSLTIYPIYELLMACPKLSHLSL 873

>Scas_660.30
          Length = 774

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 7/69 (10%)

Query: 376 DSRVAELTIDKP---IHAHETFFETEGYDSSTSQVNSNPDLHQHHHELPLDVVYTRCCHL 432
           DS + E   D P   ++A + +   E YD+ +  ++ NPD H H+      +      ++
Sbjct: 61  DSLLDEYEPDFPGVQLYAPDNYTMDEYYDNESGYISDNPDFHIHNKY----ITQKGFSNV 116

Query: 433 REILPIPST 441
           +EILP P+T
Sbjct: 117 KEILPPPTT 125

>Scas_707.13
          Length = 859

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 42/83 (50%), Gaps = 9/83 (10%)

Query: 306 ENYK-RLQKESERQQLEAHRVAERIANEVTGYRIRSGSLFEAAHNAVVNKVLSPSSPTEA 364
           ENYK RL  E E+QQ E H   ER  N V+ +++  GS  +++           +S T A
Sbjct: 439 ENYKERL--EQEQQQYEMHENNERRKNRVSRFKLDRGSRNKSSERD------DRASSTSA 490

Query: 365 SVIDSDPTVALDSRVAELTIDKP 387
           +V D      +D+ + E  ++KP
Sbjct: 491 AVNDIIENKPVDTLIMEDILEKP 513

>Kwal_23.5859
          Length = 619

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 51/113 (45%), Gaps = 17/113 (15%)

Query: 284 NKASSAPKRKYSKDSQEY------KMVLENYKRLQKESERQQLEAHRVAERIANE--VTG 335
           N    A +RKY  +S EY      +M LE  K+++KE ER+  +  R     AN   + G
Sbjct: 71  NGRCPACRRKYDDESVEYIVLTPEEMKLEQAKQVRKEKERKLRDKERKENEFANRKHLAG 130

Query: 336 YRIRSGSLFEAAHNAVVNKVLSPSSPTE--ASVIDSDPTVALDSRVAELTIDK 386
            R+          N V    L+P  P E  A+++ SD       ++ ++ ++K
Sbjct: 131 MRV-------IQKNLVYVVGLNPPVPYEDVAALLKSDRYFGQYGKINKIVVNK 176

>Sklu_2353.4 YER068W, Contig c2353 8340-10190
          Length = 616

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 51/113 (45%), Gaps = 17/113 (15%)

Query: 284 NKASSAPKRKYSKDSQEY------KMVLENYKRLQKESERQQLEAHRVAERIANE--VTG 335
           N    A +RKY  +S EY      K+ +E  K+ +KE ER+Q E  R     AN   + G
Sbjct: 67  NGRCPACRRKYDDESVEYIVLSPEKLKIEQAKQARKERERKQREKERKENEHANRKHLAG 126

Query: 336 YRIRSGSLFEAAHNAVVNKVLSPSSPTE--ASVIDSDPTVALDSRVAELTIDK 386
            R+          N V    L+P  P E  ++++ SD       ++ ++ +++
Sbjct: 127 MRV-------IQKNLVYVVGLNPPVPYEEVSNLLRSDKYFGQYGKINKIVVNR 172

>Kwal_27.10246
          Length = 339

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 34/79 (43%), Gaps = 16/79 (20%)

Query: 533 KSIIRLDLSQTKIKPDLPAECYRHNMNWKLFCNVLRERTGRPLE---------------- 576
           +S I LDL++   + D+  E Y     W++    +RE  G P                  
Sbjct: 214 ESDIALDLAKQLDEDDVIVEGYAEYPTWRVHLGYIREEDGDPKSTIDLDGVGGVSILAKA 273

Query: 577 ELLLNGVHFDEMSFDDYQD 595
           +L  NGVHF   +F+++ +
Sbjct: 274 QLFRNGVHFPAFTFENHAE 292

>ADL064W [1677] [Homologous to ScYER068W (MOT2) - SH]
           complement(567690..569630) [1941 bp, 646 aa]
          Length = 646

 Score = 31.2 bits (69), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 31/63 (49%), Gaps = 8/63 (12%)

Query: 284 NKASSAPKRKYSKDSQEY------KMVLENYKRLQKESERQQLEAHRVAERIAN--EVTG 335
           N    A +RKY  +S EY      ++ LE  K+ +KE ER+Q E  R     AN   + G
Sbjct: 71  NGRCPACRRKYDDESVEYIVLSPEELKLERAKQARKERERKQREKERKENEYANRKHLAG 130

Query: 336 YRI 338
            R+
Sbjct: 131 MRV 133

>KLLA0A10351g complement(906401..907087) similar to sp|Q9A7D3
           Caulobacter crescentus Hypothetical protein CC1790,
           hypothetical start
          Length = 228

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 38/82 (46%), Gaps = 4/82 (4%)

Query: 242 KFHHEPAQQLPSRKPKMGDIVVPEDMISEEPKISVGITTTSDNKASSAPKRKYSKDSQEY 301
           K H  P  +LPS KP+  +++V     S+E      I    D+ ++       S DS ++
Sbjct: 114 KVHIPPKDELPSSKPRSINVIVKPSNTSQE----TAIKQLRDSISALTGLEDPSHDSIKF 169

Query: 302 KMVLENYKRLQKESERQQLEAH 323
            + L       K+SE ++L +H
Sbjct: 170 HITLAYINEELKDSEVEELNSH 191

>YJR090C (GRR1) [2981] chr10 complement(590786..594241) F-box
           protein that targets G1 cyclins and Gic1p and other
           proteins for degradation by the SCF-Grr1p complex
           (Skp1p-Cdc53p-Cdc34p-Grr1p), also required for glucose
           repression and for glucose and cation transport [3456
           bp, 1151 aa]
          Length = 1151

 Score = 31.2 bits (69), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 41/85 (48%), Gaps = 7/85 (8%)

Query: 674 FSCTQNIGSLLKY-LSRLPNLRFLDMSNIPEMFPSVFAYLYKYLPLFPSLQRIH--FDSN 730
           F+C  N+ +   Y L+ LP L+ + +    +M       +        +L+R+H  + SN
Sbjct: 658 FACCTNLTNRTLYELADLPKLKRIGLVKCTQMTDEGLLNMVSLRGRNDTLERVHLSYCSN 717

Query: 731 CLTYKQCIMLCEILQKCPKLAHVSM 755
              Y     + E+L  CP+L+H+S+
Sbjct: 718 LTIYP----IYELLMSCPRLSHLSL 738

>KLLA0D13596g complement(1172223..1173701) similar to sp|P39937
           Saccharomyces cerevisiae YER007w PAC2 involved in the
           stabilization of microtubles singleton, start by
           similarity
          Length = 492

 Score = 30.8 bits (68), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 40/74 (54%), Gaps = 4/74 (5%)

Query: 661 YNNLEYFTLNSSS-FSCTQNIGSLLKYLSRLPNLRFLDMSNIPEMFPSVFAYLYKYLPLF 719
           ++ LE  TL+ ++ F   +   S + + S   +LR+LD+S    +F  +   +Y+ L LF
Sbjct: 122 FDKLESITLSENNIFRAFKTTCSSIPFNSAHSSLRYLDLS--FNLFSDI-NEVYRILRLF 178

Query: 720 PSLQRIHFDSNCLT 733
           PS++ +    NC T
Sbjct: 179 PSVETVILSGNCFT 192

>ADL239C [1502] [Homologous to ScYIL109C (SEC24) - SH; ScYNL049C
           (SFB2) - SH] (281426..284101) [2676 bp, 891 aa]
          Length = 891

 Score = 30.8 bits (68), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 29/57 (50%)

Query: 343 LFEAAHNAVVNKVLSPSSPTEASVIDSDPTVALDSRVAELTIDKPIHAHETFFETEG 399
           +F+ + NA+ N +L+ ++ T    +DS P     +R+  L +D  IH      + EG
Sbjct: 285 VFDVSQNAIKNGLLATAARTLLESLDSLPNYDERTRITILAVDHTIHYFSVPLDEEG 341

>Kwal_14.1042
          Length = 912

 Score = 30.8 bits (68), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 31/67 (46%), Gaps = 8/67 (11%)

Query: 1065 PDTDDKKSGPEKTPNVSENTNAPERVTVPKIQT---VPSGNELREAIIKAKGIDSIEDLI 1121
            PD D     P+     +  T   +R  +  I     VP G E+  +I+KA G++ I  L 
Sbjct: 784  PDMD-----PDVLARTALATKVFQRAGIKSINITDDVPGGEEVLSSILKAHGVEEIRMLP 838

Query: 1122 KKVSKDD 1128
            KK S+ D
Sbjct: 839  KKFSEQD 845

>KLLA0A02959g 260627..262306 similar to sp|Q02206 Saccharomyces
           cerevisiae YKR008w RSC4 member of RSC complex, which
           remodels the structure of chromatin, start by similarity
          Length = 559

 Score = 30.4 bits (67), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 39/89 (43%), Gaps = 8/89 (8%)

Query: 309 KRLQKESERQQLEA-HRVAERIANEVTGYRIRSGSLFEAAHNAVVNKVLSPSSPTEASVI 367
           KR + E   ++ E  H     +     G R RSG+L +  +       + P  PTE  ++
Sbjct: 4   KRSRSEDPSEEPEQKHSKQNYVPRYTPGKRPRSGALPKVDY-------VHPLDPTEELIV 56

Query: 368 DSDPTVALDSRVAELTIDKPIHAHETFFE 396
           D D T+   +     T+D  + AH+  F+
Sbjct: 57  DLDWTIPKLNLFIAFTLDNLVEAHKALFK 85

>Kwal_23.4925
          Length = 897

 Score = 30.8 bits (68), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 41/88 (46%), Gaps = 5/88 (5%)

Query: 316 ERQQLEAHRVAERIANEVTGYRIRSGS----LFEAAHNAVVNKVLSPSSPTEASVIDSDP 371
           ER +L+ H V E +A +    R    S    + + + NA+ N +L+ ++ T    +DS P
Sbjct: 262 ERNELQ-HAVMEYLAPKEYAVRQPPPSSYAFVLDVSQNAIKNGLLATAARTLLDTLDSLP 320

Query: 372 TVALDSRVAELTIDKPIHAHETFFETEG 399
                +RV  L +D  IH      + EG
Sbjct: 321 NHDERTRVTILAVDNSIHYFAIPLDEEG 348

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.131    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 36,444,315
Number of extensions: 1592633
Number of successful extensions: 5257
Number of sequences better than 10.0: 72
Number of HSP's gapped: 5291
Number of HSP's successfully gapped: 86
Length of query: 1180
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1067
Effective length of database: 12,684,275
Effective search space: 13534121425
Effective search space used: 13534121425
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 67 (30.4 bits)