Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0J04004g28828414910.0
YOR228C3022955758e-73
Scas_640.203022815097e-63
Kwal_26.86942882774791e-58
KLLA0D07238g2832313266e-36
ACR114C2342313183e-35
Kwal_47.1812379137635.3
CAGL0D00176g46035627.0
Scas_519.460345627.2
Scas_613.747655619.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J04004g
         (284 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J04004g 375642..376508 similar to tr|Q12106 Saccharomyces c...   578   0.0  
YOR228C (YOR228C) [5019] chr15 complement(766869..767777) Protei...   226   8e-73
Scas_640.20                                                           200   7e-63
Kwal_26.8694                                                          189   1e-58
KLLA0D07238g complement(618435..619286) weakly similar to sgd|S0...   130   6e-36
ACR114C [1161] [Homologous to ScYOR228C - SH] (553753..554457) [...   127   3e-35
Kwal_47.18123                                                          29   5.3  
CAGL0D00176g 23693..25075 highly similar to sp|P39708 Saccharomy...    28   7.0  
Scas_519.4                                                             28   7.2  
Scas_613.7                                                             28   9.1  

>CAGL0J04004g 375642..376508 similar to tr|Q12106 Saccharomyces
           cerevisiae YOR228c, hypothetical start
          Length = 288

 Score =  578 bits (1491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/284 (100%), Positives = 284/284 (100%)

Query: 1   MSKNLKEVSPTPLKPDERPISYNPRKILGIEVSTTTVVHALFKLQRLSIVPMALYFPVHA 60
           MSKNLKEVSPTPLKPDERPISYNPRKILGIEVSTTTVVHALFKLQRLSIVPMALYFPVHA
Sbjct: 1   MSKNLKEVSPTPLKPDERPISYNPRKILGIEVSTTTVVHALFKLQRLSIVPMALYFPVHA 60

Query: 61  VNTMITPLVNPETAPDSFLTAVHKWVPQAASKILIASLLTHIASGVLLRGWKLYKSHVLK 120
           VNTMITPLVNPETAPDSFLTAVHKWVPQAASKILIASLLTHIASGVLLRGWKLYKSHVLK
Sbjct: 61  VNTMITPLVNPETAPDSFLTAVHKWVPQAASKILIASLLTHIASGVLLRGWKLYKSHVLK 120

Query: 121 EKYHLHHQHKHTTSQDDIGLTGGISGYLFGIYKQFTLSPLSMSGYVLTPLVLYHLLIMKW 180
           EKYHLHHQHKHTTSQDDIGLTGGISGYLFGIYKQFTLSPLSMSGYVLTPLVLYHLLIMKW
Sbjct: 121 EKYHLHHQHKHTTSQDDIGLTGGISGYLFGIYKQFTLSPLSMSGYVLTPLVLYHLLIMKW 180

Query: 181 VPESLGEPATGFDFVKQLLRASEWWIRWFAGIIPLSALISAASYHIVAGACRLLDVKDMK 240
           VPESLGEPATGFDFVKQLLRASEWWIRWFAGIIPLSALISAASYHIVAGACRLLDVKDMK
Sbjct: 181 VPESLGEPATGFDFVKQLLRASEWWIRWFAGIIPLSALISAASYHIVAGACRLLDVKDMK 240

Query: 241 KRKNASRIISGLSIAGFLSILRLSNAKSFSSDWSQFNDIFTKLN 284
           KRKNASRIISGLSIAGFLSILRLSNAKSFSSDWSQFNDIFTKLN
Sbjct: 241 KRKNASRIISGLSIAGFLSILRLSNAKSFSSDWSQFNDIFTKLN 284

>YOR228C (YOR228C) [5019] chr15 complement(766869..767777) Protein
           of unknown function, has low similarity to
           uncharacterized C. albicans Orf6.5264p [909 bp, 302 aa]
          Length = 302

 Score =  226 bits (575), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 122/295 (41%), Positives = 174/295 (58%), Gaps = 19/295 (6%)

Query: 5   LKEVSPTPLKPDERPISYNP------------RKILGIE--VSTTTVVHALFKLQRLSIV 50
           L EV P P+ P   P   N             +KI GI    S ++    L+  Q++S++
Sbjct: 4   LHEVPPEPVDPASLPHDVNAHSPEGDGNPDKRKKIFGIPYPFSRSSCRRFLWNCQKISVL 63

Query: 51  PMALYFPVHAVNTMITPLVNPETAPDSFLTAVHKWVPQAASKILIASLLTHIASGVLLRG 110
           PMALYFP+HA NT+ITP V+P++APD  L  V + +P   +K+L+A +  H+++GVLLR 
Sbjct: 64  PMALYFPLHAANTLITPAVSPDSAPDDVLMMVREILPSITTKLLVAGITLHVSAGVLLRI 123

Query: 111 WKLYKSHVLKEKYHLHHQHKHTTSQDDIGLTGGISGYLFGIYKQFTLSPLSMSGYVLTPL 170
              +         HL    +   SQD IGLTGGISGYLFG+YK F + P  +SGY+L P+
Sbjct: 124 VNNWNKPRRNRHRHLKISAEQDLSQDSIGLTGGISGYLFGLYKTFRIPPQVISGYILVPV 183

Query: 171 VLYHLLIMKWVPESLGEPATGFDF--VKQLLRASEWWIRWFAGIIPLSALISAASYHIVA 228
           ++YHLLIMKWVP S+   +T  DF  +KQLL +   W +W  G++PL+ L+ +  YHI +
Sbjct: 184 LIYHLLIMKWVPNSI---STEVDFASIKQLLSSKNRWWKWLGGLVPLAILLESGVYHIGS 240

Query: 229 GACRLLDVKDMKKRKNASRIISGLSIAGFLSILRLSNAKSFSSDWSQFNDIFTKL 283
           G CR   V+ M  RK  S  I+ L++ GF+S++RL    S     +QF  IF K+
Sbjct: 241 GLCRYFGVRKMTSRKKWSTAINLLTLVGFVSLIRLMKEDSTKLGPNQFESIFKKI 295

>Scas_640.20
          Length = 302

 Score =  200 bits (509), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 125/281 (44%), Positives = 161/281 (57%), Gaps = 25/281 (8%)

Query: 4   NLKEVSPTPLKPDE---RPISYNPRKILGIEV-STTTVVHALFKLQRLSIVPMALYFPVH 59
            +KEV+P P+ P+     P S +P       V S   ++ AL   Q+ S+ PM LYFPVH
Sbjct: 2   QIKEVAPEPILPESVELTPESSSPFFPESKNVFSNRNLIKALKGFQKYSVWPMLLYFPVH 61

Query: 60  AVNTMITPLVNPETAPDSFLTAVHKWVPQAASKILIASLLTHIASGVLLR--GWKLYKSH 117
           ++NT   PL+ P   P   LT + +  P   S+ILI SL+ HIASGVLLR   W  +   
Sbjct: 62  SINTFGIPLIQPNKLPGRVLTIIREKSPLFLSRILIGSLVIHIASGVLLRVSHWLYHFQR 121

Query: 118 VLKE------KYHLHHQHKH-----TTSQDDIGLTGGISGYLFGIYKQFTLSPLSMSGYV 166
            + E       +HL+H           SQ  IGLTGGI GY  G  K+F  SPL +SGY+
Sbjct: 122 RMGEGEESEADHHLNHDASQLLVSEDISQGSIGLTGGIVGYFLGWRKKFKHSPLIVSGYL 181

Query: 167 LTPLVLYHLLIMKW---VPESLGEPATGFDFVKQLLRASEWWIRWFAGIIPLSALISAAS 223
           LTP +LYH++IM+W    PES      GF FV  LL  S+WWIR   GIIPLS LI + +
Sbjct: 182 LTPFLLYHVIIMRWGLVNPES-----KGFTFVDWLLTNSDWWIRVVGGIIPLSVLIVSGT 236

Query: 224 YHIVAGACRLLDVKDMKKRKNASRIISGLSIAGFLSILRLS 264
           YHI AG C+ L +KD+ KRK  +  I+ LSI G +SI RLS
Sbjct: 237 YHIGAGICKYLKIKDVNKRKKWAGGITLLSITGLISIFRLS 277

>Kwal_26.8694
          Length = 288

 Score =  189 bits (479), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 106/277 (38%), Positives = 162/277 (58%), Gaps = 9/277 (3%)

Query: 4   NLKEVSPTPLKPDERPIS--YNPRKILGIEVSTTTVVHALFKLQRLSIVPMALYFPVHAV 61
            LKEV+P P++ + RP+     P  +L   ++   V  +L ++Q+ ++ P+A+YFP+HA+
Sbjct: 6   ELKEVTPEPIR-NYRPLEGIEKPSGVLSF-LNARFVRLSLRRIQKHAVWPLAVYFPLHAL 63

Query: 62  NTMITPLVNPETAPDSFLTAVHKWVPQAASKILIASLLTHIASGVLLRGWKLYK--SHVL 119
           NT++ P ++ E+AP+  L  + + +P   S++L  S+  H+ASG  LR W L    + + 
Sbjct: 64  NTLVVPAISTESAPNDILMMIREVLPGFTSRLLTWSITAHVASGFALRIWSLASRWTKLK 123

Query: 120 KEKYHLHHQHKHTTSQDDIGLTGGISGYLFGIYKQFTLSPLSMSGYVLTPLVLYHLLIMK 179
           K    +    K   SQ  IGL GG+SGY  G+ KQ   +P  +SGY+L P++ YH  +MK
Sbjct: 124 KRGRSIPQDQKERESQRQIGLIGGLSGYFIGVSKQLAYNPQVVSGYILLPIIWYHARLMK 183

Query: 180 WVPESLGEPATGFDFVKQLLRASEWWIRWFAGIIPLSALISAASYHIVAGACRLLDVKDM 239
            +P +  +    FDFVK +L+    WI+WF GIIPLS LI  ASYHIVAG C    ++ +
Sbjct: 184 KIPTA-EDIDIDFDFVKWVLQNDSVWIKWFGGIIPLSILIWTASYHIVAGFCTYAKIRRL 242

Query: 240 KKRKNASRIISGLSIAGFLSILRLSNAKSF--SSDWS 274
             RK  S ++  L+  GF S+ RLS +     SS WS
Sbjct: 243 DVRKAMSTLVFSLTATGFFSLWRLSKSLPVFESSQWS 279

>KLLA0D07238g complement(618435..619286) weakly similar to
           sgd|S0005754 Saccharomyces cerevisiae YOR228c, start by
           similarity
          Length = 283

 Score =  130 bits (326), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 79/231 (34%), Positives = 117/231 (50%), Gaps = 7/231 (3%)

Query: 45  QRLSIVPMALYFPVHAVNTMITPLVNPETAPDSFLTAVHKWVPQAASKILIASLLTHIAS 104
           Q+ S+ P+  YFP+H +N +I P + P + P+  L  V +      SK++   +  HI S
Sbjct: 44  QKWSLFPLVTYFPLHGINALIIPALEPSSFPNDALMMVRELTSGLGSKLIWTGISIHILS 103

Query: 105 GVLLRGWKLYKSHVLKEKYHLHHQHKHTTS--QDDIGLTGGISGYLFGIYKQFTLSPLSM 162
           G  LR   + +      K H       T S  Q  IGL GG+SGY  GI +    +P  +
Sbjct: 104 GFALR---IMRKLPTSSKTHNAESLLDTQSLAQSRIGLVGGLSGYFIGIKRNLQYNPQEL 160

Query: 163 SGYVLTPLVLYHLLIMKWVPESLGEPATGFDFVKQLLRASEW-WIRWFAGIIPLSALISA 221
           +G++LTP++ +H  +MKW+P +  +    FDFVK LL       +R   G  PL ALI  
Sbjct: 161 TGWLLTPVLFFHGALMKWLPNT-AKVDIDFDFVKWLLDKDRGALVRIGLGYGPLVALIGL 219

Query: 222 ASYHIVAGACRLLDVKDMKKRKNASRIISGLSIAGFLSILRLSNAKSFSSD 272
            SYHI+AG  + + V+ +K RK     I  L   G++ I RL +   F  D
Sbjct: 220 GSYHIIAGTVQYMHVRSLKTRKRIMNFILLLICTGYIGISRLGSEIVFGMD 270

>ACR114C [1161] [Homologous to ScYOR228C - SH] (553753..554457) [705
           bp, 234 aa]
          Length = 234

 Score =  127 bits (318), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 78/231 (33%), Positives = 129/231 (55%), Gaps = 6/231 (2%)

Query: 55  YFPVHAVNTMITPLVNPETAPDSFLTAVHKWVPQAASKILIASLLTHIASGVLLRGWKLY 114
           Y P+H  NT+  PL+ P  AP+  L  V + +P A  ++L+ ++  H+A+GV LR    Y
Sbjct: 5   YMPLHLTNTLFVPLIEPTYAPNDVLRMVRELLPAATDQVLVWTVGVHVAAGVALRAMSWY 64

Query: 115 KSHVLKEKYHLHHQHKHTTSQDDIGLTGGISGYLFGIYKQFTLSPLSMSGYVLTPLVLYH 174
           +    + + ++  + +  TS   IGL GG+SGY  G+ K    +P ++SGY+L PL+ YH
Sbjct: 65  RRWTRRGRRYVT-RVESDTSPRRIGLIGGLSGYFLGLNKTVRHNPHAVSGYLLVPLLAYH 123

Query: 175 LLIMKWVPESLGEPATGFDFVKQLLRASEW--WIRWFAGIIPLSALISAASYHIVAGACR 232
             +MKW+P   G     FDFV+ LL       W RW  GI+PL+ L+S  +YH+  G  +
Sbjct: 124 AALMKWLPARAGVDVD-FDFVQWLLYGGTGSAWTRWGLGIMPLAGLVSVGAYHMFTGLVQ 182

Query: 233 LLDVKDMKKRKNASRIISGLSIAGFLSILRLSNAKSFSSDWSQFNDIFTKL 283
           LL  + +  R+    ++ G+++ G +S+ RLS  +   +   Q++ I  +L
Sbjct: 183 LLRWRSLALRRKVFNVVVGINVVGLVSLWRLSTVRPIMN--VQYHRILQQL 231

>Kwal_47.18123
          Length = 791

 Score = 28.9 bits (63), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 2/37 (5%)

Query: 110 GWKLYKSHVLKEKYHLHHQHKHTT--SQDDIGLTGGI 144
           GWK   +HVL E   + H   +T   S+D+I +  G+
Sbjct: 56  GWKALNTHVLYELTQIEHHFPNTNAYSKDEISIQNGV 92

>CAGL0D00176g 23693..25075 highly similar to sp|P39708 Saccharomyces
           cerevisiae YAL062w GDH3 NADP-glutamate dehydrogenase or
           sp|P07262 Saccharomyces cerevisiae YOR375c GDH1,
           hypothetical start
          Length = 460

 Score = 28.5 bits (62), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 17/35 (48%)

Query: 124 HLHHQHKHTTSQDDIGLTGGISGYLFGIYKQFTLS 158
           H H          DIG+ G   GYLFG Y+ +T S
Sbjct: 141 HRHIGADTDVPAGDIGVGGREIGYLFGAYRHYTNS 175

>Scas_519.4
          Length = 603

 Score = 28.5 bits (62), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 26/45 (57%)

Query: 232 RLLDVKDMKKRKNASRIISGLSIAGFLSILRLSNAKSFSSDWSQF 276
           RL ++K ++   +  +II  +S  GF +++  SN +  S  W++F
Sbjct: 359 RLYEIKFLQGNTDNQKIIKKISCGGFHNLVLDSNNECHSFGWNRF 403

>Scas_613.7
          Length = 476

 Score = 28.1 bits (61), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 3/55 (5%)

Query: 70  NPETAPDSFLTAVHKWVPQAASKILIASLLTHIASGVLLRGWKL--YKSHVLKEK 122
           NPET+  ++L+    W+  A +K+L   +L  ++S +   G  L  +K  V  EK
Sbjct: 418 NPETSKLAYLSLGTSWLENAGAKVL-PGVLVEVSSRLSYEGENLSQFKGKVFNEK 471

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.136    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,285,843
Number of extensions: 374334
Number of successful extensions: 1004
Number of sequences better than 10.0: 17
Number of HSP's gapped: 992
Number of HSP's successfully gapped: 17
Length of query: 284
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 184
Effective length of database: 13,134,309
Effective search space: 2416712856
Effective search space used: 2416712856
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)