Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0J03982g1151146057e-83
AFL121W85851621.2
YFL029C (CAK1)36825602.0
YKR028W (SAP190)109849584.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J03982g
         (114 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J03982g 374931..375278 no similarity, hypothetical start         237   7e-83
AFL121W [3074] [Homologous to ScYBL022C - NSH] complement(209373...    28   1.2  
YFL029C (CAK1) [1654] chr6 complement(78053..79159) Cdk-activati...    28   2.0  
YKR028W (SAP190) [3283] chr11 (493900..497196) Protein that asso...    27   4.2  

>CAGL0J03982g 374931..375278 no similarity, hypothetical start
          Length = 115

 Score =  237 bits (605), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 114/114 (100%), Positives = 114/114 (100%)

Query: 1   MFYAAYRANISQPGPVQWNKYCRKWYKNGVWSLMVVVNSWTDRNTSTFEGYSIQRLPEGI 60
           MFYAAYRANISQPGPVQWNKYCRKWYKNGVWSLMVVVNSWTDRNTSTFEGYSIQRLPEGI
Sbjct: 1   MFYAAYRANISQPGPVQWNKYCRKWYKNGVWSLMVVVNSWTDRNTSTFEGYSIQRLPEGI 60

Query: 61  IAGYSSLEEGVGTSRAIVYEPHIQYSYKQLVGTISNSIYPPKFGITCLSFDTRL 114
           IAGYSSLEEGVGTSRAIVYEPHIQYSYKQLVGTISNSIYPPKFGITCLSFDTRL
Sbjct: 61  IAGYSSLEEGVGTSRAIVYEPHIQYSYKQLVGTISNSIYPPKFGITCLSFDTRL 114

>AFL121W [3074] [Homologous to ScYBL022C - NSH]
           complement(209373..211949) [2577 bp, 858 aa]
          Length = 858

 Score = 28.5 bits (62), Expect = 1.2,   Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 1/51 (1%)

Query: 59  GIIAGYSSLEEGVGTSRAIVYEPHIQYSYKQLVGTISNSIYPPKFGITCLS 109
           G+ A   ++E+G  T RA+VYE   Q   K  V  +   + PP  G T ++
Sbjct: 334 GVTADAGAIEDGSATKRAVVYENKAQEQRKTKVPFLL-LVGPPGVGKTSVA 383

>YFL029C (CAK1) [1654] chr6 complement(78053..79159) Cdk-activating
           kinase (serine/threonine protein kinase) responsible for
           in vivo activation of Cdc28p, also involved in spore
           wall formation [1107 bp, 368 aa]
          Length = 368

 Score = 27.7 bits (60), Expect = 2.0,   Method: Composition-based stats.
 Identities = 11/25 (44%), Positives = 16/25 (64%), Gaps = 2/25 (8%)

Query: 24  KWYKNGV--WSLMVVVNSWTDRNTS 46
           K Y  GV  WSL+++++ W  R TS
Sbjct: 219 KCYDGGVDVWSLLIIISQWFQRETS 243

>YKR028W (SAP190) [3283] chr11 (493900..497196) Protein that
           associates with and contributes to function of the
           protein phosphatase Sit4p [3297 bp, 1098 aa]
          Length = 1098

 Score = 26.9 bits (58), Expect = 4.2,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 53  IQRLPEGIIAGYSSLEEGVGTSRAIVYEPHIQYSYKQLVGTISNSIYPP 101
           I++L + ++ G +SL  GVG    ++ + +  Y + QLV T   S +PP
Sbjct: 385 IEKLIKIMLKGGTSLSNGVGIIIELIRKNNSDYDFIQLVYTTLES-HPP 432

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.135    0.434 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,048,735
Number of extensions: 150411
Number of successful extensions: 307
Number of sequences better than 10.0: 6
Number of HSP's gapped: 307
Number of HSP's successfully gapped: 6
Length of query: 114
Length of database: 16,596,109
Length adjustment: 84
Effective length of query: 30
Effective length of database: 13,688,197
Effective search space: 410645910
Effective search space used: 410645910
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)