Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0J02992g2301965941e-77
Scas_704.31*2221922427e-25
YER063W (THO1)218591666e-14
ADL069W205591271e-08
KLLA0C08195g243601229e-08
Kwal_23.5835157511074e-06
Kwal_23.628545834642.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J02992g
         (227 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J02992g 286008..286700 similar to sp|P40040 Saccharomyces c...   233   1e-77
Scas_704.31*                                                           98   7e-25
YER063W (THO1) [1494] chr5 (281708..282364) Protein that suppres...    69   6e-14
ADL069W [1672] [Homologous to ScYER063W (THO1) - SH] complement(...    54   1e-08
KLLA0C08195g complement(719857..720588) some similarities with s...    52   9e-08
Kwal_23.5835                                                           46   4e-06
Kwal_23.6285                                                           29   2.5  

>CAGL0J02992g 286008..286700 similar to sp|P40040 Saccharomyces
           cerevisiae YER063w THO1, start by similarity
          Length = 230

 Score =  233 bits (594), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 130/196 (66%)

Query: 1   MSNYSALTVVQLKELLTERNLSVAGLKNQLVERLTNDDXXXXXXXXXXXXXXXXXXXXXX 60
           MSNYSALTVVQLKELLTERNLSVAGLKNQLVERLTNDD                      
Sbjct: 1   MSNYSALTVVQLKELLTERNLSVAGLKNQLVERLTNDDKAKEAAGEAAPAPVTEEAAPAP 60

Query: 61  XXXXXXXXXXXXXXXXXXXXXXXXXXXXSNEAAPAVASEQPAEASEDKPXXXXXXXXXXX 120
                                       SNEAAPAVASEQPAEASEDKP           
Sbjct: 61  AAAPVAAEVEEAKPEEAKPEEETKAEPASNEAAPAVASEQPAEASEDKPAEVQEKAPEVK 120

Query: 121 XXXXXLFDILTAEEIKQRATELIDKKLHRAKKFGAEQDQIDSLEKLKVRIDRFGVDRNMS 180
                LFDILTAEEIKQRATELIDKKLHRAKKFGAEQDQIDSLEKLKVRIDRFGVDRNMS
Sbjct: 121 EPEKELFDILTAEEIKQRATELIDKKLHRAKKFGAEQDQIDSLEKLKVRIDRFGVDRNMS 180

Query: 181 IALELGLVKPKEVRQQ 196
           IALELGLVKPKEVRQQ
Sbjct: 181 IALELGLVKPKEVRQQ 196

>Scas_704.31*
          Length = 222

 Score = 97.8 bits (242), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 88/192 (45%), Gaps = 14/192 (7%)

Query: 1   MSNYSALTVVQLKELLTERNLSVAGLKNQLVERLTNDDXXXXXXXXXXXXXXXXXXXXXX 60
           M+ YS LTV QLKELLT+R+L + GLK  LVERL  +D                      
Sbjct: 1   MTEYSKLTVAQLKELLTQRSLPLEGLKKDLVERLVKNDAEATSSVGETTATPAEATVAES 60

Query: 61  XXXXXXXXXXXXXXXXXXXXXXXXXXXXSNEAAPAVASEQPAEASEDKPXXXXXXXXXXX 120
                                       +N AAP  A+ +  E    K            
Sbjct: 61  TEQSEAAAEPSVETAAPAPAVTAPVEPATN-AAPVTAATETKEGEPTK------------ 107

Query: 121 XXXXXLFDILTAEEIKQRATELIDKKLHRAKKFGAEQDQIDSLEKLKVRIDRFGVDRNMS 180
                    LT EE+K  A EL++KK+HRAKKF AEQ  ID LE++  RI++FG+D N +
Sbjct: 108 PEEKEEKKPLTQEEMKTMALELLNKKIHRAKKFAAEQSSIDELERMITRIEKFGLDLNST 167

Query: 181 IALELGLV-KPK 191
           +A+ELGL  KPK
Sbjct: 168 LAVELGLAPKPK 179

>YER063W (THO1) [1494] chr5 (281708..282364) Protein that suppresses
           the transcriptional defects of hpr1 null mutant upon
           overproduction [657 bp, 218 aa]
          Length = 218

 Score = 68.6 bits (166), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 33/59 (55%), Positives = 45/59 (76%)

Query: 130 LTAEEIKQRATELIDKKLHRAKKFGAEQDQIDSLEKLKVRIDRFGVDRNMSIALELGLV 188
           L+ EEIK +A +L++KKLHRA KFG +Q  IDSL++   R+++FGVD N  +A ELGLV
Sbjct: 120 LSPEEIKAKALDLLNKKLHRANKFGQDQADIDSLQRQINRVEKFGVDLNSKLAEELGLV 178

 Score = 61.2 bits (147), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 28/38 (73%), Positives = 35/38 (92%)

Query: 1  MSNYSALTVVQLKELLTERNLSVAGLKNQLVERLTNDD 38
          M++YS+LTVVQLK+LLT+RNLSV GLKN+LV+RL  DD
Sbjct: 1  MADYSSLTVVQLKDLLTKRNLSVGGLKNELVQRLIKDD 38

>ADL069W [1672] [Homologous to ScYER063W (THO1) - SH]
           complement(558299..558916) [618 bp, 205 aa]
          Length = 205

 Score = 53.5 bits (127), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 38/59 (64%)

Query: 129 ILTAEEIKQRATELIDKKLHRAKKFGAEQDQIDSLEKLKVRIDRFGVDRNMSIALELGL 187
            L+ EE+KQ A   + KKLHRA+KFG +   + +L+K   R+++FG+D    +A ELG 
Sbjct: 117 TLSPEEMKQAAVAHLSKKLHRARKFGEDDAAVGALQKQLARLEKFGLDLTTQLAQELGF 175

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 27/38 (71%)

Query: 1  MSNYSALTVVQLKELLTERNLSVAGLKNQLVERLTNDD 38
          M++Y+++TV QLK++L ER L   GLK  LVERL   D
Sbjct: 33 MTDYASMTVAQLKDVLKERELPTQGLKAALVERLQQAD 70

>KLLA0C08195g complement(719857..720588) some similarities with
           sp|P40040 Saccharomyces cerevisiae YER063w THO1
           singleton, hypothetical start
          Length = 243

 Score = 51.6 bits (122), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 41/60 (68%)

Query: 130 LTAEEIKQRATELIDKKLHRAKKFGAEQDQIDSLEKLKVRIDRFGVDRNMSIALELGLVK 189
           L+ +++KQ A + + KK++RA+KFG +   ID L++   RI++FG+D +  +A ELG  K
Sbjct: 157 LSQDQLKQAAIDHLQKKIYRAEKFGQDDSTIDDLQRQINRIEKFGLDLSTQLAKELGFGK 216

 Score = 45.8 bits (107), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%)

Query: 3  NYSALTVVQLKELLTERNLSVAGLKNQLVERLTNDD 38
          +YS  TV QLKELL +RNLS  GLK  L+ RL +DD
Sbjct: 47 SYSGNTVAQLKELLKQRNLSTDGLKADLINRLQDDD 82

>Kwal_23.5835
          Length = 157

 Score = 45.8 bits (107), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 32/51 (62%)

Query: 143 IDKKLHRAKKFGAEQDQIDSLEKLKVRIDRFGVDRNMSIALELGLVKPKEV 193
           +++KL RAKKF  +Q  +D LE+   R+ +FG+D    +A ELGL K  E 
Sbjct: 85  LERKLRRAKKFADDQATLDYLERQIARVRKFGLDTTTELARELGLGKGPET 135

 Score = 32.7 bits (73), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 22/38 (57%)

Query: 1  MSNYSALTVVQLKELLTERNLSVAGLKNQLVERLTNDD 38
           + Y+  TV QL+  L  R L   G K+QLVERL  DD
Sbjct: 4  TTKYAEQTVEQLQNELQSRQLDSDGEKSQLVERLEADD 41

>Kwal_23.6285
          Length = 458

 Score = 29.3 bits (64), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 21/34 (61%)

Query: 3   NYSALTVVQLKELLTERNLSVAGLKNQLVERLTN 36
           N+S++++ QLK+ L    L V G + QLV R  +
Sbjct: 278 NFSSMSMQQLKQKLASLKLPVVGTRQQLVNRYNH 311

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.310    0.128    0.328 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,605,128
Number of extensions: 97999
Number of successful extensions: 311
Number of sequences better than 10.0: 10
Number of HSP's gapped: 310
Number of HSP's successfully gapped: 16
Length of query: 227
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 129
Effective length of database: 13,203,545
Effective search space: 1703257305
Effective search space used: 1703257305
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 60 (27.7 bits)