Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0J02970g44844123450.0
YER061C (CEM1)44245012901e-176
Scas_715.4844845112661e-173
Kwal_23.582842444811151e-150
ADL072C43345010261e-136
KLLA0C08239g4294408981e-117
Kwal_23.486217312541424e-09
YPL231W (FAS2)18872241041e-04
CAGL0E06138g18831051041e-04
KLLA0C15983g18931991032e-04
AFL138W18912201032e-04
Kwal_56.242488771991004e-04
Scas_630.2558260760.25
YAL067C (SEO1)59360711.1
YNL224C76775682.8
YER051W49278672.9
YPL028W (ERG10)39876663.8
Sklu_1761.239963664.1
CAGL0L12364g39863646.7
Sklu_2362.157258647.9
YOL156W (HXT11)56758648.4
KLLA0D12056g39835639.0
YJL219W (HXT9)56758639.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J02970g
         (441 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J02970g complement(284370..285716) similar to sp|P39525 Sac...   907   0.0  
YER061C (CEM1) [1492] chr5 complement(278296..279624) Beta-ketoa...   501   e-176
Scas_715.48                                                           492   e-173
Kwal_23.5828                                                          434   e-150
ADL072C [1669] [Homologous to ScYER061C (CEM1) - SH] (554605..55...   399   e-136
KLLA0C08239g 723077..724366 similar to sp|P39525 Saccharomyces c...   350   e-117
Kwal_23.4862                                                           59   4e-09
YPL231W (FAS2) [5218] chr16 (108652..114315) Fatty-acyl-CoA synt...    45   1e-04
CAGL0E06138g complement(611598..617249) highly similar to sp|P19...    45   1e-04
KLLA0C15983g 1389936..1395617 highly similar to sp|P19097 Saccha...    44   2e-04
AFL138W [3057] [Homologous to ScYPL231W (FAS2) - SH] complement(...    44   2e-04
Kwal_56.24248                                                          43   4e-04
Scas_630.25                                                            34   0.25 
YAL067C (SEO1) [2] chr1 complement(7236..9017) Member of the all...    32   1.1  
YNL224C (YNL224C) [4380] chr14 complement(224795..227098) Nucleo...    31   2.8  
YER051W (YER051W) [1479] chr5 (254655..256133) Protein containin...    30   2.9  
YPL028W (ERG10) [5410] chr16 (498092..499288) Acetyl-CoA acetylt...    30   3.8  
Sklu_1761.2 YPL028W, Contig c1761 1942-3141                            30   4.1  
CAGL0L12364g complement(1334642..1335838) highly similar to sp|P...    29   6.7  
Sklu_2362.1 YDR342C, Contig c2362 924-2642                             29   7.9  
YOL156W (HXT11) [4669] chr15 (25272..26975) Low-affinity glucose...    29   8.4  
KLLA0D12056g 1029222..1030418 highly similar to sp|P41338 Saccha...    29   9.0  
YJL219W (HXT9) [2711] chr10 (19497..21200) Member of the hexose ...    29   9.5  

>CAGL0J02970g complement(284370..285716) similar to sp|P39525
           Saccharomyces cerevisiae YER061c CEM1, start by
           similarity
          Length = 448

 Score =  907 bits (2345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/441 (100%), Positives = 441/441 (100%)

Query: 1   MSRRVVVTGLGCVTPLGKSVKESWHRLLQRDSNGLVKLDQLTKGDFAKWRGIFPPELRVG 60
           MSRRVVVTGLGCVTPLGKSVKESWHRLLQRDSNGLVKLDQLTKGDFAKWRGIFPPELRVG
Sbjct: 1   MSRRVVVTGLGCVTPLGKSVKESWHRLLQRDSNGLVKLDQLTKGDFAKWRGIFPPELRVG 60

Query: 61  AVSPIESFEVNSQLFTSQDDRRMSRFIKLATIASYEALVSSGLVNKETKMSEDGRIPIDQ 120
           AVSPIESFEVNSQLFTSQDDRRMSRFIKLATIASYEALVSSGLVNKETKMSEDGRIPIDQ
Sbjct: 61  AVSPIESFEVNSQLFTSQDDRRMSRFIKLATIASYEALVSSGLVNKETKMSEDGRIPIDQ 120

Query: 121 HNQGIDPDKVGCLIGSGIGSIEDIYETSVTFDSNTKKNRINPYFVPRILTNMAAGNIAIK 180
           HNQGIDPDKVGCLIGSGIGSIEDIYETSVTFDSNTKKNRINPYFVPRILTNMAAGNIAIK
Sbjct: 121 HNQGIDPDKVGCLIGSGIGSIEDIYETSVTFDSNTKKNRINPYFVPRILTNMAAGNIAIK 180

Query: 181 FNLRGPTHSVSTACATGNNAIGDGYNMIKLGMQDICLAGASEASVHPLSLAGFLRAKSLS 240
           FNLRGPTHSVSTACATGNNAIGDGYNMIKLGMQDICLAGASEASVHPLSLAGFLRAKSLS
Sbjct: 181 FNLRGPTHSVSTACATGNNAIGDGYNMIKLGMQDICLAGASEASVHPLSLAGFLRAKSLS 240

Query: 241 PDGISRPFDEERNGFVLGEGAGIVVLESLESAERRGAPILAEIVGYGLSCDAHHITSPPN 300
           PDGISRPFDEERNGFVLGEGAGIVVLESLESAERRGAPILAEIVGYGLSCDAHHITSPPN
Sbjct: 241 PDGISRPFDEERNGFVLGEGAGIVVLESLESAERRGAPILAEIVGYGLSCDAHHITSPPN 300

Query: 301 DGEGASRAIKMALDLSHGNVNARDIEYVNAHATSTKLGDNTECCAIQNTLIDNVNRQKPL 360
           DGEGASRAIKMALDLSHGNVNARDIEYVNAHATSTKLGDNTECCAIQNTLIDNVNRQKPL
Sbjct: 301 DGEGASRAIKMALDLSHGNVNARDIEYVNAHATSTKLGDNTECCAIQNTLIDNVNRQKPL 360

Query: 361 YISSNKGSIGHLLGAAGAAESIFTILSLYNRTIPHTYNLKNVLGNFESSSMRFVKSQPHK 420
           YISSNKGSIGHLLGAAGAAESIFTILSLYNRTIPHTYNLKNVLGNFESSSMRFVKSQPHK
Sbjct: 361 YISSNKGSIGHLLGAAGAAESIFTILSLYNRTIPHTYNLKNVLGNFESSSMRFVKSQPHK 420

Query: 421 VADLEYALCNSFGFGGVNTSL 441
           VADLEYALCNSFGFGGVNTSL
Sbjct: 421 VADLEYALCNSFGFGGVNTSL 441

>YER061C (CEM1) [1492] chr5 complement(278296..279624)
           Beta-ketoacyl-ACP synthase, mitochondrial
           (3-oxoacyl-[Acyl-carrier-protein] synthase) [1329 bp,
           442 aa]
          Length = 442

 Score =  501 bits (1290), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 263/450 (58%), Positives = 329/450 (73%), Gaps = 25/450 (5%)

Query: 1   MSRRVVVTGLGCVTPLGKSVKESWHRLLQRDSNGLVKLDQLTK--GDFAKWRGIFPPELR 58
           MSRRVV+TGLGCVTPLG+S+ ESW  LL    NGL  +  L     D+       P  + 
Sbjct: 1   MSRRVVITGLGCVTPLGRSLSESWGNLLS-SKNGLTPITSLPNYNEDYKLREKSIPSTIT 59

Query: 59  VGAVSPIESFE-----VNSQLFTSQDDRRMSRFIKLATIASYEALVSSGLVNKETKMSED 113
           VG +   E+F+     +N  LFTSQD+RR S FIKLA   +YEAL ++GL+N        
Sbjct: 60  VGKIP--ENFQNENSAINKLLFTSQDERRTSSFIKLALRTTYEALHNAGLLNPND----- 112

Query: 114 GRIPIDQHNQGIDPDKVGCLIGSGIGSIEDIYETSVTFDSNTKKNRINPYFVPRILTNMA 173
               I  +    + D  GCLIGSGIGSI+DIY+TS+ F ++ K  RINPYFVP+ILTNMA
Sbjct: 113 ----ITINTSLCNLDHFGCLIGSGIGSIQDIYQTSLQFHNDNK--RINPYFVPKILTNMA 166

Query: 174 AGNIAIKFNLRGPTHSVSTACATGNNAIGDGYNMIKLGMQDICLAGASEASVHPLSLAGF 233
           AGN++IKFNLRG +HSVSTACATGNN+IGD +N I+LGMQDIC+AGASE S+HPLSLAGF
Sbjct: 167 AGNVSIKFNLRGLSHSVSTACATGNNSIGDAFNFIRLGMQDICVAGASETSLHPLSLAGF 226

Query: 234 LRAKSLSPDGISRPFDEERNGFVLGEGAGIVVLESLESAERRGAPILAEIVGYGLSCDAH 293
           +RAKS++ +GISRPFD +R+GFVLGEG G++V+ESLE A++R A I++E+VGYGLS DA 
Sbjct: 227 IRAKSITTNGISRPFDTQRSGFVLGEGCGMIVMESLEHAQKRNANIISELVGYGLSSDAC 286

Query: 294 HITSPPNDGEGASRAIKMALDLSHGNVNARDIEYVNAHATSTKLGDNTECCAIQNTLIDN 353
           HITSPP DG GA RAI+MAL ++   +   D++YVNAHATST LGD  EC A+ + L+  
Sbjct: 287 HITSPPADGNGAKRAIEMALKMAR--LEPTDVDYVNAHATSTLLGDKAECLAVASALLPG 344

Query: 354 VNRQKPLYISSNKGSIGHLLGAAGAAESIFTILSLYNRTIPHTYNLKNVLG--NFESSSM 411
            ++ KPLYISSNKG+IGHLLGA GA ESIFTI SL +  +PHT NL NVL   N E+  +
Sbjct: 345 RSKSKPLYISSNKGAIGHLLGARGAVESIFTICSLKDDKMPHTLNLDNVLTLENNEADKL 404

Query: 412 RFVKSQPHKVADLEYALCNSFGFGGVNTSL 441
            F++ +P   A+ +YALCNSFGFGGVNTSL
Sbjct: 405 HFIRDKPIVGANPKYALCNSFGFGGVNTSL 434

>Scas_715.48
          Length = 448

 Score =  492 bits (1266), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 264/451 (58%), Positives = 331/451 (73%), Gaps = 21/451 (4%)

Query: 1   MSRRVVVTGLGCVTPLGKSVKESWHRLLQRDSNGLVKLDQLT--KGDFAKWRGIFPPELR 58
           MSRRVVVTGLGC TPLG +++ESW  LL+  S G+V +  L   + D+  +    P  + 
Sbjct: 1   MSRRVVVTGLGCATPLGNTLRESWKNLLKSKS-GIVPITSLENYESDYEPFAKHIPRTIS 59

Query: 59  VGAV-SPIESFEVN-SQLFTSQDDRRMSRFIKLATIASYEALVSSGLVNKETKMSEDGRI 116
           VG + +P ES +    QLFTSQ++RR S+FIKLA  ++YEAL S+ L+  ++  S +  I
Sbjct: 60  VGRIPTPTESDQQELDQLFTSQEERRYSKFIKLAIQSTYEALKSANLLTHKSSPS-NPEI 118

Query: 117 PIDQHNQGIDPDKVGCLIGSGIGSIEDIYETSVTFDSNTKKNRINPYFVPRILTNMAAGN 176
            I   N     +K GC+IGSGIGSI DIY T++ F +  K   I+PYFVP+ILTNMAAGN
Sbjct: 119 DITHCNM----EKFGCVIGSGIGSISDIYSTTLQFQNGKK---ISPYFVPKILTNMAAGN 171

Query: 177 IAIKFNLRGPTHSVSTACATGNNAIGDGYNMIKLGMQDICLAGASEASVHPLSLAGFLRA 236
           ++IKFNLRG +HSVSTACATGNN+IGD YN I+LGMQDIC+AGASEAS+HPLSLAGFLRA
Sbjct: 172 VSIKFNLRGLSHSVSTACATGNNSIGDAYNFIRLGMQDICVAGASEASIHPLSLAGFLRA 231

Query: 237 KSLSPDGISRPFDEERNGFVLGEGAGIVVLESLESAERRGAPILAEIVGYGLSCDAHHIT 296
           KS++ DGISRPFD ER+GFVLGEGAG+VVLESLE A++R A I  EI GYGLS DA+HIT
Sbjct: 232 KSITTDGISRPFDLERSGFVLGEGAGMVVLESLEHAKKRNAKIFCEIKGYGLSSDAYHIT 291

Query: 297 SPPNDGEGASRAIKMALDLSHGNVNARDIEYVNAHATSTKLGDNTECCAIQNTLI-DNV- 354
           SPP+DG GA RA+ MA++ S  +++  +I+YVNAHATST +GD TE  AI ++ I +N+ 
Sbjct: 292 SPPSDGNGARRAMDMAINSS--SISRDEIDYVNAHATSTPVGDITEVKAIYSSFINENIF 349

Query: 355 ----NRQKPLYISSNKGSIGHLLGAAGAAESIFTILSLYNRTIPHTYNLKNVLGNFESSS 410
                R KPLY+SSNKGSIGHLLGAAGA ESIFTI+SL  + IPHT NL + +    S  
Sbjct: 350 DKSNTRTKPLYVSSNKGSIGHLLGAAGAVESIFTIMSLREKIIPHTLNLAHPIEEVSSEL 409

Query: 411 MRFVKSQPHKVADLEYALCNSFGFGGVNTSL 441
           +  V  +P     +  ALCNSFGFGGVNT+L
Sbjct: 410 LELVMDEPASPKQVNSALCNSFGFGGVNTAL 440

>Kwal_23.5828
          Length = 424

 Score =  434 bits (1115), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 244/448 (54%), Positives = 305/448 (68%), Gaps = 38/448 (8%)

Query: 1   MSRRVVVTGLGCVTPLGKSVKESWHRLLQRDSNGLVKLDQLTKGDFAKWRGIFPPELRVG 60
           M+ RVVVTGLG +TPLG++V ESW  LL   S G+  +  L       + G  P  +   
Sbjct: 1   MTSRVVVTGLGAITPLGRTVSESWRALLAGKS-GIRPIRDLPNAK--SYEGHCPASV--- 54

Query: 61  AVSPIESFEVNS--QLFTSQDDRRMSRFIKLATIASYEALVSSGLVNKETKMSEDGRIPI 118
           AV+ I  F+  +   LFTSQD RRMS+F + A +A+ EAL  + ++    +   D     
Sbjct: 55  AVADIPDFDPQAYGDLFTSQDLRRMSQFTQFAMVAAQEALQDADILQMLAESKND----- 109

Query: 119 DQHNQGIDPDKVGCLIGSGIGSIEDIYETSVTFDSNTKKNRINPYFVPRILTNMAAGNIA 178
                     +VGC+IGSGIGSI+D+Y+T V F+   +  R+ P FVP+IL NMA GNI+
Sbjct: 110 ----------RVGCVIGSGIGSIQDMYDTIVDFE---RGKRVAPTFVPKILANMACGNIS 156

Query: 179 IKFNLRGPTHSVSTACATGNNAIGDGYNMIKLGMQDICLAGASEASVHPLSLAGFLRAKS 238
           IKF LRG +H VSTACATGNNAIGD YN I+LG  D+CLAGASEASVHPLSLAGFLRAKS
Sbjct: 157 IKFQLRGVSHCVSTACATGNNAIGDAYNFIRLGYNDVCLAGASEASVHPLSLAGFLRAKS 216

Query: 239 LSPDGISRPFDEERNGFVLGEGAGIVVLESLESAERRGAPILAEIVGYGLSCDAHHITSP 298
           ++  G+SRPFD+ER+GFVLGEGAG+VVLESLE A+RRGA I AEI GYGL+ DAHHIT+P
Sbjct: 217 ITTSGVSRPFDKERDGFVLGEGAGLVVLESLEHAQRRGARIYAEIEGYGLTSDAHHITAP 276

Query: 299 PNDGEGASRAIKMALDLSHGNVNARDIEYVNAHATSTKLGDNTECCAIQNTLIDNVNRQK 358
             +GEGA RA++MAL     N + R ++Y+NAHATST LGD  E  AI ++L    N   
Sbjct: 277 SENGEGARRAMEMALK----NHDPRKVDYINAHATSTVLGDRAESQAI-SSLFSTPN-PS 330

Query: 359 PLYISSNKGSIGHLLGAAGAAESIFTILSLYNRTIPHTYNLKNVLGNFES-----SSMRF 413
            L +SSNKG+IGHLLGAAGA ESIFTI SL    IPHT NL N+ G         +S+  
Sbjct: 331 TLKVSSNKGAIGHLLGAAGAVESIFTIKSLQEGIIPHTLNLSNIGGAKGDEADTFNSLDL 390

Query: 414 VKSQPHKVADLEYALCNSFGFGGVNTSL 441
           V+ +P  V D++ AL NSFGFGG+N+SL
Sbjct: 391 VRDKP-AVHDIQLALNNSFGFGGINSSL 417

>ADL072C [1669] [Homologous to ScYER061C (CEM1) - SH]
           (554605..555906) [1302 bp, 433 aa]
          Length = 433

 Score =  399 bits (1026), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 222/450 (49%), Positives = 294/450 (65%), Gaps = 31/450 (6%)

Query: 1   MSRRVVVTGLGCVTPLGKSVKESWHRLLQRDSNGLVKLDQLTK--GDFAKWRGIFPPELR 58
           M  RVVVTG+GC TPLG S+ +SW  LL R ++GLV+L  L +  GD+     +   +LR
Sbjct: 1   MHPRVVVTGIGCYTPLGPSLAQSWKELL-RGTSGLVRLQDLAEYEGDYKPLSRLISGDLR 59

Query: 59  VGAVSPIESFEVNSQ-LFTSQDDRRMSRFIKLATIASYEALVSSGLVNKETKMSEDGRIP 117
           VG V     FE   Q L +SQ+ RR SR  +LA + + EAL  +GL++    ++      
Sbjct: 60  VGKVG----FEARDQELLSSQEQRRTSRAAQLAMVTAEEALRHAGLLSGSHLVAS----- 110

Query: 118 IDQHNQGIDPDKVGCLIGSGIGSIEDIYETSVTFDSNTKKNRINPYFVPRILTNMAAGNI 177
                  +D ++ GC+IG+G+ S+EDI + + +  S+ ++  ++P+F+P++L NMAAGN+
Sbjct: 111 -------VDRNRAGCIIGAGLPSMEDISQATASL-SSARRPSVSPFFIPKMLNNMAAGNV 162

Query: 178 AIKFNLRGPTHSVSTACATGNNAIGDGYNMIKLGMQDICLAGASEASVHPLSLAGFLRAK 237
           AIKF LRG ++  STACA+GNNAIGD YN I+LG  D+ +AGASE SVHPL+LAGF++AK
Sbjct: 163 AIKFQLRGASNCPSTACASGNNAIGDAYNFIRLGYSDVIVAGASELSVHPLALAGFVKAK 222

Query: 238 SLSPDGISRPFDEERNGFVLGEGAGIVVLESLESAERRGAPILAEIVGYGLSCDAHHITS 297
           S+S  GISRPFD  R+GFVLGEG G++VLESLE A  RGA I+AE+VGYG+  DAHHITS
Sbjct: 223 SISASGISRPFDARRDGFVLGEGCGLLVLESLEHARHRGAEIIAEVVGYGVCSDAHHITS 282

Query: 298 PPNDGEGASRAIKMALDLSHGNVNARD-IEYVNAHATSTKLGDNTECCAIQNTLIDNVNR 356
           P   G+GA RA+ MAL    G  + RD + YVNAHATST LGD  E  AIQ         
Sbjct: 283 PSEGGDGARRAMHMALQ-DAGIWDTRDQVGYVNAHATSTPLGDRAEARAIQAVF--GATG 339

Query: 357 QKPLYISSNKGSIGHLLGAAGAAESIFTILSLYNRTIPHTYNLKNVLGNFESSS-----M 411
                +SSNKG +GHLLGAAGA E++FT+ SL    +PHT NL+ V             +
Sbjct: 340 TGSTLVSSNKGHMGHLLGAAGAVEAVFTVQSLREGIVPHTLNLQTVGEGLADKKDGFGGI 399

Query: 412 RFVKSQPHKVADLEYALCNSFGFGGVNTSL 441
            FV+  P   A L YA+ NSFGFGG+N+SL
Sbjct: 400 TFVQDNPVP-APLTYAMNNSFGFGGINSSL 428

>KLLA0C08239g 723077..724366 similar to sp|P39525 Saccharomyces
           cerevisiae YER061c CEM1 beta-keto-acyl-ACP synthase,
           mitochondrial singleton, start by similarity
          Length = 429

 Score =  350 bits (898), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 196/440 (44%), Positives = 278/440 (63%), Gaps = 22/440 (5%)

Query: 3   RRVVVTGLGCVTPLGKSVKESWHRLLQRDSNGLVKLDQL-TKGDFAKWRGIFPPELRVGA 61
           +RVVVTGLG  TPLG +V +SW  LL    + L+ LD    + DFAK + + P +    A
Sbjct: 4   KRVVVTGLGAYTPLGSTVSKSWAGLLAAKQS-LIPLDAFYNREDFAKVKKLVPLDT---A 59

Query: 62  VSPIESFEVNSQLFTSQDDRRMSRFIKLATIASYEALVSSGLVNKETKMSEDGRIPIDQH 121
           VS + +  +++  F   D RRM+   ++    + EAL+ + L+  E          ++  
Sbjct: 60  VSRLHADPLDT--FPEYDQRRMTPAHQIVLEKTKEALLQANLIADEN---------LNTL 108

Query: 122 NQGIDPDKVGCLIGSGIGSIEDIYETSVTFDSNTKKNRINPYFVPRILTNMAAGNIAIKF 181
            + ID  KVGC+IG+G+ S+ D+  T  T  +   K +++P+ +PR+L NMA GN+ IK+
Sbjct: 109 TEDIDKTKVGCVIGTGMPSMPDLESTISTLFT---KPKVSPFLIPRVLPNMAMGNVMIKY 165

Query: 182 NLRGPTHSVSTACATGNNAIGDGYNMIKLGMQDICLAGASEASVHPLSLAGFLRAKSLSP 241
            ++GP+   STACATGN++I +G+N I+LG+ D+ + G+ E S+ P+S+AGF R+K++S 
Sbjct: 166 GIQGPSSCPSTACATGNSSIIEGFNSIQLGLADVMICGSYEFSIDPISIAGFYRSKTISK 225

Query: 242 DGISRPFDEERNGFVLGEGAGIVVLESLESAERRGAPILAEIVGYGLSCDAHHITSPPND 301
              +RPFD ER+GF++GEG GI+ LESLESA +RG+PILAEI G GLS D +HITSP  D
Sbjct: 226 KHQTRPFDVERDGFIMGEGCGILTLESLESALKRGSPILAEISGVGLSNDGYHITSPLPD 285

Query: 302 GEGASRAIKMALDLSHGNVNARDIEYVNAHATSTKLGDNTECCAIQNTLIDNVNRQKPLY 361
           G G   A++ A  L   N+  + + Y+NAHATST+LGD  E  AI            P Y
Sbjct: 286 GSGGKLAMQNA--LKRANIAPQQVGYINAHATSTQLGDVAESTAITELFGTKSTGTAP-Y 342

Query: 362 ISSNKGSIGHLLGAAGAAESIFTILSLYNRTIPHTYNLKNVLGNFESSSMRFVKSQPHKV 421
           +SSNKG IGHLLGA+G+ ESIFT+LSL     PHT NLK V      + +  +K++    
Sbjct: 343 VSSNKGHIGHLLGASGSVESIFTVLSLKYGRFPHTLNLKTVDETSIINELNLIKNESMID 402

Query: 422 ADLEYALCNSFGFGGVNTSL 441
             +EYAL NSFGFGGVNTS+
Sbjct: 403 NSIEYALTNSFGFGGVNTSI 422

>Kwal_23.4862
          Length = 1731

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 70/254 (27%), Positives = 107/254 (42%), Gaps = 30/254 (11%)

Query: 90   ATIASYEALVSSGLVNKETKMSEDGRIPIDQHNQGIDPDKVGCLIGSGIGSIEDIYETSV 149
            A +A+ EAL+SSG+V+           P + + Q +   +VG   GSGIG ++      +
Sbjct: 1232 ALVATAEALLSSGIVD-----------PYEMY-QYVHVSEVGNCSGSGIGGMKS---HRL 1276

Query: 150  TFDSNTKKNRINPYFVPRILTNMAAGNI-AIKFNLRGPTHSVSTACATGNNAIGDGYNMI 208
            T  +  K++ +    +     N +A  +  +  +  GP  +   ACAT   ++      I
Sbjct: 1277 TRQARMKEDDVQNDILQETFINASAAWVNMLLLSSSGPIKTPVGACATAVESLDYAVETI 1336

Query: 209  KLGMQDICLAGA-SEASVHPLSLAGFLRAKS---------LSPDGISRPFDEERNGFVLG 258
              G   IC+AG   +   H     G + A S           P  + RP    RNGF+  
Sbjct: 1337 LSGKAKICIAGGYDDFEEHVAYEFGNMGATSNHQKEVECGRDPREMCRPATTSRNGFMES 1396

Query: 259  EGAGIVVLESLESAERRGAPILAEIVGYGLSCDAHHITSPPNDGEG---ASRAIKMALDL 315
            +GAGI VL S + A R G PI   IVG   +       S P  G+G    +R I   ++ 
Sbjct: 1397 QGAGIQVLMSAQLAIRMGVPIYG-IVGMTSTASDKIGKSLPAPGKGIMTCARQISGRIES 1455

Query: 316  SHGNVNARDIEYVN 329
               NV  R  +  N
Sbjct: 1456 PSLNVEYRKRQLQN 1469

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 50/114 (43%), Gaps = 3/114 (2%)

Query: 324  DIEYVNAHATSTKLGDNTECCAIQNTLIDNVNRQK--PLYISSNKGSIGHLLGAAGAAES 381
            D+   + H TSTK  +  E   I NT+++++NR +  PL     K   GH  GAAGA   
Sbjct: 1533 DLGVASCHGTSTKANEKNES-QILNTMMEHLNRTEGNPLLTVFQKYLTGHPKGAAGAWMV 1591

Query: 382  IFTILSLYNRTIPHTYNLKNVLGNFESSSMRFVKSQPHKVADLEYALCNSFGFG 435
               +  +    IP   N  N+ G F         S+   V  ++     SFGFG
Sbjct: 1592 NGLLQIMQTGVIPGNRNADNIDGAFSKFEHLLYSSENIDVGTVKATCLTSFGFG 1645

>YPL231W (FAS2) [5218] chr16 (108652..114315) Fatty-acyl-CoA synthase,
            alpha chain, contains acyl carrier protein, beta-ketoacyl
            reductase, and beta-ketoacyl synthase in a single
            polypeptide chain [5664 bp, 1887 aa]
          Length = 1887

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 89/224 (39%), Gaps = 27/224 (12%)

Query: 92   IASYEALVSSGLVNKETKMSEDGRIPIDQHNQGIDPDKVGCLIGSGIGSIEDIYETSVTF 151
            ++  EA ++SG+ +           P + +   +   +VG   GSG+G +  +      F
Sbjct: 1217 VSVVEAFIASGITD-----------PYEMYKY-VHVSEVGNCSGSGMGGVSAL---RGMF 1261

Query: 152  DSNTKKNRI-NPYFVPRILTNMAAGNIAIKFNLRGPTHSVSTACATGNNAIGDGYNMIKL 210
                K   + N       +  M+A    +  +  GP  +   ACAT   ++  G   I  
Sbjct: 1262 KDRFKDEPVQNDILQESFINTMSAWVNMLLISSSGPIKTPVGACATSVESVDIGVETILS 1321

Query: 211  GMQDICLAGASEASVHPLSLA-GFLRAKS---------LSPDGISRPFDEERNGFVLGEG 260
            G   IC+ G  +      S   G ++A S          +P  +SRP    RNGF+  +G
Sbjct: 1322 GKARICIVGGYDDFQEEGSFEFGNMKATSNTLEEFEHGRTPAEMSRPATTTRNGFMEAQG 1381

Query: 261  AGIVVLESLESAERRGAPILAEIVGYGLSCDAHHITSPPNDGEG 304
            AGI ++   + A + G PI   IV    +       S P  G+G
Sbjct: 1382 AGIQIIMQADLALKMGVPIYG-IVAMAATATDKIGRSVPAPGKG 1424

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 46/114 (40%), Gaps = 3/114 (2%)

Query: 324  DIEYVNAHATSTKLGDNTECCAIQNTLIDNVNRQK--PLYISSNKGSIGHLLGAAGAAES 381
            D+   + H TSTK  D  E   I N ++ ++ R +  P+     K   GH  GAAGA   
Sbjct: 1535 DLGVASFHGTSTKANDKNESATI-NEMMKHLGRSEGNPVIGVFQKFLTGHPKGAAGAWMM 1593

Query: 382  IFTILSLYNRTIPHTYNLKNVLGNFESSSMRFVKSQPHKVADLEYALCNSFGFG 435
               +  L +  IP   N  NV    E        S+  K   +      SFGFG
Sbjct: 1594 NGALQILNSGIIPGNRNADNVDKILEQFEYVLYPSKTLKTDGVRAVSITSFGFG 1647

>CAGL0E06138g complement(611598..617249) highly similar to sp|P19097
            Saccharomyces cerevisiae YPL231w FAS2, start by
            similarity
          Length = 1883

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 48/105 (45%), Gaps = 10/105 (9%)

Query: 185  GPTHSVSTACATGNNAIGDGYNMIKLGMQDICLAGASEASVHPLSLA-GFLRAKS----- 238
            GP  +   ACAT   ++  G   I  G   IC+ G  +      S   G ++A S     
Sbjct: 1295 GPIKTPVGACATSVESVDIGVETILSGKAKICIVGGYDDFQEEGSYEFGNMKATSNTLEE 1354

Query: 239  ----LSPDGISRPFDEERNGFVLGEGAGIVVLESLESAERRGAPI 279
                 +P  +SRP    RNGF+  +GAGI V+ + + A + G PI
Sbjct: 1355 FEHGRTPAEMSRPATTSRNGFMEAQGAGIQVIMNADLALKMGVPI 1399

 Score = 35.8 bits (81), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 47/114 (41%), Gaps = 3/114 (2%)

Query: 324  DIEYVNAHATSTKLGDNTECCAIQNTLIDNVNRQK--PLYISSNKGSIGHLLGAAGAAES 381
            D+   + H TSTK  D  E   I N ++ ++ R +  P+     K   GH  GAAGA   
Sbjct: 1534 DLGVASFHGTSTKANDKNESATI-NEMMKHLGRSEGNPVIGVFQKFLTGHPKGAAGAWML 1592

Query: 382  IFTILSLYNRTIPHTYNLKNVLGNFESSSMRFVKSQPHKVADLEYALCNSFGFG 435
               I  L +  +P   N  NV    E        S+  K   ++     SFGFG
Sbjct: 1593 NGAIQILNSGIVPGNRNADNVDKLLEQFDYVLYPSKSIKTDGIKAVSVTSFGFG 1646

>KLLA0C15983g 1389936..1395617 highly similar to sp|P19097
            Saccharomyces cerevisiae YPL231w FAS2 fatty-acyl-CoA
            synthase, alpha chain singleton, start by similarity
          Length = 1893

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/199 (24%), Positives = 81/199 (40%), Gaps = 26/199 (13%)

Query: 92   IASYEALVSSGLVNKETKMSEDGRIPIDQHNQGIDPDKVGCLIGSGIGSIEDIYETSVTF 151
            ++  EA +SSG+ +           P + +   +   +VG   GSG+G +  +      F
Sbjct: 1217 VSVIEAFISSGITD-----------PYEMYKY-VHVSEVGNCSGSGMGGVSAL---RGMF 1261

Query: 152  DSNTKKNRI-NPYFVPRILTNMAAGNIAIKFNLRGPTHSVSTACATGNNAIGDGYNMIKL 210
                K   + N       +  M+A    +  +  GP  +   ACAT   ++  G   I  
Sbjct: 1262 KDRYKDEPVQNDILQESFINTMSAWVNMLLISSSGPIKTPVGACATAVESLDIGVETILS 1321

Query: 211  GMQDICLAGASEASVHPLSLA-GFLRAKS---------LSPDGISRPFDEERNGFVLGEG 260
                IC+ G  +      S   G ++A S          +P  +SRP    RNGF+  +G
Sbjct: 1322 NKAKICIVGGYDDFQEEGSYEFGNMKATSNTLEEYENGRTPAEMSRPTTTTRNGFMEAQG 1381

Query: 261  AGIVVLESLESAERRGAPI 279
            AGI V+ + + A + G PI
Sbjct: 1382 AGIQVIMTADLALKMGVPI 1400

 Score = 33.1 bits (74), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 46/114 (40%), Gaps = 3/114 (2%)

Query: 324  DIEYVNAHATSTKLGDNTECCAIQNTLIDNVNRQK--PLYISSNKGSIGHLLGAAGAAES 381
            D+   + H TSTK  D  E   I N ++ ++ R +  P+     K   GH  GAAGA   
Sbjct: 1535 DLGVASFHGTSTKANDKNESATI-NEMMKHLGRSEGNPVIGVFQKYLTGHPKGAAGAWMM 1593

Query: 382  IFTILSLYNRTIPHTYNLKNVLGNFESSSMRFVKSQPHKVADLEYALCNSFGFG 435
               +  L +  +P   N  NV    E        S   +   ++     SFGFG
Sbjct: 1594 NGALQILNSGIVPGNRNADNVDKLLEQFEYILYPSHSIQTNGIKAVSVTSFGFG 1647

>AFL138W [3057] [Homologous to ScYPL231W (FAS2) - SH]
            complement(171276..176951) [5676 bp, 1891 aa]
          Length = 1891

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 57/220 (25%), Positives = 87/220 (39%), Gaps = 21/220 (9%)

Query: 129  KVGCLIGSGIGSIEDIYETSVTFDSNTKKNRINPYFVPRILTNMAAGNIAIKFNLRGPTH 188
            +VG   GSG+G +  +    +  D    K   N       +  M+A    +  +  GP  
Sbjct: 1245 EVGNCSGSGMGGVSAL--RGMFKDRYKDKPVQNDILQESFINTMSAWVNMLLISSTGPIK 1302

Query: 189  SVSTACATGNNAIGDGYNMIKLGMQDICLAGASEASVHPLSLA-GFLRAKSLS------- 240
            +   ACAT   ++  G   I  G   IC+ G  +      S   G + A S S       
Sbjct: 1303 TPVGACATAVESMDIGVETILSGKAKICIVGGYDDFQEEGSFEFGSMNATSNSLEEFEHG 1362

Query: 241  --PDGISRPFDEERNGFVLGEGAGIVVLESLESAERRGAPILAEIVGYGLSCDAHHITSP 298
              P  +SRP    R+GF+  +GAGI ++ + + A + G PI   IV    +       S 
Sbjct: 1363 RTPAEMSRPTTTTRSGFMEAQGAGIQIIMNADLALKMGVPIYG-IVALTATATDKIGRSV 1421

Query: 299  PNDGEGASRAIKMALDLSHGNVN----ARDIEYVNAHATS 334
            P  G+G    I       HG++       DI+Y   H T+
Sbjct: 1422 PAPGQG----ILTTAREHHGSMKYPSPLLDIKYRKRHLTA 1457

 Score = 35.4 bits (80), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 46/114 (40%), Gaps = 3/114 (2%)

Query: 324  DIEYVNAHATSTKLGDNTECCAIQNTLIDNVNRQK--PLYISSNKGSIGHLLGAAGAAES 381
            D+   + H TSTK  D  E   I N ++ ++ R +  P+     K   GH  GAAGA   
Sbjct: 1538 DLGVASFHGTSTKANDKNESATI-NQMLKHLGRSEGNPIIGVFQKYLTGHPKGAAGAWMM 1596

Query: 382  IFTILSLYNRTIPHTYNLKNVLGNFESSSMRFVKSQPHKVADLEYALCNSFGFG 435
               I  L +  +P   N  N+    E        S   K   ++     SFGFG
Sbjct: 1597 NGAIQILNSGIVPGNRNADNIDEVMEQFEYILYPSHSIKTDGIKAVSVTSFGFG 1650

>Kwal_56.24248
          Length = 877

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 81/199 (40%), Gaps = 26/199 (13%)

Query: 92  IASYEALVSSGLVNKETKMSEDGRIPIDQHNQGIDPDKVGCLIGSGIGSIEDIYETSVTF 151
           ++  EA +SSG+ +           P + + Q +   +VG   GSG+G +  +      F
Sbjct: 206 VSVVEAFISSGITD-----------PYEMY-QYVHVSEVGNCSGSGMGGVSAL---RGMF 250

Query: 152 DSNTKKNRI-NPYFVPRILTNMAAGNIAIKFNLRGPTHSVSTACATGNNAIGDGYNMIKL 210
               K   + N       +  M+A    +  +  GP  +   ACAT   ++  G   I  
Sbjct: 251 KDRYKDQPVQNDILQESFINTMSAWVNMLLISSSGPIKTPVGACATAVESLDVGVETILS 310

Query: 211 GMQDICLAGASEASVHPLSLA-GFLRAKSLS---------PDGISRPFDEERNGFVLGEG 260
           G   IC+ G  +      S   G + A S S         P  +SRP    RNGF+  +G
Sbjct: 311 GKAKICIVGGYDDFQEEGSYEFGNMGATSNSLDEFDHGRTPAEMSRPATTSRNGFMEAQG 370

Query: 261 AGIVVLESLESAERRGAPI 279
           +G+ V+ + + A   G PI
Sbjct: 371 SGMQVIMNADLALNMGVPI 389

 Score = 33.9 bits (76), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 46/114 (40%), Gaps = 3/114 (2%)

Query: 324 DIEYVNAHATSTKLGDNTECCAIQNTLIDNVNRQK--PLYISSNKGSIGHLLGAAGAAES 381
           DI   + H TSTK  D  E   I N ++ ++ R +  P+     K   GH  G AGA   
Sbjct: 524 DIGVASFHGTSTKANDKNESATI-NKMMKHLGRSEGNPVLGVFQKYLTGHPKGPAGAWML 582

Query: 382 IFTILSLYNRTIPHTYNLKNVLGNFESSSMRFVKSQPHKVADLEYALCNSFGFG 435
              +  L +  +P   N  NV    E        S+  K   ++     SFGFG
Sbjct: 583 NGGLQILNSGIVPGNRNADNVDKVMEQFEYILYPSRSIKTDGIKAVSVTSFGFG 636

>Scas_630.25
          Length = 582

 Score = 33.9 bits (76), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 30/60 (50%)

Query: 351 IDNVNRQKPLYISSNKGSIGHLLGAAGAAESIFTILSLYNRTIPHTYNLKNVLGNFESSS 410
           + N+  Q P     NK  + +LL     A S+ TI + Y  ++PH   ++  +G FE+ S
Sbjct: 181 VGNIIFQLPFLFYLNKIPLNYLLPGLDMAWSLLTIGAAYVNSVPHLKAIRFFIGGFEAPS 240

>YAL067C (SEO1) [2] chr1 complement(7236..9017) Member of the
           allantoate permease family of the major facilitator
           superfamily (MFS) [1782 bp, 593 aa]
          Length = 593

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 31/60 (51%)

Query: 351 IDNVNRQKPLYISSNKGSIGHLLGAAGAAESIFTILSLYNRTIPHTYNLKNVLGNFESSS 410
           + N+  Q P  I  NK  + ++L +     S+ T+ + Y  ++PH   ++  +G FE+ S
Sbjct: 185 VGNIIFQLPFLIYLNKLPLNYVLPSLDLCWSLLTVGAAYVNSVPHLKAIRFFIGAFEAPS 244

>YNL224C (YNL224C) [4380] chr14 complement(224795..227098) Nucleolar
           protein that may be involved in cell cycle control [2304
           bp, 767 aa]
          Length = 767

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 36/75 (48%), Gaps = 3/75 (4%)

Query: 288 LSCDAHHITSPPNDGEGASRAIKMALDLSHGNVNARDIEYVNAHATSTKLGDNTECCAIQ 347
           LS +   +T PP D  G    +K+A    H N+ +  I   N  +   +    T+  +  
Sbjct: 608 LSRNNDRLTFPPLDPHGNKTVMKIA---KHYNMKSSKIGKANHTSVVVEKIKKTKWSSPN 664

Query: 348 NTLIDNVNRQKPLYI 362
            +LID + RQ+P+++
Sbjct: 665 YSLIDQLMRQRPVFM 679

>YER051W (YER051W) [1479] chr5 (254655..256133) Protein containing a
           PHD-finger, which may be involved in chromatin-mediated
           transcriptional regulation, and a Jumonji (jmjC) domain,
           has low similarity to uncharacterized C. albicans
           Orf6.8281p [1479 bp, 492 aa]
          Length = 492

 Score = 30.4 bits (67), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 37/78 (47%), Gaps = 4/78 (5%)

Query: 263 IVVLESLESAERRGA-PILAEIVGY---GLSCDAHHITSPPNDGEGASRAIKMALDLSHG 318
           IV +E L    RR   P   +++G     L+ D + ITS  +DG+  SR    A+   H 
Sbjct: 404 IVEIEKLTKVPRRFTFPKFDQVMGKLCEYLALDKNKITSDVSDGDLLSRTTNCAIQSLHA 463

Query: 319 NVNARDIEYVNAHATSTK 336
            V   +++Y   + TS K
Sbjct: 464 YVIKPEVKYKPLNFTSKK 481

>YPL028W (ERG10) [5410] chr16 (498092..499288) Acetyl-CoA
           acetyltransferase (acetoacetyl-CoA thiolase), catalyzes
           the first step in mevalonate/sterol pathway [1197 bp,
           398 aa]
          Length = 398

 Score = 30.0 bits (66), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 37/76 (48%), Gaps = 6/76 (7%)

Query: 189 SVSTACATGNNAIGDGYNMIKLGMQDICLAGASEASVH-----PLSLAGFLRAKSLSPDG 243
           +V+  CA+   AI  G   IK G  D+ +AG  E+  +     P + AG    +++  DG
Sbjct: 86  TVNKVCASAMKAIILGAQSIKCGNADVVVAGGCESMTNAPYYMPAARAGAKFGQTVLVDG 145

Query: 244 ISRP-FDEERNGFVLG 258
           + R   ++  +G  +G
Sbjct: 146 VERDGLNDAYDGLAMG 161

>Sklu_1761.2 YPL028W, Contig c1761 1942-3141
          Length = 399

 Score = 30.0 bits (66), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 5/63 (7%)

Query: 189 SVSTACATGNNAIGDGYNMIKLGMQDICLAGASEASVH-----PLSLAGFLRAKSLSPDG 243
           +V+  CA+G  AI  G   IK G  DI +AG +E+  +     P + +G    ++   DG
Sbjct: 87  TVNKVCASGMKAIICGAQTIKCGNADIVVAGGAESMTNAPYYLPSARSGARFGETKLIDG 146

Query: 244 ISR 246
           I R
Sbjct: 147 IQR 149

>CAGL0L12364g complement(1334642..1335838) highly similar to
           sp|P41338 Saccharomyces cerevisiae YPL028w acetyl-CoA
           C-acetyltransferase, start by similarity
          Length = 398

 Score = 29.3 bits (64), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 5/63 (7%)

Query: 189 SVSTACATGNNAIGDGYNMIKLGMQDICLAGASEASVH-----PLSLAGFLRAKSLSPDG 243
           SV+  CA+   +I  G   IK G  D+ +AG  E+  +     P + AG    ++   DG
Sbjct: 86  SVNKVCASAMKSIILGAQAIKCGTADVVIAGGCESMTNAPYYMPAARAGARFGETKMVDG 145

Query: 244 ISR 246
           I R
Sbjct: 146 IQR 148

>Sklu_2362.1 YDR342C, Contig c2362 924-2642
          Length = 572

 Score = 29.3 bits (64), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 3/58 (5%)

Query: 124 GIDPDKVGCLIGSGIG--SIEDIYETSVTFDSNTKKNRINPYFVPRILTNMAAGNIAI 179
           GI   K+G L G  IG  S+  +Y  SV   S    ++   YF+ RI++ +  G IA+
Sbjct: 135 GIILSKIGDLYGRRIGLMSVILVYVVSVII-SIAASDKWYQYFIGRIISGLGVGGIAV 191

>YOL156W (HXT11) [4669] chr15 (25272..26975) Low-affinity glucose
           permease, member of the hexose transporter family of the
           major facilitator superfamily (MFS), may be involved in
           uptake of drugs [1704 bp, 567 aa]
          Length = 567

 Score = 29.3 bits (64), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 3/58 (5%)

Query: 124 GIDPDKVGCLIGSGIG--SIEDIYETSVTFDSNTKKNRINPYFVPRILTNMAAGNIAI 179
           GI   KVG + G  IG  ++  IY   +     T  N+   YF+ RI++ +  G IA+
Sbjct: 126 GIVLSKVGDIYGRRIGLITVTAIYVVGILIQI-TSINKWYQYFIGRIISGLGVGGIAV 182

>KLLA0D12056g 1029222..1030418 highly similar to sp|P41338
           Saccharomyces cerevisiae YPL028w ERG10 acetyl-CoA
           C-acetyltransferase, cytosolic, start by similarity
          Length = 398

 Score = 28.9 bits (63), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 21/35 (60%)

Query: 189 SVSTACATGNNAIGDGYNMIKLGMQDICLAGASEA 223
           +V+  CA+G  AI  G   IK G  DI +AG +E+
Sbjct: 85  TVNKVCASGMKAIILGAQAIKTGSADIIVAGGAES 119

>YJL219W (HXT9) [2711] chr10 (19497..21200) Member of the hexose
           transporter family of the major facilitator superfamily
           (MFS), may play a role in drug uptake [1704 bp, 567 aa]
          Length = 567

 Score = 28.9 bits (63), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 3/58 (5%)

Query: 124 GIDPDKVGCLIGSGIG--SIEDIYETSVTFDSNTKKNRINPYFVPRILTNMAAGNIAI 179
           GI   KVG + G  IG  ++  IY   +     T  N+   YF+ RI++ +  G IA+
Sbjct: 126 GIVLSKVGDIYGRRIGLITVTAIYVVGILIQI-TSINKWYQYFIGRIISGLGVGGIAV 182

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.134    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,992,530
Number of extensions: 592723
Number of successful extensions: 1516
Number of sequences better than 10.0: 29
Number of HSP's gapped: 1504
Number of HSP's successfully gapped: 35
Length of query: 441
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 336
Effective length of database: 12,961,219
Effective search space: 4354969584
Effective search space used: 4354969584
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)