Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0J02948g51550725200.0
Scas_715.4953250418030.0
YER060W (FCY21)52850717810.0
CAGL0L00671g54352117390.0
Scas_704.3654550617370.0
YER056C (FCY2)53350717230.0
Scas_715.47d53352616980.0
YER060W-A (FCY22)53051916680.0
Sklu_1893.251351116260.0
Kwal_23.581951650615540.0
KLLA0C08283g51950815050.0
Kwal_34.1573051850914620.0
CAGL0C00231g54050514550.0
Scas_715.47d152350414400.0
ADL074W52450613530.0
Scas_715.54d2322085565e-68
Kwal_47.172165425085388e-62
KLLA0D05060g5234955192e-59
YGL186C (TPN1)5795584654e-51
Scas_710.305844154294e-46
CAGL0L06138g6314763981e-41
Scas_701.168602083e-20
Scas_690.1*636842211e-18
CAGL0F02717g154256702.2
Sklu_2364.621967646.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J02948g
         (507 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J02948g 282559..284106 highly similar to sp|P40039 Saccharo...   975   0.0  
Scas_715.49                                                           699   0.0  
YER060W (FCY21) [1490] chr5 (274565..276151) Protein with simila...   690   0.0  
CAGL0L00671g 83129..84760 highly similar to sp|P17064 Saccharomy...   674   0.0  
Scas_704.36                                                           673   0.0  
YER056C (FCY2) [1485] chr5 complement(266511..268112) Cytosine/p...   668   0.0  
Scas_715.47d                                                          658   0.0  
YER060W-A (FCY22) [1491] chr5 (276570..278162) Purine/cytosine p...   647   0.0  
Sklu_1893.2 YER056C, Contig c1893 1725-3266                           630   0.0  
Kwal_23.5819                                                          603   0.0  
KLLA0C08283g complement(725563..727122) similar to sp|P17064 Sac...   584   0.0  
Kwal_34.15730                                                         567   0.0  
CAGL0C00231g 15916..17538 similar to sp|P40039 Saccharomyces cer...   565   0.0  
Scas_715.47d1                                                         559   0.0  
ADL074W [1667] [Homologous to ScYER056C (FCY2) - SH] complement(...   525   0.0  
Scas_715.54d                                                          218   5e-68
Kwal_47.17216                                                         211   8e-62
KLLA0D05060g 436335..437906 similar to sp|P53099 Saccharomyces c...   204   2e-59
YGL186C (TPN1) [1806] chr7 complement(151041..152780) Member of ...   183   4e-51
Scas_710.30                                                           169   4e-46
CAGL0L06138g 695566..697461 similar to sp|P53099 Saccharomyces c...   157   1e-41
Scas_701.1                                                             85   3e-20
Scas_690.1*                                                            90   1e-18
CAGL0F02717g 261361..265989 tr|O74208 Candida glabrata ATP-bindi...    32   2.2  
Sklu_2364.6 YAR002C-A, Contig c2364 10693-11352                        29   6.8  

>CAGL0J02948g 282559..284106 highly similar to sp|P40039
           Saccharomyces cerevisiae YER060w or sp|P17064
           Saccharomyces cerevisiae YER056c FCY2, hypothetical
           start
          Length = 515

 Score =  975 bits (2520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/507 (94%), Positives = 481/507 (94%)

Query: 1   MSYEDKKDLYDMEMQVESSANSHVETDGYNDATVLETKLSLLNRLAAMISAETKGIEPIT 60
           MSYEDKKDLYDMEMQVESSANSHVETDGYNDATVLETKLSLLNRLAAMISAETKGIEPIT
Sbjct: 1   MSYEDKKDLYDMEMQVESSANSHVETDGYNDATVLETKLSLLNRLAAMISAETKGIEPIT 60

Query: 61  DDEKNDDSLINAASMWFSANMVXXXXXXXXXXXXVFGLNFGVSVLTIVFFNILGLFAVAF 120
           DDEKNDDSLINAASMWFSANMV            VFGLNFGVSVLTIVFFNILGLFAVAF
Sbjct: 61  DDEKNDDSLINAASMWFSANMVLPALAIGGLGPLVFGLNFGVSVLTIVFFNILGLFAVAF 120

Query: 121 FSVFGAKFGLRQMVLSRYLVGNITARIFALINSVACVGWGIVNTVAASQLLNEINPGSHQ 180
           FSVFGAKFGLRQMVLSRYLVGNITARIFALINSVACVGWGIVNTVAASQLLNEINPGSHQ
Sbjct: 121 FSVFGAKFGLRQMVLSRYLVGNITARIFALINSVACVGWGIVNTVAASQLLNEINPGSHQ 180

Query: 181 LPLWGGCLVIIGATILVSFFGYKVIHTYEKYSWVPNFAVFLVLIARLKISGKFHNGAWGS 240
           LPLWGGCLVIIGATILVSFFGYKVIHTYEKYSWVPNFAVFLVLIARLKISGKFHNGAWGS
Sbjct: 181 LPLWGGCLVIIGATILVSFFGYKVIHTYEKYSWVPNFAVFLVLIARLKISGKFHNGAWGS 240

Query: 241 GPTTAGSVLSFGSAVFGFASGWTTYAADYTVYMPRNTNSYKIFFALVAGLAFPLFFTMIL 300
           GPTTAGSVLSFGSAVFGFASGWTTYAADYTVYMPRNTNSYKIFFALVAGLAFPLFFTMIL
Sbjct: 241 GPTTAGSVLSFGSAVFGFASGWTTYAADYTVYMPRNTNSYKIFFALVAGLAFPLFFTMIL 300

Query: 301 GSACAQAAVDYTPWQEFYNKNGMGGLTFAILVPDSLHGFGQFCCVVLAMSTIANNVPNMY 360
           GSACAQAAVDYTPWQEFYNKNGMGGLTFAILVPDSLHGFGQFCCVVLAMSTIANNVPNMY
Sbjct: 301 GSACAQAAVDYTPWQEFYNKNGMGGLTFAILVPDSLHGFGQFCCVVLAMSTIANNVPNMY 360

Query: 361 TIALSAQSVWDPFAKIPRVVWTMIGNLAALGISIPACYYFSTFMQYFMDXXXXXXXXXXX 420
           TIALSAQSVWDPFAKIPRVVWTMIGNLAALGISIPACYYFSTFMQYFMD           
Sbjct: 361 TIALSAQSVWDPFAKIPRVVWTMIGNLAALGISIPACYYFSTFMQYFMDSIAYYLSIYIS 420

Query: 421 XXXCEHLIYRHNSFSNYNVEDWNNFKKLPIGIAGTISLVVGAFGVALGMSQSYWVGEIAR 480
              CEHLIYRHNSFSNYNVEDWNNFKKLPIGIAGTISLVVGAFGVALGMSQSYWVGEIAR
Sbjct: 421 IALCEHLIYRHNSFSNYNVEDWNNFKKLPIGIAGTISLVVGAFGVALGMSQSYWVGEIAR 480

Query: 481 HIGEYGGDIAIELGAGWAFIAYNICRP 507
           HIGEYGGDIAIELGAGWAFIAYNICRP
Sbjct: 481 HIGEYGGDIAIELGAGWAFIAYNICRP 507

>Scas_715.49
          Length = 532

 Score =  699 bits (1803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/504 (67%), Positives = 397/504 (78%), Gaps = 3/504 (0%)

Query: 4   EDKKDLYDMEMQVESSANSHVETDGYNDATVLETKLSLLNRLAAMISAETKGIEPITDDE 63
            + KDL      +  S++ +V+ D +    VLETKL+L NR+AA +SAETKGIEPITD+E
Sbjct: 24  RNSKDLKSPSKNL--SSDYYVDIDSHASEEVLETKLNLFNRIAAGLSAETKGIEPITDEE 81

Query: 64  KNDDSLINAASMWFSANMVXXXXXXXXXXXXVFGLNFGVSVLTIVFFNILGLFAVAFFSV 123
           KND SL+NAASMWFSANMV            VFGLNFG S L I+FFNILGL  VAFFS+
Sbjct: 82  KNDASLLNAASMWFSANMVIAAYAIGGLGPLVFGLNFGTSTLVIIFFNILGLLPVAFFSI 141

Query: 124 FGAKFGLRQMVLSRYLVGNITARIFALINSVACVGWGIVNTVAASQLLNEINPGSHQLPL 183
           FGAK GLRQMVLSR+L+GN TARIF++INSVACVGWGIVNTVA+SQLLN +N G H+ PL
Sbjct: 142 FGAKLGLRQMVLSRFLIGNSTARIFSVINSVACVGWGIVNTVASSQLLNMVNQGPHKCPL 201

Query: 184 WGGCLVIIGATILVSFFGYKVIHTYEKYSWVPNFAVFLVLIARLKISGKFHNGAWGSGPT 243
           W GC+VIIGATIL++FFGY+VIH++EK+ WVPNFA FLV+IARL  SG F NG W SGPT
Sbjct: 202 WAGCIVIIGATILITFFGYRVIHSFEKWIWVPNFACFLVIIARLAKSGNFSNGEWTSGPT 261

Query: 244 TAGSVLSFGSAVFGFASGWTTYAADYTVYMPRNTNSYKIFFALVAGLAFPLFFTMILGSA 303
           TAG+VLSFGSAVFGFA+GWTTYAADYTVYMPRNTN +KIFF+LVAGL+FPLFF MILG+A
Sbjct: 262 TAGNVLSFGSAVFGFATGWTTYAADYTVYMPRNTNKFKIFFSLVAGLSFPLFFVMILGAA 321

Query: 304 CAQAAVDYTPWQEFYNKNGMGGLTFAILVPDSLHGFGQFCCVVLAMSTIANNVPNMYTIA 363
            A  AV+   W  +Y++NGMGGLT+AILVP+SLHGFG+FCCVVL++S +ANNVPNMYTIA
Sbjct: 322 SAMGAVNNPDWANYYSENGMGGLTYAILVPNSLHGFGEFCCVVLSISIVANNVPNMYTIA 381

Query: 364 LSAQSVWDPFAKIPRVVWTMIGNLAALGISIPACYYFSTFMQYFMDXXXXXXXXXXXXXX 423
           LS Q++W P AKIPRV WTM GN A LGI+IPACY+F TFM+YFMD              
Sbjct: 382 LSVQAIWAPLAKIPRVFWTMAGNFATLGIAIPACYFFDTFMEYFMDSIAYYLAIYISIAL 441

Query: 424 CEHLIYRHNSFSNYNVEDWNNFKKLPIGIAGTISLVVGAFGVALGMSQSYWVGEIARHIG 483
            EH IYR  SF  YNVEDW++  KLPIGIAG  +  VG  GVALGM Q+YW G+I R IG
Sbjct: 442 SEHFIYRR-SFEAYNVEDWDDNSKLPIGIAGCCAFGVGVIGVALGMCQTYWTGQIGRLIG 500

Query: 484 EYGGDIAIELGAGWAFIAYNICRP 507
           EYGGD+  ELGAGW+FI YN+ RP
Sbjct: 501 EYGGDLGFELGAGWSFIVYNLVRP 524

>YER060W (FCY21) [1490] chr5 (274565..276151) Protein with
           similarity to Fcy2p, member of the purine/cytosine
           family of secondary active transporters [1587 bp, 528
           aa]
          Length = 528

 Score =  690 bits (1781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/507 (65%), Positives = 403/507 (79%), Gaps = 7/507 (1%)

Query: 6   KKDLYDMEMQVE-----SSANSHVETDGYNDATVLETKLSLLNRLAAMISAETKGIEPIT 60
           K +L D+E +       S+   + + + +    ++E KLS LNR+AA +SAETKGIEPIT
Sbjct: 16  KYELKDLESRAHDAKTPSTNEFYDDVESHGTEELVEAKLSFLNRIAAGLSAETKGIEPIT 75

Query: 61  DDEKNDDSLINAASMWFSANMVXXXXXXXXXXXXVFGLNFGVSVLTIVFFNILGLFAVAF 120
           +DEK DDS++NAASMWFSANMV            VF LNFG SV  I+FFN+LGL +VAF
Sbjct: 76  EDEKTDDSILNAASMWFSANMVLPAYAIGALGPMVFDLNFGQSVFVIIFFNLLGLVSVAF 135

Query: 121 FSVFGAKFGLRQMVLSRYLVGNITARIFALINSVACVGWGIVNTVAASQLLNEINPGSHQ 180
           FSVFGA+ GLRQM+LSRYLVGNI ARIF+ IN +AC+GWGIVNTVA+SQ+LN +NPG HQ
Sbjct: 136 FSVFGAELGLRQMILSRYLVGNIAARIFSFINFIACIGWGIVNTVASSQVLNMVNPG-HQ 194

Query: 181 LPLWGGCLVIIGATILVSFFGYKVIHTYEKYSWVPNFAVFLVLIARLKISGKFHNGAWGS 240
            PLW GC+VIIGAT++V+FFGY VIH YEK++WVPNFAVFLV+IARL  S KF  G W S
Sbjct: 195 CPLWAGCIVIIGATVIVTFFGYGVIHAYEKWAWVPNFAVFLVIIARLARSKKFVLGEWTS 254

Query: 241 GPTTAGSVLSFGSAVFGFASGWTTYAADYTVYMPRNTNSYKIFFALVAGLAFPLFFTMIL 300
           GPTTAG+VLSFGS V+GFA+GWTTYAADYTVYMPR TN YKIFF+LV GLA PL+FTMIL
Sbjct: 255 GPTTAGNVLSFGSTVYGFAAGWTTYAADYTVYMPRKTNKYKIFFSLVVGLATPLYFTMIL 314

Query: 301 GSACAQAAVDYTPWQEFYNKNGMGGLTFAILVPDSLHGFGQFCCVVLAMSTIANNVPNMY 360
           G+A A AA+    W+ +Y++N +GGLTFA+LVP+S+HGFGQFCCV+L++STIANNVPNMY
Sbjct: 315 GAAVAMAAIGDPAWKTYYDENSIGGLTFAVLVPNSVHGFGQFCCVLLSLSTIANNVPNMY 374

Query: 361 TIALSAQSVWDPFAKIPRVVWTMIGNLAALGISIPACYYFSTFMQYFMDXXXXXXXXXXX 420
           TIALS Q+ W+P AK+PRV+WT++GN AALGI+IPACYYFSTFM YFMD           
Sbjct: 375 TIALSVQATWEPLAKVPRVIWTLLGNAAALGIAIPACYYFSTFMNYFMDSIGYYLAIYIA 434

Query: 421 XXXCEHLIYRHNSFSNYNVEDWNNFKKLPIGIAGTISLVVGAFGVALGMSQSYWVGEIAR 480
               EH IYR  SFS YNV+DW+++++LPIGIAGT +L+VGAFGVALGM Q+YWVGEI+R
Sbjct: 435 IACSEHFIYRR-SFSAYNVDDWDSWERLPIGIAGTAALIVGAFGVALGMCQTYWVGEISR 493

Query: 481 HIGEYGGDIAIELGAGWAFIAYNICRP 507
            IG+YGGDI  ELG  WAFI YNI RP
Sbjct: 494 LIGDYGGDIGFELGLSWAFIVYNIARP 520

>CAGL0L00671g 83129..84760 highly similar to sp|P17064 Saccharomyces
           cerevisiae YER056c FCY2 purine-cytosine permease or
           sp|P40039 Saccharomyces cerevisiae YER060w FCY21,
           hypothetical start
          Length = 543

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/521 (63%), Positives = 403/521 (77%), Gaps = 16/521 (3%)

Query: 2   SYEDKKDLYDMEMQ-VESSANSHVETDG----YND--------ATVLETKLSL--LNRLA 46
           S+ +  +L ++E Q VE    ++V T+     Y D        ATV ETKL L  ++RLA
Sbjct: 16  SHSNDYELNEVEKQPVEDVKTTNVNTNDFEYDYGDDFTNSSEAATVEETKLKLGFISRLA 75

Query: 47  AMISAETKGIEPITDDEKNDDSLINAASMWFSANMVXXXXXXXXXXXXVFGLNFGVSVLT 106
             ++AETKG+EP+TD+EK DDS++NAASMWFSAN+V            VF LNFG SVLT
Sbjct: 76  LKMNAETKGVEPVTDEEKTDDSVLNAASMWFSANLVLASYALGALGPIVFRLNFGTSVLT 135

Query: 107 IVFFNILGLFAVAFFSVFGAKFGLRQMVLSRYLVGNITARIFALINSVACVGWGIVNTVA 166
           IVFFN++GL +VAFFSVFGA+FGLRQM+LSR+LVGN+TAR+FA IN VACVGWG+VNTV 
Sbjct: 136 IVFFNMIGLVSVAFFSVFGAEFGLRQMILSRFLVGNVTARVFAAINVVACVGWGVVNTVV 195

Query: 167 ASQLLNEINPGSHQLPLWGGCLVIIGATILVSFFGYKVIHTYEKYSWVPNFAVFLVLIAR 226
           A+QLL+ +N GSHQLPLWGGCLVI+G T++V+FFGY +IH YE++SWVPNFAVFLV+IAR
Sbjct: 196 AAQLLHIVNQGSHQLPLWGGCLVIVGGTVMVTFFGYSIIHAYERWSWVPNFAVFLVIIAR 255

Query: 227 LKISGKFHNGAWGSGPTTAGSVLSFGSAVFGFASGWTTYAADYTVYMPRNTNSYKIFFAL 286
           L  SG+F NG W SG TTAG VLSFGSA++GFA+GWTTYAADYTVYMPR  N +KIFF L
Sbjct: 256 LHKSGQFSNGPWTSGATTAGGVLSFGSAIYGFAAGWTTYAADYTVYMPRTMNKFKIFFFL 315

Query: 287 VAGLAFPLFFTMILGSACAQAAVDYTPWQEFYNKNGMGGLTFAILVPDSLHGFGQFCCVV 346
            AGLAFPL FTMILG+A A  AV+   W   Y+K+ MGGLT+AILVP+SLHGFG+FCCV+
Sbjct: 316 CAGLAFPLLFTMILGAASAMGAVNNPEWMALYDKDNMGGLTYAILVPNSLHGFGEFCCVL 375

Query: 347 LAMSTIANNVPNMYTIALSAQSVWDPFAKIPRVVWTMIGNLAALGISIPACYYFSTFMQY 406
           LAMSTIANN+PNMYTIALS Q++++PF+++PRVVWT+ GN A +GISIPA YYF  F++ 
Sbjct: 376 LAMSTIANNIPNMYTIALSVQALYEPFSRVPRVVWTLAGNAAVVGISIPASYYFEGFLEN 435

Query: 407 FMDXXXXXXXXXXXXXXCEHLIYRHNSFSNYNVEDWNNFKKLPIGIAGTISLVVGAFGVA 466
           FMD               EH IYR   F  YN+EDWNN+ +LPIGIAG  +L VGAFGVA
Sbjct: 436 FMDSIGYYLAIYIAISLSEHFIYRR-GFKGYNIEDWNNWDRLPIGIAGCSALFVGAFGVA 494

Query: 467 LGMSQSYWVGEIARHIGEYGGDIAIELGAGWAFIAYNICRP 507
           LGMSQ+YW GEI+RHIG++GGDI  ELG  WAFI +NI RP
Sbjct: 495 LGMSQTYWTGEISRHIGKHGGDIGFELGMSWAFIVFNIVRP 535

>Scas_704.36
          Length = 545

 Score =  673 bits (1737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/506 (64%), Positives = 389/506 (76%), Gaps = 2/506 (0%)

Query: 2   SYEDKKDLYDMEMQVESSANSHVETDGYNDATVLETKLSLLNRLAAMISAETKGIEPITD 61
           S+ +K    D+++          E+    +  + ETKLS  NR  A ++AETKG+EP+TD
Sbjct: 34  SFGEKASSADIKVIPGVPDYDEYESIQEPETYMEETKLSFFNRFVASLNAETKGVEPVTD 93

Query: 62  DEKNDDSLINAASMWFSANMVXXXXXXXXXXXXVFGLNFGVSVLTIVFFNILGLFAVAFF 121
           +EK DDS+INAASMWFSAN+V            VF LNFG SVL I+FFNILGL ++AFF
Sbjct: 94  EEKTDDSIINAASMWFSANLVIASYALGGLGPIVFNLNFGTSVLVIIFFNILGLLSIAFF 153

Query: 122 SVFGAKFGLRQMVLSRYLVGNITARIFALINSVACVGWGIVNTVAASQLLNEINPGSHQL 181
           SVFGA+FGLRQM+LSRYL+GNITARIFA+IN +ACVGWG+VNTVA+SQLLN +N   +  
Sbjct: 154 SVFGAEFGLRQMILSRYLLGNITARIFAIINIIACVGWGVVNTVASSQLLNMVNT-PNNC 212

Query: 182 PLWGGCLVIIGATILVSFFGYKVIHTYEKYSWVPNFAVFLVLIARLKISGKFHNGAWGSG 241
           PLW GCL+I+G T+LV+FFGY VIH YEK+SWVPNFAVFLV+IARLK+SG F  G W SG
Sbjct: 213 PLWAGCLIIVGCTVLVTFFGYNVIHAYEKWSWVPNFAVFLVIIARLKMSGAFTGGEWTSG 272

Query: 242 PTTAGSVLSFGSAVFGFASGWTTYAADYTVYMPRNTNSYKIFFALVAGLAFPLFFTMILG 301
           PTTAG+VLSFG AVFGFA+GWTTYAADYTVYMPR+TN Y IFF+L AGL+ PLFFTMILG
Sbjct: 273 PTTAGNVLSFGGAVFGFAAGWTTYAADYTVYMPRSTNKYTIFFSLTAGLSLPLFFTMILG 332

Query: 302 SACAQAAVDYTPWQEFYNKNGMGGLTFAILVPDSLHGFGQFCCVVLAMSTIANNVPNMYT 361
           +A A  AV+   W  +Y  NGMGG+T+AILVPDSLHGFGQFCCV+LAMST+ANN+PNMYT
Sbjct: 333 AASAMGAVNNPDWMNYYKSNGMGGVTYAILVPDSLHGFGQFCCVLLAMSTVANNIPNMYT 392

Query: 362 IALSAQSVWDPFAKIPRVVWTMIGNLAALGISIPACYYFSTFMQYFMDXXXXXXXXXXXX 421
           IALS Q+++ PF+K+PRV WTM GN   LGISI ACYYF  FM+ FM+            
Sbjct: 393 IALSVQALYQPFSKVPRVAWTMAGNAFTLGISIAACYYFQGFMENFMNSIGYYLAIYIAI 452

Query: 422 XXCEHLIYRHNSFSNYNVEDWNNFKKLPIGIAGTISLVVGAFGVALGMSQSYWVGEIARH 481
              EH IYR   F  YNVEDWN + KLPIGIAGT +L+VGAFGVALGMSQSYWVGEI + 
Sbjct: 453 SLSEHFIYRK-GFQGYNVEDWNTWSKLPIGIAGTSALIVGAFGVALGMSQSYWVGEIGKL 511

Query: 482 IGEYGGDIAIELGAGWAFIAYNICRP 507
           IG++GGDI  ELGA WAFI YN+ RP
Sbjct: 512 IGDHGGDIGFELGASWAFIVYNVLRP 537

>YER056C (FCY2) [1485] chr5 complement(266511..268112)
           Cytosine/purine permease, member of the purine/cytosine
           permease family of membrane transporters [1602 bp, 533
           aa]
          Length = 533

 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/507 (64%), Positives = 394/507 (77%), Gaps = 6/507 (1%)

Query: 2   SYEDKKDLYDMEMQVESSANSHVETDGYNDATVLETKLSLLNRLAAMISAETKGIEPITD 61
           S E++K +   E    +S +        ++AT    KLS  ++  A ++AETKG+EP+T+
Sbjct: 24  SLENEKKVAASETFTATSEDDQQYIVESSEAT----KLSWFHKFFASLNAETKGVEPVTE 79

Query: 62  DEKNDDSLINAASMWFSANMVXXXXXXXXXXXXVFGLNFGVSVLTIVFFNILGLFAVAFF 121
           DEK DDS++NAASMWFSANMV            VFGLNFG SVL I+FFNI+GL  VAFF
Sbjct: 80  DEKTDDSILNAASMWFSANMVIASYALGALGPMVFGLNFGQSVLVIIFFNIMGLIFVAFF 139

Query: 122 SVFGAKFGLRQMVLSRYLVGNITARIFALINSVACVGWGIVNTVAASQLLNEINPGS-HQ 180
           SVFGA+ GLRQM+LSRYLVGN+TARIF+LIN +ACVGWGIVNT  ++QLLN +N GS H 
Sbjct: 140 SVFGAELGLRQMILSRYLVGNVTARIFSLINVIACVGWGIVNTSVSAQLLNMVNEGSGHV 199

Query: 181 LPLWGGCLVIIGATILVSFFGYKVIHTYEKYSWVPNFAVFLVLIARLKISGKFHNGAWGS 240
            P+W GCL+IIG T+LV+FFGY VIH YEK+SWVPNFAVFLV+IA+L  SGKF  G W  
Sbjct: 200 CPIWAGCLIIIGGTVLVTFFGYSVIHAYEKWSWVPNFAVFLVIIAQLSRSGKFKGGEWVG 259

Query: 241 GPTTAGSVLSFGSAVFGFASGWTTYAADYTVYMPRNTNSYKIFFALVAGLAFPLFFTMIL 300
           G TTAGSVLSFGS++FGFA+GWTTYAADYTVYMP++TN YKIFF+LVAGLAFPLFFTMIL
Sbjct: 260 GATTAGSVLSFGSSIFGFAAGWTTYAADYTVYMPKSTNKYKIFFSLVAGLAFPLFFTMIL 319

Query: 301 GSACAQAAVDYTPWQEFYNKNGMGGLTFAILVPDSLHGFGQFCCVVLAMSTIANNVPNMY 360
           G+A A AA++   W+ +Y+KN MGG+ +AILVP+SL+GFGQFCCV+LA+STIANN+PNMY
Sbjct: 320 GAASAMAALNDPTWKAYYDKNAMGGVIYAILVPNSLNGFGQFCCVLLALSTIANNIPNMY 379

Query: 361 TIALSAQSVWDPFAKIPRVVWTMIGNLAALGISIPACYYFSTFMQYFMDXXXXXXXXXXX 420
           T+ALSAQ++W P AKIPRVVWTM GN A LGISIPA YYF  FM+ FMD           
Sbjct: 380 TVALSAQALWAPLAKIPRVVWTMAGNAATLGISIPATYYFDGFMENFMDSIGYYLAIYIA 439

Query: 421 XXXCEHLIYRHNSFSNYNVEDWNNFKKLPIGIAGTISLVVGAFGVALGMSQSYWVGEIAR 480
               EH  YR  SFS YN++DW+N++ LPIGIAGT +L+VGAFGVALGM Q+YWVGEI R
Sbjct: 440 ISCSEHFFYRR-SFSAYNIDDWDNWEHLPIGIAGTAALIVGAFGVALGMCQTYWVGEIGR 498

Query: 481 HIGEYGGDIAIELGAGWAFIAYNICRP 507
            IG+YGGDI  ELGA WAFI YNI RP
Sbjct: 499 LIGKYGGDIGFELGASWAFIIYNILRP 525

>Scas_715.47d
          Length = 533

 Score =  658 bits (1698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/526 (61%), Positives = 395/526 (75%), Gaps = 20/526 (3%)

Query: 1   MSYEDKKDLY---DMEMQVESSAN-SHVETDGYND---------ATVLE------TKLSL 41
           MS    K++Y   D+EM +E ++  S++  D   D         A+ +E      +K S 
Sbjct: 1   MSSLSDKNVYEIQDLEMDLERNSEFSNLPNDKKIDLGPTFSNEPASFIEITEETGSKFSF 60

Query: 42  LNRLAAMISAETKGIEPITDDEKNDDSLINAASMWFSANMVXXXXXXXXXXXXVFGLNFG 101
            NRLA+ ++AETKGIE ITD+EK D S+++A SMWFSANMV            V+GLNFG
Sbjct: 61  FNRLASQLNAETKGIERITDEEKTDGSILDATSMWFSANMVISAYTLGGIGPLVYGLNFG 120

Query: 102 VSVLTIVFFNILGLFAVAFFSVFGAKFGLRQMVLSRYLVGNITARIFALINSVACVGWGI 161
             VLTI+FF+ILGL  VAFFS+FGAKFGLRQMVLSR+L+GN TARI A+IN ++ VGWG+
Sbjct: 121 TCVLTIIFFSILGLLPVAFFSIFGAKFGLRQMVLSRFLIGNSTARIIAVINVISSVGWGV 180

Query: 162 VNTVAASQLLNEINPGSHQLPLWGGCLVIIGATILVSFFGYKVIHTYEKYSWVPNFAVFL 221
           VN+VA+SQLLN +N G H  PLW GC++IIGATILV+FFGY  IH YE++SWVPNFAVFL
Sbjct: 181 VNSVASSQLLNMVNQGHHSCPLWAGCVIIIGATILVTFFGYSYIHAYERWSWVPNFAVFL 240

Query: 222 VLIARLKISGKFHNGAWGSGPTTAGSVLSFGSAVFGFASGWTTYAADYTVYMPRNTNSYK 281
           V+IARL +SG F  G W SGPTTAG+VLSFG A+FGFA+GWT YAADYTVYMPR+TN +K
Sbjct: 241 VIIARLHMSGNFSGGEWTSGPTTAGNVLSFGCAIFGFATGWTVYAADYTVYMPRDTNKFK 300

Query: 282 IFFALVAGLAFPLFFTMILGSACAQAAVDYTPWQEFYNKNGMGGLTFAILVPDSLHGFGQ 341
           IFF+LV GL+FPLFF +ILG+A A  AV+   W ++Y  NGMGG+T+AILVPDSLHGFG+
Sbjct: 301 IFFSLVGGLSFPLFFCLILGAASAMGAVNNPTWNDYYQNNGMGGVTYAILVPDSLHGFGE 360

Query: 342 FCCVVLAMSTIANNVPNMYTIALSAQSVWDPFAKIPRVVWTMIGNLAALGISIPACYYFS 401
           FCCV+LA+STIANN+PNMY+I L+ Q++W+P AK+PR +WT+ GN A L ISIPACYYF 
Sbjct: 361 FCCVLLALSTIANNIPNMYSIGLAVQAIWEPLAKVPRAIWTLAGNAATLAISIPACYYFD 420

Query: 402 TFMQYFMDXXXXXXXXXXXXXXCEHLIYRHNSFSNYNVEDWNNFKKLPIGIAGTISLVVG 461
            FM+ FM+               EH I+R   F  YNVEDW++  KLP+GIAG  +L VG
Sbjct: 421 GFMEDFMNSIGYYLAIYSATALAEHFIFRR-GFKGYNVEDWDDNSKLPMGIAGCAALFVG 479

Query: 462 AFGVALGMSQSYWVGEIARHIGEYGGDIAIELGAGWAFIAYNICRP 507
           AFGVALGMSQ+YWVGEIARHIGEYGGDI  ELGAGWAF+ Y I RP
Sbjct: 480 AFGVALGMSQTYWVGEIARHIGEYGGDIGFELGAGWAFVVYVILRP 525

>YER060W-A (FCY22) [1491] chr5 (276570..278162) Purine/cytosine
           permease with similarity to Fcy2p, member of the
           purine/cytosine subfamily of the nucleobase:cation
           symporter-1 (NCS1) family [1593 bp, 530 aa]
          Length = 530

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/519 (62%), Positives = 389/519 (74%), Gaps = 15/519 (2%)

Query: 1   MSYEDKKD----LYDME---MQVESSAN----SHVETDGYNDATVLETKLSLLNRLAAMI 49
           MS  D KD    L D+E   +  +SSA       VE    N+   ++ K S  NR+AA +
Sbjct: 7   MSMVDIKDAGSELRDLESGALDTKSSAADVYYEGVELHRTNE--FIDNKPSFFNRIAAAL 64

Query: 50  SAETKGIEPITDDEKNDDSLINAASMWFSANMVXXXXXXXXXXXXVFGLNFGVSVLTIVF 109
           +AETKGIEP+T+DEKNDDS++NAA++WFSANMV            VFGLNFG SVL I+F
Sbjct: 65  NAETKGIEPVTEDEKNDDSILNAATIWFSANMVIVAYSVGALGPLVFGLNFGQSVLVIIF 124

Query: 110 FNILGLFAVAFFSVFGAKFGLRQMVLSRYLVGNITARIFALINSVACVGWGIVNTVAASQ 169
           FNILGL  VA FS+FG + GLRQM+LSRYL GNITAR F+L+N +ACVGW ++N   ++Q
Sbjct: 125 FNILGLIPVALFSLFGVELGLRQMILSRYLAGNITARFFSLVNVIACVGWCVLNISVSAQ 184

Query: 170 LLNEINPGS-HQLPLWGGCLVIIGATILVSFFGYKVIHTYEKYSWVPNFAVFLVLIARLK 228
           LLN +N GS H  P+W GCL+I G T+LV+FFGY V+H YEK+SWVPNFA FLV+IA+L 
Sbjct: 185 LLNMVNEGSGHNCPIWAGCLIIAGGTVLVTFFGYSVVHAYEKWSWVPNFAAFLVIIAQLS 244

Query: 229 ISGKFHNGAWGSGPTTAGSVLSFGSAVFGFASGWTTYAADYTVYMPRNTNSYKIFFALVA 288
            SGKF  G W  G TTAG VLSFGS+VFG A+GW TYAADYTVYMP+ T+ YKIFF++VA
Sbjct: 245 RSGKFKGGEWVGGATTAGGVLSFGSSVFGSAAGWATYAADYTVYMPKTTSKYKIFFSVVA 304

Query: 289 GLAFPLFFTMILGSACAQAAVDYTPWQEFYNKNGMGGLTFAILVPDSLHGFGQFCCVVLA 348
           GLAFPLFFTMILG+AC  AA++   W+ +Y+KN MGG+ +AILVP+SL+GFGQFCCV+LA
Sbjct: 305 GLAFPLFFTMILGAACGMAALNDPTWKSYYDKNAMGGVIYAILVPNSLNGFGQFCCVLLA 364

Query: 349 MSTIANNVPNMYTIALSAQSVWDPFAKIPRVVWTMIGNLAALGISIPACYYFSTFMQYFM 408
           +ST+ANNVP MYT+ALSAQ++W P AKIPRVVWTM GN A LGISIPA YYF  FM+ FM
Sbjct: 365 LSTVANNVPGMYTVALSAQALWAPLAKIPRVVWTMAGNAATLGISIPATYYFDGFMENFM 424

Query: 409 DXXXXXXXXXXXXXXCEHLIYRHNSFSNYNVEDWNNFKKLPIGIAGTISLVVGAFGVALG 468
           D               EH IYR  SFS YN++DW+N++ LPIGIAGT +L+ GAFGVALG
Sbjct: 425 DSIGYYLAIYIAIACSEHFIYRR-SFSAYNIDDWDNWEHLPIGIAGTAALIAGAFGVALG 483

Query: 469 MSQSYWVGEIARHIGEYGGDIAIELGAGWAFIAYNICRP 507
           M Q+YWVGEI+R IGEYGGDI  ELG  WAFI YNI RP
Sbjct: 484 MCQTYWVGEISRLIGEYGGDIGFELGGSWAFIIYNIVRP 522

>Sklu_1893.2 YER056C, Contig c1893 1725-3266
          Length = 513

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/511 (60%), Positives = 378/511 (73%), Gaps = 13/511 (2%)

Query: 2   SYEDKKDLYDMEMQ-----VESSANSHVETDGYNDATVLETKLSLLNRLAAMISAETKGI 56
           S +++  + DME Q      E+ +   VE+  Y       T +S ++R AA + AETKGI
Sbjct: 3   SSKEEYAIQDMEKQNPLELTETDSTPVVESTEY-------TTVSFIDRWAAKLKAETKGI 55

Query: 57  EPITDDEKNDDSLINAASMWFSANMVXXXXXXXXXXXXVFGLNFGVSVLTIVFFNILGLF 116
           EPITD+EK+DDS++NAASMWFSANMV            VFGLNF  SVLTI+FF+ LGL 
Sbjct: 56  EPITDEEKDDDSILNAASMWFSANMVIAAYALGVLGTGVFGLNFWESVLTIIFFSFLGLI 115

Query: 117 AVAFFSVFGAKFGLRQMVLSRYLVGNITARIFALINSVACVGWGIVNTVAASQLLNEINP 176
            VAFFSVFGA+ G+RQMVLSR+L+GN+TARIFALIN +ACVGWG VNT+A++ LL+ INP
Sbjct: 116 PVAFFSVFGAELGMRQMVLSRFLMGNVTARIFALINVIACVGWGAVNTIASASLLHMINP 175

Query: 177 GSHQLPLWGGCLVIIGATILVSFFGYKVIHTYEKYSWVPNFAVFLVLIARLKISGKFHNG 236
           G  Q P W  CL+I+ +TI+V+FFGY+VIH YEK+SWVPNFAVFLV+IARLKISG F  G
Sbjct: 176 GGAQCPPWAACLIIVFSTIIVTFFGYRVIHAYEKWSWVPNFAVFLVIIARLKISGNFSTG 235

Query: 237 AWGSGPTTAGSVLSFGSAVFGFASGWTTYAADYTVYMPRNTNSYKIFFALVAGLAFPLFF 296
            W SG TTAG VLSFG ++FGFASGWTTYAADYTVYMPR+TN +KIFFALV GLAFPL F
Sbjct: 236 EWTSGATTAGGVLSFGGSIFGFASGWTTYAADYTVYMPRSTNKWKIFFALVFGLAFPLCF 295

Query: 297 TMILGSACAQAAVDYTPWQEFYNKNGMGGLTFAILVPDSLHGFGQFCCVVLAMSTIANNV 356
           ++ILG+A          W+++Y  + +GGL +AILV DSLHGFG+FCCV+LAMST+ANN+
Sbjct: 296 SLILGAASIAGIEKNALWKQYYEDHSVGGLVYAILVKDSLHGFGEFCCVLLAMSTVANNI 355

Query: 357 PNMYTIALSAQSVWDPFAKIPRVVWTMIGNLAALGISIPACYYFSTFMQYFMDXXXXXXX 416
           PNMY+IAL  QS+W+P AK+PRV WT+ GNL  L I+IPA Y F +FM  FM+       
Sbjct: 356 PNMYSIALGTQSMWEPLAKVPRVFWTIAGNLVTLAIAIPAYYKFESFMSSFMEAIAYYLA 415

Query: 417 XXXXXXXCEHLIYRHNSFSNYNVEDWNNFKKLPIGIAGTISLVVGAFGVALGMSQSYWVG 476
                   EH  YR   F  YNV+DWN + +LPIG AG  +L +GAFGVA GMSQ+YW G
Sbjct: 416 IYIAISLSEHFFYRKG-FKGYNVDDWNRWDRLPIGYAGCAALFIGAFGVAFGMSQTYWEG 474

Query: 477 EIARHIGEYGGDIAIELGAGWAFIAYNICRP 507
           +IARHIGEYGGDI  ELG G++FI YNI RP
Sbjct: 475 QIARHIGEYGGDIGFELGMGFSFITYNILRP 505

>Kwal_23.5819
          Length = 516

 Score =  603 bits (1554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/506 (58%), Positives = 375/506 (74%), Gaps = 5/506 (0%)

Query: 6   KKDLYDMEMQVESSANSHVETDGYNDATVLE----TKLSLLNRLAAMISAETKGIEPITD 61
           +K+ Y+++  VE   NS  E    +   V+E    TKLS+++R+AA + AETKGIEP+T+
Sbjct: 4   QKEEYEIQ-DVEKRLNSRFEISDDDSQPVVESTEYTKLSIVDRIAASLRAETKGIEPVTE 62

Query: 62  DEKNDDSLINAASMWFSANMVXXXXXXXXXXXXVFGLNFGVSVLTIVFFNILGLFAVAFF 121
           +EK+DDS+ NAASMWFSANMV            V+GLNF   VL +V F+ LG+  VA++
Sbjct: 63  EEKDDDSIWNAASMWFSANMVIAAFSLGVLGPVVWGLNFWGCVLAVVLFSALGVIPVAYY 122

Query: 122 SVFGAKFGLRQMVLSRYLVGNITARIFALINSVACVGWGIVNTVAASQLLNEINPGSHQL 181
           SVFGA+ GLRQMVLSR+L+GN+TARIFALIN +ACVGWG VNT+A++QLL+ INPG  + 
Sbjct: 123 SVFGAELGLRQMVLSRFLLGNVTARIFALINIIACVGWGAVNTIASAQLLHMINPGGARC 182

Query: 182 PLWGGCLVIIGATILVSFFGYKVIHTYEKYSWVPNFAVFLVLIARLKISGKFHNGAWGSG 241
           P W GCL+I+ +TILV+FFGY+VIH YEK+SW+PNFAVFLV+IARLKI G F +G W SG
Sbjct: 183 PPWAGCLIIVLSTILVTFFGYRVIHAYEKWSWIPNFAVFLVIIARLKIDGSFSSGEWISG 242

Query: 242 PTTAGSVLSFGSAVFGFASGWTTYAADYTVYMPRNTNSYKIFFALVAGLAFPLFFTMILG 301
              A +VLSFG  +FGFASGWTTYAADYTVYMPR TN  K+FFA++ GL FPL F++ILG
Sbjct: 243 TNGAAAVLSFGGVIFGFASGWTTYAADYTVYMPRTTNKPKVFFAVIFGLMFPLCFSIILG 302

Query: 302 SACAQAAVDYTPWQEFYNKNGMGGLTFAILVPDSLHGFGQFCCVVLAMSTIANNVPNMYT 361
           +A A A+ + + +   ++  G+GGL +AILV +SLHGFGQFCCV+LAMST+ANN+PNMY+
Sbjct: 303 AAAAMASKNNSEYARLHDSGGVGGLIYAILVNNSLHGFGQFCCVLLAMSTVANNIPNMYS 362

Query: 362 IALSAQSVWDPFAKIPRVVWTMIGNLAALGISIPACYYFSTFMQYFMDXXXXXXXXXXXX 421
           IAL  Q++W+P AKIPRV WTM GNL  L I+IPA Y F++FM  FMD            
Sbjct: 363 IALGTQALWEPLAKIPRVFWTMAGNLVTLAIAIPAYYKFNSFMTNFMDAIAYYLSIYIGI 422

Query: 422 XXCEHLIYRHNSFSNYNVEDWNNFKKLPIGIAGTISLVVGAFGVALGMSQSYWVGEIARH 481
              EHL +R  +F NYNV+DWN + KLPIG AG  +L VGA GVA+GM Q+YW G+IAR 
Sbjct: 423 SLSEHLFFRKMNFRNYNVDDWNKWDKLPIGYAGCCALFVGAVGVAVGMEQTYWTGQIARK 482

Query: 482 IGEYGGDIAIELGAGWAFIAYNICRP 507
           IG+YG DI  E+G  ++ I YNI RP
Sbjct: 483 IGDYGADIGFEIGFCFSVIVYNILRP 508

>KLLA0C08283g complement(725563..727122) similar to sp|P17064
           Saccharomyces cerevisiae YER056c FCY2 purine-cytosine
           permease, start by similarity
          Length = 519

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/508 (59%), Positives = 368/508 (72%), Gaps = 3/508 (0%)

Query: 2   SYEDKKDLYDMEMQVESSA--NSHVETDGYNDATVLETKLSLLNRLAAMISAETKGIEPI 59
           S +++  L+D+E Q  S    +  +E +     T   TKLS ++ LA+ + AETKGIEPI
Sbjct: 5   SSKEEYVLHDVEKQELSKTQFDEVLEEEPVIVETTEVTKLSWVDHLASKLHAETKGIEPI 64

Query: 60  TDDEKNDDSLINAASMWFSANMVXXXXXXXXXXXXVFGLNFGVSVLTIVFFNILGLFAVA 119
           TDDEK+DD ++NAASMW SAN+V            VFGLNFG +VL IVFF+ LGL  VA
Sbjct: 65  TDDEKDDDDILNAASMWLSANLVIAAFSLGCIGTSVFGLNFGEAVLVIVFFSFLGLLPVA 124

Query: 120 FFSVFGAKFGLRQMVLSRYLVGNITARIFALINSVACVGWGIVNTVAASQLLNEINPGSH 179
           FFSVFGA+ GLRQ+VLSR+L+GN+TARIF  IN +ACVGWG VNT+A++ LL+ +NP   
Sbjct: 125 FFSVFGAELGLRQLVLSRFLLGNVTARIFCFINIIACVGWGAVNTIASASLLHIVNPSGP 184

Query: 180 QLPLWGGCLVIIGATILVSFFGYKVIHTYEKYSWVPNFAVFLVLIARLKISGKFHNGAWG 239
             P W GCL+II  TI+V+FFGY+VIH YEK+SWVPNFAVFLV+IARL  +G F  G+WG
Sbjct: 185 DCPPWAGCLIIIFGTIIVTFFGYRVIHAYEKWSWVPNFAVFLVIIARLAKAGTFTAGSWG 244

Query: 240 SGPTTAGSVLSFGSAVFGFASGWTTYAADYTVYMPRNTNSYKIFFALVAGLAFPLFFTMI 299
           SG TTAG VLSFGS+VFGFA+GWTTYA+DYTVYMPR TN  K+F A+V GLAFPL F+MI
Sbjct: 245 SGSTTAGGVLSFGSSVFGFATGWTTYASDYTVYMPRTTNKKKVFAAIVLGLAFPLCFSMI 304

Query: 300 LGSACAQAAVDYTPWQEFYNKNGMGGLTFAILVPDSLHGFGQFCCVVLAMSTIANNVPNM 359
           LG+A          W E Y+K  +GGL +AIL+ DSL GFG FCCVVLA+STI+NN+PNM
Sbjct: 305 LGAAAVTGTRTNERWAELYDKYSVGGLCYAILIEDSLWGFGSFCCVVLALSTISNNIPNM 364

Query: 360 YTIALSAQSVWDPFAKIPRVVWTMIGNLAALGISIPACYYFSTFMQYFMDXXXXXXXXXX 419
           Y+IAL  Q++++P AK+PRV WT+IGNL  L I+IPA Y F TFM  FMD          
Sbjct: 365 YSIALGTQALFEPLAKVPRVAWTIIGNLVTLAIAIPAYYKFETFMTTFMDSIGYYLAIYS 424

Query: 420 XXXXCEHLIYRHNSFSNYNVEDWNNFKKLPIGIAGTISLVVGAFGVALGMSQSYWVGEIA 479
                EH IYR   F  YNV+DW+ + KLPIG AGT +L +GAFGVA GM+Q YW G+I 
Sbjct: 425 AIALSEHFIYR-GGFKGYNVDDWDRWDKLPIGYAGTFALFIGAFGVAFGMNQIYWQGQIG 483

Query: 480 RHIGEYGGDIAIELGAGWAFIAYNICRP 507
           R IGE GGDI  ELGAG+AFI YNI RP
Sbjct: 484 RLIGENGGDIGFELGAGFAFITYNIFRP 511

>Kwal_34.15730
          Length = 518

 Score =  567 bits (1462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/509 (55%), Positives = 358/509 (70%), Gaps = 6/509 (1%)

Query: 4   EDKKDLYDMEMQVESSANSHVETDGYNDATVLETKL-----SLLNRLAAMISAETKGIEP 58
           +DK ++ D+E+ V S  N+  + D    ++    KL     ++LNRLA  + AETKGIEP
Sbjct: 3   KDKYEVQDLELNVYSQENTSAD-DATRGSSQAPEKLNGGGMAVLNRLAKKLRAETKGIEP 61

Query: 59  ITDDEKNDDSLINAASMWFSANMVXXXXXXXXXXXXVFGLNFGVSVLTIVFFNILGLFAV 118
           +T+DEK+D S+ NAA +WFSANMV            VF LNF   V++IV F  +G+  V
Sbjct: 62  VTEDEKDDSSIWNAAFVWFSANMVIAAFSVGMLGPLVFSLNFWGCVVSIVIFTFIGVLPV 121

Query: 119 AFFSVFGAKFGLRQMVLSRYLVGNITARIFALINSVACVGWGIVNTVAASQLLNEINPGS 178
             +SVFG +  LRQMVLSR+L+GN+TARIFALIN +AC+GWG+VNTV ++QLL+ INP  
Sbjct: 122 CLYSVFGVQLSLRQMVLSRFLLGNVTARIFALINVIACIGWGVVNTVTSAQLLHMINPTG 181

Query: 179 HQLPLWGGCLVIIGATILVSFFGYKVIHTYEKYSWVPNFAVFLVLIARLKISGKFHNGAW 238
            + P W GCL+I+ +TI V+FFGY+VIHT+ KYSW+PNF VF+V+IARLKI G F  G W
Sbjct: 182 GRCPPWAGCLIIVFSTIFVTFFGYRVIHTFGKYSWIPNFIVFIVIIARLKIDGSFSVGKW 241

Query: 239 GSGPTTAGSVLSFGSAVFGFASGWTTYAADYTVYMPRNTNSYKIFFALVAGLAFPLFFTM 298
            SG TTAGS+LS G  VFGFA+GWTTYAAD+TVYMPR  N  ++FFA++ GL FPL FT+
Sbjct: 242 ESGSTTAGSILSLGGIVFGFATGWTTYAADFTVYMPRTVNRAEVFFAVMLGLVFPLCFTI 301

Query: 299 ILGSACAQAAVDYTPWQEFYNKNGMGGLTFAILVPDSLHGFGQFCCVVLAMSTIANNVPN 358
           ILG+A   AA++   + EFY  +  GGL +AILVP SLHGFGQFCCV+LAMST+AN VPN
Sbjct: 302 ILGAAAGCAALNNPVYHEFYESDHAGGLVYAILVPRSLHGFGQFCCVLLAMSTVANMVPN 361

Query: 359 MYTIALSAQSVWDPFAKIPRVVWTMIGNLAALGISIPACYYFSTFMQYFMDXXXXXXXXX 418
           MY+IAL  Q++W+P AK+PRV WT+ GNL  L I+IPA Y F  FM  FMD         
Sbjct: 362 MYSIALGTQALWEPLAKVPRVFWTLAGNLITLAIAIPAYYRFEAFMTNFMDSIAYYLSIY 421

Query: 419 XXXXXCEHLIYRHNSFSNYNVEDWNNFKKLPIGIAGTISLVVGAFGVALGMSQSYWVGEI 478
                 EH I+R N FSNY+  +WN++ +LP+G AG  +L VGA GVALGM Q+YW GEI
Sbjct: 422 IGVSLSEHFIFRQNKFSNYDTSEWNDWHRLPLGYAGCAALFVGAIGVALGMHQTYWTGEI 481

Query: 479 ARHIGEYGGDIAIELGAGWAFIAYNICRP 507
            R IGE+GGDI  ELG  ++ I Y   RP
Sbjct: 482 GRLIGEFGGDIGFELGLAFSMIVYTALRP 510

>CAGL0C00231g 15916..17538 similar to sp|P40039 Saccharomyces
           cerevisiae YER060w or sp|P17064 Saccharomyces cerevisiae
           YER056c, hypothetical start
          Length = 540

 Score =  565 bits (1455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/505 (55%), Positives = 367/505 (72%), Gaps = 4/505 (0%)

Query: 3   YEDKKDLYDMEMQVESSANSHVETDGYNDATVLETKLSLLNRLAAMISAETKGIEPITDD 62
           YED  +L D+  + + +   +  T+   D T  ++   +   L   ++AETKG+EPI ++
Sbjct: 32  YEDL-ELKDITFKEKFNELDNKSTETDKDETCFKSPFIIW--LKRTLNAETKGVEPINEN 88

Query: 63  EKNDDSLINAASMWFSANMVXXXXXXXXXXXXVFGLNFGVSVLTIVFFNILGLFAVAFFS 122
           EKND ++  ++ +WFSAN+V            V+ LNF +SVLTIVFFNILGL +V+FFS
Sbjct: 89  EKNDTNIFGSSFVWFSANLVLAAYGVGSLGPTVYHLNFAISVLTIVFFNILGLVSVSFFS 148

Query: 123 VFGAKFGLRQMVLSRYLVGNITARIFALINSVACVGWGIVNTVAASQLLNEINPGSHQLP 182
           VFGA+ GLRQM++SRYLVGN+TARIFA +N + CVGW ++N   A++L   I  G + LP
Sbjct: 149 VFGAELGLRQMIISRYLVGNVTARIFAALNCIGCVGWDVLNIYLAAKLFAIIKTGGNHLP 208

Query: 183 LWGGCLVIIGATILVSFFGYKVIHTYEKYSWVPNFAVFLVLIARLKISGKFHNGAWGSGP 242
           LWGGC+VI+G+T+ ++  GYK IH YEK+SW+PN AVFL++I+R+KIS +F NG W SG 
Sbjct: 209 LWGGCIVIVGSTVFIAALGYKFIHIYEKWSWIPNLAVFLIIISRIKISREFSNGPWTSGS 268

Query: 243 TTAGSVLSFGSAVFGFASGWTTYAADYTVYMPRNTNSYKIFFALVAGLAFPLFFTMILGS 302
           TTAG+VLSFGSA+FG A+GW TY+ADYTVYMPR TN ++IFF    GLAF L FTMI+G+
Sbjct: 269 TTAGNVLSFGSAIFGSAAGWVTYSADYTVYMPRRTNKFRIFFFNSIGLAFSLIFTMIVGA 328

Query: 303 ACAQAAVDYTPWQEFYNKNGMGGLTFAILVPDSLHGFGQFCCVVLAMSTIANNVPNMYTI 362
           A    AV+ + W E YN+  +GG+T+A+LVP+SLHGFG+FCCV+LAMST+ANNVP+MYTI
Sbjct: 329 AAGICAVNNSKWMELYNEFQIGGVTYALLVPNSLHGFGKFCCVILAMSTVANNVPSMYTI 388

Query: 363 ALSAQSVWDPFAKIPRVVWTMIGNLAALGISIPACYYFSTFMQYFMDXXXXXXXXXXXXX 422
           ALS Q++W+P   +PR +WT+  N+  LGISIPACY+F +FMQ FM              
Sbjct: 389 ALSVQALWEPLTSVPRAIWTIFANIVVLGISIPACYFFQSFMQNFMGSIGYFYALYIGIS 448

Query: 423 XCEHLIYRHNSFSNYNVEDWNNFKKLPIGIAGTISLVVGAFGVALGMSQSYWVGEIARHI 482
             EH ++R   F NYNV D +N++KLPIG AG I+L+VG+FGVALGM+Q+YWVGEIAR I
Sbjct: 449 LAEHCVFRR-KFGNYNVNDHSNWEKLPIGFAGCIALIVGSFGVALGMAQTYWVGEIARKI 507

Query: 483 GEYGGDIAIELGAGWAFIAYNICRP 507
           G YGGDI  ELG  WAF+ Y I RP
Sbjct: 508 GTYGGDIGFELGMSWAFLTYIIIRP 532

>Scas_715.47d1
          Length = 523

 Score =  559 bits (1440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/504 (52%), Positives = 344/504 (68%), Gaps = 7/504 (1%)

Query: 11  DMEMQV------ESSANSHVETDGYNDATVLE-TKLSLLNRLAAMISAETKGIEPITDDE 63
           D+E Q       E+ +N     D ++     E + ++ L ++A  ++AET+GIEP+ DDE
Sbjct: 12  DLEKQDPAFVANEAISNDTTGEDDFSKTVSSEASNIAFLQKIATRLNAETRGIEPVRDDE 71

Query: 64  KNDDSLINAASMWFSANMVXXXXXXXXXXXXVFGLNFGVSVLTIVFFNILGLFAVAFFSV 123
           K D ++ N   +WFSAN V            VFGLNFG++ LTIVFFNI+G+  VA+FS+
Sbjct: 72  KTDANIWNPCMLWFSANFVISAYAVGALGPMVFGLNFGITSLTIVFFNIIGVVPVAYFSL 131

Query: 124 FGAKFGLRQMVLSRYLVGNITARIFALINSVACVGWGIVNTVAASQLLNEINPGSHQLPL 183
           FG + GLRQMVLSRYLVGNI  R F+ IN +ACVGW ++N++ ++QLLN +N   H+ P 
Sbjct: 132 FGPELGLRQMVLSRYLVGNIVGRFFSFINCIACVGWCVLNSICSAQLLNMVNLHGHRCPF 191

Query: 184 WGGCLVIIGATILVSFFGYKVIHTYEKYSWVPNFAVFLVLIARLKISGKFHNGAWGSGPT 243
           W G +V++  TILV+FFG KVI  +E++SWVPN AVFLV+IARL  SG+F  G W SGPT
Sbjct: 192 WAGIMVVVLGTILVTFFGIKVITAFERWSWVPNLAVFLVIIARLHKSGQFSGGKWTSGPT 251

Query: 244 TAGSVLSFGSAVFGFASGWTTYAADYTVYMPRNTNSYKIFFALVAGLAFPLFFTMILGSA 303
           TAG+VLS G   +G+A  W TY+ADYTVYMPRNTN  K+FF L   L  PL FTMILG+A
Sbjct: 252 TAGNVLSLGCVAYGYAGAWATYSADYTVYMPRNTNKVKLFFGLCVALTVPLCFTMILGAA 311

Query: 304 CAQAAVDYTPWQEFYNKNGMGGLTFAILVPDSLHGFGQFCCVVLAMSTIANNVPNMYTIA 363
                V+   W ++Y+ NG+GGLT+ +LVP+S+HGFG+FCCV+LA+STIANN PNMYT+ 
Sbjct: 312 VGMGGVNNATWAKYYSSNGIGGLTYEVLVPNSVHGFGEFCCVLLALSTIANNTPNMYTLG 371

Query: 364 LSAQSVWDPFAKIPRVVWTMIGNLAALGISIPACYYFSTFMQYFMDXXXXXXXXXXXXXX 423
            S Q++W+P A++PR   T+ GN A   +   ACYYF +FM+ FMD              
Sbjct: 372 FSFQAIWEPLARVPRAFCTLFGNAAVFVVGCCACYYFDSFMEKFMDTLAYYGAIYISLGM 431

Query: 424 CEHLIYRHNSFSNYNVEDWNNFKKLPIGIAGTISLVVGAFGVALGMSQSYWVGEIARHIG 483
            EHLI+R  SF  Y+V+DW  F KLPIGIAG +   V AFGVALGM QSYWVGEI R IG
Sbjct: 432 AEHLIFRKCSFKAYDVKDWKTFSKLPIGIAGGVGFFVAAFGVALGMCQSYWVGEIGRRIG 491

Query: 484 EYGGDIAIELGAGWAFIAYNICRP 507
           + GGD+  E+GA W FIAY + RP
Sbjct: 492 KDGGDVGFEMGAAWGFIAYVLVRP 515

>ADL074W [1667] [Homologous to ScYER056C (FCY2) - SH]
           complement(551981..553555) [1575 bp, 524 aa]
          Length = 524

 Score =  525 bits (1353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/506 (52%), Positives = 338/506 (66%), Gaps = 11/506 (2%)

Query: 2   SYEDKKDLYDMEMQVESSANSHVETDGYNDATVLETKLSLLNRLAAMISAETKGIEPITD 61
           SY D +         E      V+   Y       T LS +NR AA ++AETKG+ P+T+
Sbjct: 22  SYGDLEKKKGFLSDAEEPVTPQVDETEY-------TTLSWVNRWAARLNAETKGVSPVTE 74

Query: 62  DEKNDDSLINAASMWFSANMVXXXXXXXXXXXXVFGLNFGVSVLTIVFFNILGLFAVAFF 121
           DE +D SL+NAASMWFSAN+V            VF LN   +VL  V F+ +G+ AVAFF
Sbjct: 75  DECHDSSLLNAASMWFSANLVIAAFAVGVLSTAVFRLNMLEAVLATVVFSFMGVLAVAFF 134

Query: 122 SVFGAKFGLRQMVLSRYLVGNITARIFALINSVACVGWGIVNTVAASQLLNEINPGSHQL 181
           SVFGA+FGLRQM+LSRYL+GN TARIF LIN +ACVGW  VNT+A++ LL+ INP   + 
Sbjct: 135 SVFGAEFGLRQMILSRYLMGNTTARIFCLINVIACVGWSSVNTIASTTLLHMINPTGARC 194

Query: 182 PLWGGCLVIIGATILVSFFGYKVIHTYEKYSWVPNFAVFLVLIARLKISGKFHNGAWGSG 241
           P W   L+I+ +T+ ++FFGY+VIH YEK+SWVPN  VFL++IARL I+G F  G+   G
Sbjct: 195 PPWAASLIIVLSTVFITFFGYRVIHAYEKWSWVPNLVVFLIIIARLAIAGNFTAGSSLGG 254

Query: 242 PTTAGSVLSFGSAVFGFASGWTTYAADYTVYMPRNTNSYKIFFALVAGLAFPLFFTMILG 301
             TAGS LS+GS VFGFASGWTTYAADYTVYMP+N+N Y+IFF ++AGLA PL FT+ILG
Sbjct: 255 KATAGSFLSYGSVVFGFASGWTTYAADYTVYMPKNSNKYRIFFFMIAGLATPLLFTLILG 314

Query: 302 SACAQAAVDYTPWQEFYNKNGMGGLTFAILVPDSLHGFGQFCCVVLAMSTIANNVPNMYT 361
           +A  +       W E+Y K+ +GGL FAIL  ++L GFGQFCCVVLAMST+ANN+PNMY+
Sbjct: 315 AAAGRCVHTNPTWGEYYKKHSVGGLCFAILAENALGGFGQFCCVVLAMSTVANNIPNMYS 374

Query: 362 IALSAQSVWDPFAKIPRVVWTMIGNLAALGISIPACYYFSTFMQYFMDXXXXXXXXXXXX 421
           IALS Q++W  FA++PRV WT++GN  +L I+I A Y F TFM  FMD            
Sbjct: 375 IALSTQALWSRFARVPRVFWTLVGNACSLVIAIVAYYKFETFMTSFMDSIGYYLSIYIVI 434

Query: 422 XXCEHLIYRHNSFSNYNVEDWNNFKKLPIGIAGTISLVVGAFGVALGMSQSYWVGEIARH 481
              EH ++R   F  Y+V  W+    LP G AG  +L VGA GVA+GMS  Y+ G IA+ 
Sbjct: 435 CVTEHFVFR-KGFRGYDVSHWDRPDLLPAGYAGCAALCVGAVGVAMGMSHEYYTGPIAKL 493

Query: 482 IGEYGGDIAIELGAGWAFIAYNICRP 507
               GGDI   L AG++FI Y  CRP
Sbjct: 494 A---GGDIGFLLAAGFSFIVYICCRP 516

>Scas_715.54d
          Length = 232

 Score =  218 bits (556), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 103/208 (49%), Positives = 144/208 (69%), Gaps = 1/208 (0%)

Query: 17  ESSANSHVETDGYNDATVLE-TKLSLLNRLAAMISAETKGIEPITDDEKNDDSLINAASM 75
           E+ +N     D ++     E + ++ L ++A  ++AET+GIEP+ DDEK D ++ N   +
Sbjct: 25  EAISNDTTSEDDFSKTVSSEASNIAFLQKIATRLNAETRGIEPVRDDEKTDANIWNPCML 84

Query: 76  WFSANMVXXXXXXXXXXXXVFGLNFGVSVLTIVFFNILGLFAVAFFSVFGAKFGLRQMVL 135
           WFSAN V            VFGLNFG++ LTIVFFNI+G+  VA+FS+FG + GLRQMVL
Sbjct: 85  WFSANFVISAYAVGALGPMVFGLNFGITSLTIVFFNIIGVVPVAYFSLFGPELGLRQMVL 144

Query: 136 SRYLVGNITARIFALINSVACVGWGIVNTVAASQLLNEINPGSHQLPLWGGCLVIIGATI 195
           SRYLVGNI  R F+ IN +ACVGW ++N++ ++QLLN +N   H+ P W G +V++  TI
Sbjct: 145 SRYLVGNIVGRFFSFINCIACVGWCVLNSICSAQLLNMVNLHGHRCPFWAGIMVVVLGTI 204

Query: 196 LVSFFGYKVIHTYEKYSWVPNFAVFLVL 223
           LV+FFG KVI  +E++SWVPN AVFLV+
Sbjct: 205 LVTFFGIKVITAFERWSWVPNLAVFLVI 232

>Kwal_47.17216
          Length = 542

 Score =  211 bits (538), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 152/508 (29%), Positives = 235/508 (46%), Gaps = 45/508 (8%)

Query: 38  KLSLLNRLAAMISAETKGIEPITDDEK-NDDSLINAASMWFSANMVXXXXXXXXXXXXVF 96
           KLS+ ++    +  E +GI+ I   E+      ++ A +W SA               +F
Sbjct: 32  KLSVASKRLDALGVEIRGIQRIPAYERGTSKQFLSVAGLWLSAAGGLSSMSSYFLGPLLF 91

Query: 97  GLNFGVSVLTIVFFNILGLFAVAFFSVFGAKFGLRQMVLSRYLVGNITARIFALINSVAC 156
            L F  S+++ +    +G    A+ S  G + G RQMV +RYL G    +  +L + +  
Sbjct: 92  ELTFRQSLVSGLVSMAIGCAVAAYLSTMGPQSGCRQMVTARYLFGWYFVKFVSLASIIGV 151

Query: 157 VGWGIVNTVAASQLLNEINPGSHQLPLWGGCLVIIGATILVSFFGYKVIHTYEKYSWVPN 216
           +GW IVN V   Q+L  I+  + ++PLW G +++   + +V+ FG K +   E +  VP 
Sbjct: 152 MGWSIVNCVVGGQMLAAIS--NSKIPLWVGIIIVTAVSFIVAIFGIKQVLRVETFLSVPV 209

Query: 217 FAVFLVL-IA---RLKISGKFHNGAWGSGP-TTAGSVLSFGSAVFGFASGWTTYAADYTV 271
              FL+L IA   +  +   F N      P T  G+ LSF S  +   S W +  ADY +
Sbjct: 210 LTCFLLLYIAASDKYYLLDTFKND--DIDPLTIKGNWLSFFSLCYSITSTWGSITADYYI 267

Query: 272 YMPRNTNSYKIFFALVAGLAFPLFFTMILGSACAQAAVDYTPWQEFYNKNGMGGLTFAIL 331
             P +T  YK+F     G   P  F  +LG   A  A  Y PW+  Y+K GMGGL F+  
Sbjct: 268 LFPEDTAHYKVFLLTFFGTLIPTTFVGVLGLILASCAASYEPWKAAYHKYGMGGLLFSGF 327

Query: 332 VPDSLHGFGQFCCVVLAMSTIANNVPNMYTIALSAQSVWDPFAKIPRVVWTMIGNLAALG 391
             +  +GFG+FC VVL  S I+NN+ N Y+ A + Q      A++PR +W +   +  L 
Sbjct: 328 --ERWNGFGKFCVVVLIFSLISNNIINTYSAAFNIQLSSVHMARVPRWLWAIACTIFYLV 385

Query: 392 ISIPACYYFSTFMQYFMDXXXXXXXXXXXXXXCEHLIYRHN------------------- 432
            ++    +FS  +  F+                E+LI+R +                   
Sbjct: 386 CALVGRNHFSEILGNFLPMIGYWISMYFIILLEENLIFRSHFRHLYTEEFPPHPVEEGES 445

Query: 433 --------------SFSNYNVEDWNNFKKLPIGIAGTISLVVGAFGVALGMSQSYWVGEI 478
                             YN E WNN + L  G A T + +VG  GVAL M+Q+YW+G I
Sbjct: 446 PRALRDIKNKKVSSRKHAYNWEMWNNAEVLTHGYAATFAFLVGVGGVALSMAQAYWIGPI 505

Query: 479 ARHIGEYGGDIAIELGAGWAFIAYNICR 506
           ARH G++GGD+ + +  G++   Y   R
Sbjct: 506 ARHFGDFGGDLGMWVSMGFSGTVYPALR 533

>KLLA0D05060g 436335..437906 similar to sp|P53099 Saccharomyces
           cerevisiae YGL186c, hypothetical start
          Length = 523

 Score =  204 bits (519), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 151/495 (30%), Positives = 230/495 (46%), Gaps = 37/495 (7%)

Query: 43  NRLAAMISAETKGIEPITDDEKND-DSLINAASMWFSANMVXXXXXXXXXXXXVFGLNFG 101
           ++L A+   E +GI+ I   E+       + A +W SA               VF L F 
Sbjct: 26  DKLDAL-GVEARGIQRIQPYERGTAKQFWHVAGLWLSAAGGLSSMSSYFLGPMVFQLTFN 84

Query: 102 VSVLTIVFFNILGLFAVAFFSVFGAKFGLRQMVLSRYLVGNITARIFALINSVACVGWGI 161
             +++ +    +G    A+ SV G + G RQ+V +RYL G    +  AL   V  +GW I
Sbjct: 85  QCLVSGLISMWIGCGVAAYCSVMGPQSGCRQIVTARYLFGWWFVKFIALAAIVGVMGWSI 144

Query: 162 VNTVAASQLLNEINPGSHQLPLWGGCLVIIGATILVSFFGYKVIHTYEKYSWVPNFAVFL 221
           VN V   Q+L  ++ G  ++PLW G +++   ++LVS FG K +   E    VP    FL
Sbjct: 145 VNCVVGGQMLASVSDG--KVPLWVGIIIVTVVSLLVSIFGIKQVLKVETLFAVPVLTSFL 202

Query: 222 VLIA----RLKISGKFHNGAWGSGPTTAGSVLSFGSAVFGFASGWTTYAADYTVYMPRNT 277
           +L      + K   +F N    S  T  G  LSF S  +   S W +  ADY +  P +T
Sbjct: 203 LLYISASDKFKYLYEFSNSDIDS-LTVKGCWLSFFSLCYSITSTWGSITADYYILFPEDT 261

Query: 278 NSYKIFFALVAGLAFPLFFTMILGSACAQAAVDYTPWQEFYNKNGMGGLTFAILVPDSLH 337
              ++F     G A P  F  +LG   A  ++ Y PWQ  Y++ GMGGL  A       +
Sbjct: 262 PQIQVFLLTFFGTAVPTTFVGVLGLLLASCSLSYEPWQAAYDEYGMGGLMNAGF--SRWN 319

Query: 338 GFGQFCCVVLAMSTIANNVPNMYTIALSAQSVWDPFAKIPRVVWTMIGNLAALGISIPAC 397
           GFG+F  VVL +S I+NN+ N Y+ A S Q      AK+PR +W +   +  L  ++   
Sbjct: 320 GFGKFLVVVLILSLISNNIVNTYSAAFSIQLSSVMLAKVPRWIWAIGCTIFYLVCALVGR 379

Query: 398 YYFSTFMQYFMDXXXXXXXXXXXXXXCEHLIYRH-------------------------- 431
             FST +  F+                E++I+R+                          
Sbjct: 380 NSFSTILGNFLPMIGYWISMYFILLVEENVIFRNWFHHLYKLEFPNDIEVKPHHKLRKLP 439

Query: 432 NSFSNYNVEDWNNFKKLPIGIAGTISLVVGAFGVALGMSQSYWVGEIARHIGEYGGDIAI 491
                YN ++W+N + +  G+A + +  +G  GV LGM Q+Y+VG +A  IGEYGGD+ +
Sbjct: 440 RHIHRYNWDEWDNSEVITRGLAASAAFCIGVAGVVLGMCQTYYVGPLAAKIGEYGGDLGM 499

Query: 492 ELGAGWAFIAYNICR 506
            LG G+A ++Y   R
Sbjct: 500 WLGMGFAGVSYPPLR 514

>YGL186C (TPN1) [1806] chr7 complement(151041..152780) Member of the
           purine/cytosine permease family of membrane transporters
           [1740 bp, 579 aa]
          Length = 579

 Score =  183 bits (465), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 152/558 (27%), Positives = 256/558 (45%), Gaps = 59/558 (10%)

Query: 4   EDKKDLYDMEMQVESSANSHVETDGYNDATVLETKL----SLLNRLAAMISAETKGIEPI 59
           +   D+ +   +  ++++ ++ T+  N +  +  ++    + L++    +  E+ GI+ I
Sbjct: 17  KHTTDVIEFYEEGTAASSLNIATEKANSSPSILRRIINRAAWLSKKVDAMGVESTGIQRI 76

Query: 60  TDDEK--NDDSLINAASMWFSANMVXXXXXXXXXXXXVFGLNFGVSVLTIVFFNILGLFA 117
           +  E+  +    ++ A +W SA               +FGL+F  SV + +    +G   
Sbjct: 77  SPYERGTSKKQFLHVAGLWLSATGGLSSMSSFLLGPLLFGLSFRESVASSLISVTIGCLI 136

Query: 118 VAFFSVFGAKFGLRQMVLSRYLVGNITARIFALINSVACVGWGIVNTVAASQLLNEINPG 177
            A+ S+ G + G RQMV +RYL G    ++ AL + +  +GW +VN+V   ++L  I+  
Sbjct: 137 AAYCSIMGPQSGCRQMVTARYLFGWWFVKLVALASIIGVMGWSVVNSVVGGEMLAAIS-- 194

Query: 178 SHQLPLWGGCLVIIGATILVSFFGYKVIHTYEKYSWVPNFAVFLVLIARLKISGKFHNGA 237
           + ++PLW G +++   + LV+ FG K +   E Y  VP    FL+L         F N  
Sbjct: 195 NDKVPLWVGIVIVTVCSFLVAIFGIKQVIKVETYLSVPVLTAFLLLYISSSDKYSFVNAY 254

Query: 238 WGSG----PTTAGSVLSFGSAVFGFASGWTTYAADYTVYMPRNTNSYKIFFALVAGLAFP 293
              G     T  G+ +SF S  +   + W +  ADY +  P +T   +IF     G   P
Sbjct: 255 VSKGNLDSSTRKGNWMSFFSLCYSITATWGSITADYYILFPEDTPYIQIFCLTFFGTFLP 314

Query: 294 LFFTMILGSACAQAAVDYTPWQEFYNKNGMGGLTFAILVPDSLHGFGQFCCVVLAMSTIA 353
             F  ILG   A  A+ Y PW   Y+ +GMGGL +A       +GFG+FC VVL  S ++
Sbjct: 315 TCFVGILGLLLASVAMSYKPWSVEYDSHGMGGLLWAGF--QRWNGFGKFCVVVLVFSLVS 372

Query: 354 NNVPNMYTIALSAQSVWDPFAKIPRVVWTMIGNLAALGISIPACYYFSTFMQYFMDXXXX 413
           NN+ N Y+ A S Q      AKIPR  W+++  +  L  ++    +FST +  F+     
Sbjct: 373 NNIINTYSAAFSIQLSSVFCAKIPRWFWSIVCTIICLVCALIGRNHFSTILGNFLPMIGY 432

Query: 414 XXXXXXXXXXCEHLIYRH-------------------------------NSFSN------ 436
                      E+L++R                                ++ +N      
Sbjct: 433 WISMYFILLFEENLVFRRFFLHLYTKEFPTVTGEINGPELVGSSKEVEKDAVTNIHLLKR 492

Query: 437 --------YNVEDWNNFKKLPIGIAGTISLVVGAFGVALGMSQSYWVGEIARHIGEYGGD 488
                   YN + W +++ L  G A T + +VG  GV +GM+Q+YW+G IA   GEYGGD
Sbjct: 493 KHKVTKHRYNWDKWEDYEVLTHGYAATFAFIVGVAGVVVGMAQAYWIGPIAAKFGEYGGD 552

Query: 489 IAIELGAGWAFIAYNICR 506
           +A+ L   ++ + Y  CR
Sbjct: 553 VAMWLSMAFSGVVYPPCR 570

>Scas_710.30
          Length = 584

 Score =  169 bits (429), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 122/415 (29%), Positives = 199/415 (47%), Gaps = 14/415 (3%)

Query: 40  SLLNRLAAMISAETKGIEPITDDEK--NDDSLINAASMWFSANMVXXXXXXXXXXXXVFG 97
           +LL++    +  E  GIE I+  E+       I+ A  W +A               +FG
Sbjct: 34  NLLSKKLDSLGVEATGIERISPYERGSKRKQFIHVAGYWLAATGSLSSMSSFLLGPLLFG 93

Query: 98  LNFGVSVLTIVFFNILGLFAVAFFSVFGAKFGLRQMVLSRYLVGNITARIFALINSVACV 157
           L F  S+++ +    +G    A+ S+ G + G RQMV +RYL G    +  AL   +  +
Sbjct: 94  LTFNESMVSGIVSMAIGCLVAAYCSIMGPQSGCRQMVTARYLFGWWFVKFVALAAIIGVM 153

Query: 158 GWGIVNTVAASQLLNEINPGSHQLPLWGGCLVIIGATILVSFFGYKVIHTYEKYSWVPNF 217
           GW +VN+V   ++L  I+  + ++PLW G L++   + LV+ FG K +   E Y  +P +
Sbjct: 154 GWSVVNSVVGGEMLASIS--NDKVPLWVGVLIVTLFSFLVAVFGIKQVLKVETYLSIPVW 211

Query: 218 AVFLVLIARLKISGKFHNGAWGSGP-----TTAGSVLSFGSAVFGFASGWTTYAADYTVY 272
            +F++L   +  S K+H       P     T  G+ LSF S  +   + W +  ADY + 
Sbjct: 212 LMFILLY--ISSSDKYHYIDDFKSPIPDRLTLKGNWLSFFSLCYSITATWGSITADYYIL 269

Query: 273 MPRNTNSYKIFFALVAGLAFPLFFTMILGSACAQAAVDYTPWQEFYNKNGMGGLTFAILV 332
            P +T+ +++F     G   P  F  +LG   +  A  Y PW + YNK GMGGL  A   
Sbjct: 270 FPEDTSKFQVFMLTFLGTVVPTLFVGVLGLCLSTVAATYEPWNDDYNKYGMGGLLHAGF- 328

Query: 333 PDSLHGFGQFCCVVLAMSTIANNVPNMYTIALSAQSVWDPFAKIPRVVWTMIGNLAALGI 392
               +GFG+FC VVL +S I+NN+ N Y+ A S Q      AK+PR  W+++  +  L  
Sbjct: 329 -KRWNGFGKFCVVVLLLSLISNNIINTYSAAFSVQLASVKAAKVPRWFWSIVCMIICLVC 387

Query: 393 SIPACYYFSTFMQYFMDXXXXXXXXXXXXXXCEHLIYRHNSFSNYNVEDWNNFKK 447
           ++    +FST +  F+                E++I+R   F +   +++  F K
Sbjct: 388 ALVGRNHFSTILGNFLPMIGYWISMYFILLLEENVIFRE-YFHHLYYKEFPEFDK 441

 Score = 61.2 bits (147), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 48/83 (57%), Gaps = 2/83 (2%)

Query: 426 HLIYRHN--SFSNYNVEDWNNFKKLPIGIAGTISLVVGAFGVALGMSQSYWVGEIARHIG 483
           HL+ R +  +   YN   W++ + L  G A T + + G  GV +GM+Q+YW+G +AR  G
Sbjct: 493 HLLKRRHLATSHKYNWNKWDDPEVLTHGYAATFAFLCGVAGVVVGMAQAYWIGPLARKFG 552

Query: 484 EYGGDIAIELGAGWAFIAYNICR 506
           E GGDIA+ L   ++ + Y   R
Sbjct: 553 ETGGDIAMWLSMAFSGLVYPPLR 575

>CAGL0L06138g 695566..697461 similar to sp|P53099 Saccharomyces
           cerevisiae YGL186c, start by similarity
          Length = 631

 Score =  157 bits (398), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 132/476 (27%), Positives = 211/476 (44%), Gaps = 48/476 (10%)

Query: 4   EDKKDLYDM--EMQVESSANSHVE--------TDGYNDATVLETKLSLLNR--------- 44
           ED KDL ++  + +V+S  NS  +        TD  +       KL  L+R         
Sbjct: 12  EDSKDLQNVVQQFEVQSVDNSDYDLEKRSTHKTDPDSRTNRRNKKLFDLDRHDPNLNIFM 71

Query: 45  --LAAMI---------SAETKGIEPITDDEK-NDDSLINAASMWFSANMVXXXXXXXXXX 92
             LA ++           ET GIE +   E+      ++ A +W SA             
Sbjct: 72  KGLAYLLWLSDKLDSFGVETSGIERVPPYERGTKKQFLHVAGLWLSATGGLSSMSSFLLG 131

Query: 93  XXVFGLNFGVSVLTIVFFNILGLFAVAFFSVFGAKFGLRQMVLSRYLVGNITARIFALIN 152
             +F L+F  ++ + +    +G    A+ S+ G + G RQMV +RYL G    +  AL  
Sbjct: 132 PLLFELSFQQALTSSMISVTVGCLVAAYCSIMGPQSGCRQMVTARYLFGWWFVKFVALAA 191

Query: 153 SVACVGWGIVNTVAASQLLNEINPGSHQLPLWGGCLVIIGATILVSFFGYKVIHTYEKYS 212
            +  +GW + N+V   ++L  I+  + ++PLW G +++   + +V+ FG K +   E Y 
Sbjct: 192 IIGVMGWSVTNSVVGGEMLAAIS--NDRVPLWVGIVIVTVCSFVVAIFGIKQVLRIETYI 249

Query: 213 WVPNFAVFLVLIARLKISGKFHNGAWGSGP------TTAGSVLSFGSAVFGFASGWTTYA 266
            VP    FL+L      SG          P      T  G+ +SF S  +   S W +  
Sbjct: 250 SVPVLTSFLLLYIS---SGNRDYLVREYKPIDVPSKTIKGNWISFFSLCYSITSTWGSIT 306

Query: 267 ADYTVYMPRNTNSYKIFFALVAGLAFPLFFTMILGSACAQAAVDYTPWQEFYNKNGMGGL 326
           ADY +  P +T  Y++F   +AG   P  F  ILG   A  A  Y P+ E Y+ +GMGGL
Sbjct: 307 ADYYILFPEDTPHYQVFLLTLAGTLIPTTFVGILGLTLASIAKSYQPYGEEYDTHGMGGL 366

Query: 327 TFAILVPDSLHGFGQFCCVVLAMSTIANNVPNMYTIALSAQ--SVWDPFAKIPRVVWTMI 384
            +A       +GFG+F  VVL +S I+NN+ N Y+ A   Q  +VW   A++PR  W ++
Sbjct: 367 LWAGF--SRWNGFGKFLVVVLILSLISNNIINTYSAAFGIQLSAVWA--ARVPRWFWCIV 422

Query: 385 GNLAALGISIPACYYFSTFMQYFMDXXXXXXXXXXXXXXCEHLIYRHNSFSNYNVE 440
             +  L  ++    +F+T +  F+                E++I+R      Y  E
Sbjct: 423 CTIVYLVCALVGRNHFATILGNFLPMIGYWISMYFILLFEENVIFRRYFLHLYTKE 478

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 50/83 (60%), Gaps = 5/83 (6%)

Query: 425 EHLIYRHNSFSNYNVEDWNNFKKLPIGIAGTISLVVGAFGVALGMSQSYWVGEIARHI-G 483
           +H+  +H     YN ++W+N   L  G A T + + G  GV +GM+Q+YWVG IAR + G
Sbjct: 544 KHIHTKHR----YNWDEWDNPDVLTHGYAATFAFLCGVAGVVVGMAQTYWVGPIARKLGG 599

Query: 484 EYGGDIAIELGAGWAFIAYNICR 506
            YGGDIA+ L  G++ I Y   R
Sbjct: 600 PYGGDIAMWLSMGFSGIVYPWLR 622

>Scas_701.1
          Length = 68

 Score = 84.7 bits (208), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 40/60 (66%), Positives = 45/60 (75%)

Query: 448 LPIGIAGTISLVVGAFGVALGMSQSYWVGEIARHIGEYGGDIAIELGAGWAFIAYNICRP 507
           LPIGIAG +   V AFGVALGM QSYWVGEI R IG+ GGD+  E+GA W FIAY + RP
Sbjct: 1   LPIGIAGGVGFFVAAFGVALGMCQSYWVGEIGRRIGKDGGDVGFEMGAAWGFIAYVLVRP 60

>Scas_690.1*
          Length = 636

 Score = 89.7 bits (221), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 45/84 (53%), Positives = 52/84 (61%), Gaps = 3/84 (3%)

Query: 427 LIYRHN---SFSNYNVEDWNNFKKLPIGIAGTISLVVGAFGVALGMSQSYWVGEIARHIG 483
           LIY  N    F +       +   LPIGIAG +   V AFGVALGM QSYWVGEI R IG
Sbjct: 545 LIYMDNLSPEFHHIGASSARDGHSLPIGIAGGVGFFVAAFGVALGMCQSYWVGEIGRRIG 604

Query: 484 EYGGDIAIELGAGWAFIAYNICRP 507
           + GGD+  E+GA W FIAY + RP
Sbjct: 605 KDGGDVGFEMGAAWGFIAYVLVRP 628

>CAGL0F02717g 261361..265989 tr|O74208 Candida glabrata
          ATP-binding cassette transporter, identified start
          Length = 1542

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 12 MEMQVESSANSHVETDGYNDATVLETKLSLLNRLAAMISAETKGIEPITDDEKNDD 67
          +  Q  +S+N  V  +   D +    ++S   R +++ SA+ KG+ P+  DE+ DD
Sbjct: 36 LTQQSLTSSNRSVNKEAPADGSAPLDRVS--TRASSIFSADFKGVNPVFSDEEEDD 89

>Sklu_2364.6 YAR002C-A, Contig c2364 10693-11352
          Length = 219

 Score = 29.3 bits (64), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 14/67 (20%), Positives = 34/67 (50%)

Query: 12  MEMQVESSANSHVETDGYNDATVLETKLSLLNRLAAMISAETKGIEPITDDEKNDDSLIN 71
           ++++ E  +NS +++   N    L++K+ +LN   A I  E   +       ++    +N
Sbjct: 125 IDIEFEVGSNSKLDSKKKNSVQTLQSKVQILNEKVAEIRREQTLVREREAMFRDASESVN 184

Query: 72  AASMWFS 78
           + +MW++
Sbjct: 185 SRAMWWA 191

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.138    0.435 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,070,672
Number of extensions: 590375
Number of successful extensions: 1954
Number of sequences better than 10.0: 29
Number of HSP's gapped: 1956
Number of HSP's successfully gapped: 33
Length of query: 507
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 401
Effective length of database: 12,926,601
Effective search space: 5183567001
Effective search space used: 5183567001
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 64 (29.3 bits)