Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0J02926g1271256546e-90
Scas_715.52107973507e-44
Kwal_23.5805102943481e-43
YER058W (PET117)1071003429e-43
Sklu_2193.4102983307e-41
KLLA0C08327g103973054e-37
ADL076W113952934e-35
YKL065C206120700.12
CAGL0I10670g55584631.1
AFR669W191859621.7
Scas_592.545340611.8
YIL149C (MLP2)167952603.3
Scas_718.12144637603.3
Sklu_2415.2571105594.2
YPR023C (EAF3)40137584.8
YHR096C (HXT5)59285585.6
ADR241C99344576.3
Scas_685.556044568.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J02926g
         (125 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J02926g 281301..281684 similar to sp|Q02771 Saccharomyces c...   256   6e-90
Scas_715.52                                                           139   7e-44
Kwal_23.5805                                                          138   1e-43
YER058W (PET117) [1488] chr5 (271766..272089) Protein involved i...   136   9e-43
Sklu_2193.4 YER058W, Contig c2193 6568-6876                           131   7e-41
KLLA0C08327g complement(730884..731195) similar to sp|Q02771 Sac...   122   4e-37
ADL076W [1665] [Homologous to ScYER058W (PET117) - SH] complemen...   117   4e-35
YKL065C (YKL065C) [3194] chr11 complement(316082..316702) Transm...    32   0.12 
CAGL0I10670g 1045681..1047348 similar to tr|Q06512 Saccharomyces...    29   1.1  
AFR669W [3862] [Homologous to ScYNL271C (BNI1) - SH] complement(...    28   1.7  
Scas_592.5                                                             28   1.8  
YIL149C (MLP2) [2528] chr9 complement(63028..68067) Protein asso...    28   3.3  
Scas_718.12                                                            28   3.3  
Sklu_2415.2 YJL214W, Contig c2415 2182-3897 reverse complement         27   4.2  
YPR023C (EAF3) [5457] chr16 complement(608821..610026) Component...    27   4.8  
YHR096C (HXT5) [2384] chr8 complement(294671..296449) Member of ...    27   5.6  
ADR241C [1982] [Homologous to ScYLR039C (RIC1) - SH] (1123202..1...    27   6.3  
Scas_685.5                                                             26   8.5  

>CAGL0J02926g 281301..281684 similar to sp|Q02771 Saccharomyces
           cerevisiae YER058w PET117, start by similarity
          Length = 127

 Score =  256 bits (654), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 125/125 (100%), Positives = 125/125 (100%)

Query: 1   MINEPGGEVIKAGGREGVTAILASIYNQDQTMSRASKITFGVSCAVTLATIIGVHYVQEL 60
           MINEPGGEVIKAGGREGVTAILASIYNQDQTMSRASKITFGVSCAVTLATIIGVHYVQEL
Sbjct: 1   MINEPGGEVIKAGGREGVTAILASIYNQDQTMSRASKITFGVSCAVTLATIIGVHYVQEL 60

Query: 61  ERETLHQGPIKDAKRVAEKKKLMPAGTDEKKLLNRSEHELQQELRKKYESMQPLSGEVVT 120
           ERETLHQGPIKDAKRVAEKKKLMPAGTDEKKLLNRSEHELQQELRKKYESMQPLSGEVVT
Sbjct: 61  ERETLHQGPIKDAKRVAEKKKLMPAGTDEKKLLNRSEHELQQELRKKYESMQPLSGEVVT 120

Query: 121 QDGER 125
           QDGER
Sbjct: 121 QDGER 125

>Scas_715.52
          Length = 107

 Score =  139 bits (350), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 81/97 (83%), Gaps = 4/97 (4%)

Query: 32  MSRASKITFGVSCAVTLATIIGVHYVQELERETLHQGPIKDAKRVAEKKKLMPAGTD--- 88
           MSRASKITF ++C  T+ T +GVHYVQ +ER+TLHQGPIKDAKRVAEKK+L  +G D   
Sbjct: 1   MSRASKITFALTCVFTITTTVGVHYVQGMERDTLHQGPIKDAKRVAEKKRLKESGLDPAK 60

Query: 89  -EKKLLNRSEHELQQELRKKYESMQPLSGEVVTQDGE 124
            +K++ N+SEHELQ+EL+K+YE  QPLSGEVVT+DGE
Sbjct: 61  EKKRMFNQSEHELQKELKKQYEQQQPLSGEVVTKDGE 97

>Kwal_23.5805
          Length = 102

 Score =  138 bits (348), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 79/94 (84%), Gaps = 2/94 (2%)

Query: 32  MSRASKITFGVSCAVTLATIIGVHYVQELERETLHQGPIKDAKRVAEKKKLMPAGTDEKK 91
           MS ASKIT  +SC +T AT+IGVHYVQELER+TLHQGPIKDAKR+A++K  M    + KK
Sbjct: 1   MSTASKITLALSCVLTTATVIGVHYVQELERDTLHQGPIKDAKRIADRKAEME--NERKK 58

Query: 92  LLNRSEHELQQELRKKYESMQPLSGEVVTQDGER 125
             N SEHELQQELR+KYE++QPLSGEV+T+DGER
Sbjct: 59  RFNESEHELQQELRRKYEALQPLSGEVLTKDGER 92

>YER058W (PET117) [1488] chr5 (271766..272089) Protein involved in
           assembly of cytochrome oxidase [324 bp, 107 aa]
          Length = 107

 Score =  136 bits (342), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 77/100 (77%), Gaps = 7/100 (7%)

Query: 32  MSRASKITFGVSCAVTLATIIGVHYVQELERETLHQGPIKDAKRVAEKKKLMPAGT---- 87
           MSRASKITF  SC +T AT++GVHYVQE+ERETLHQGPIKDAKRV EK+     G     
Sbjct: 1   MSRASKITFAASCLITAATVVGVHYVQEMERETLHQGPIKDAKRVEEKRLRKTNGVASLD 60

Query: 88  ---DEKKLLNRSEHELQQELRKKYESMQPLSGEVVTQDGE 124
              + K+  N SEHE Q+ELRKKYE+MQPLSGEVVT+DGE
Sbjct: 61  PTKERKRYFNMSEHEEQKELRKKYETMQPLSGEVVTKDGE 100

>Sklu_2193.4 YER058W, Contig c2193 6568-6876
          Length = 102

 Score =  131 bits (330), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 77/98 (78%), Gaps = 5/98 (5%)

Query: 32  MSRASKITFGVSCAVTLATIIGVHYVQELERETLHQGPIKDAKRVAEKK-----KLMPAG 86
           MSRASKIT  +SC +T  T+IGVH VQ++ER+TLHQGPIKDAKRVAEKK     +     
Sbjct: 1   MSRASKITLALSCLLTTTTVIGVHIVQDMERQTLHQGPIKDAKRVAEKKLAKEEQNQDPS 60

Query: 87  TDEKKLLNRSEHELQQELRKKYESMQPLSGEVVTQDGE 124
               KL+N+ EHELQQELRKKYE+MQPLSGEV+T+DGE
Sbjct: 61  KQRMKLVNKGEHELQQELRKKYEAMQPLSGEVLTKDGE 98

>KLLA0C08327g complement(730884..731195) similar to sp|Q02771
           Saccharomyces cerevisiae YER058w PET117 cytochrome c
           oxidase assembly factor singleton, start by similarity
          Length = 103

 Score =  122 bits (305), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 61/97 (62%), Positives = 74/97 (76%), Gaps = 4/97 (4%)

Query: 32  MSRASKITFGVSCAVTLATIIGVHYVQELERETLHQGPIKDAKRVAEKKKLMPAGTDEKK 91
           MSRASKIT G++   T   ++GVH+VQELER+TLHQGPIKDA+RVAEKK     G D +K
Sbjct: 1   MSRASKITLGLTTLFTATIVVGVHHVQELERQTLHQGPIKDAQRVAEKKLARQNGVDPEK 60

Query: 92  ----LLNRSEHELQQELRKKYESMQPLSGEVVTQDGE 124
               ++N++EHE Q ELRKKYE MQPLSGEV T+D E
Sbjct: 61  ERQRMVNKNEHEYQLELRKKYEQMQPLSGEVRTKDNE 97

>ADL076W [1665] [Homologous to ScYER058W (PET117) - SH]
           complement(550058..550399) [342 bp, 113 aa]
          Length = 113

 Score =  117 bits (293), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 71/95 (74%), Gaps = 2/95 (2%)

Query: 32  MSRASKITFGVSCAVTLATIIGVHYVQELERETLHQGPIKDAKRVAEKKKLMPAGTD--E 89
           MSRASKIT  +  A + AT++ VH VQE+ER+ L QGPIKDA R AEK+    A  +   
Sbjct: 14  MSRASKITLALCTAASAATVVTVHLVQEMERDALKQGPIKDALRTAEKRAERDADPEAAR 73

Query: 90  KKLLNRSEHELQQELRKKYESMQPLSGEVVTQDGE 124
           KK+LN SEHELQ ELR+KY +MQPLSGEVVTQDG+
Sbjct: 74  KKMLNASEHELQLELRRKYAAMQPLSGEVVTQDGD 108

>YKL065C (YKL065C) [3194] chr11 complement(316082..316702)
           Transmembrane protein of the endoplasmic reticulum [621
           bp, 206 aa]
          Length = 206

 Score = 31.6 bits (70), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 59/120 (49%), Gaps = 21/120 (17%)

Query: 3   NEPGGEVIKAGGREGVTAI--LAS-IYNQDQTMSRASKITFGVSCAVTLATIIGVHYVQE 59
           N+  G +    G   VT I  LAS  YNQ + M  +  I +   C  T+ +I+       
Sbjct: 78  NDNSGSI----GSSAVTPIQALASRAYNQ-RNMYISGFILYFSICIPTVMSIV------- 125

Query: 60  LERETLHQGPIKDAKRVAEKKKLMPAGTDEKKLLNRSEH-ELQQELRKKYESMQPLSGEV 118
            +R   +QG I +     EK+KL    ++ KK  N ++  +LQ+ELRKK  S++ L  +V
Sbjct: 126 -KRLVKYQGLINEQ----EKQKLNKPSSNSKKDSNEADSTKLQEELRKKQISLEGLQKQV 180

>CAGL0I10670g 1045681..1047348 similar to tr|Q06512 Saccharomyces
           cerevisiae YPR144c, start by similarity
          Length = 555

 Score = 28.9 bits (63), Expect = 1.1,   Method: Composition-based stats.
 Identities = 30/84 (35%), Positives = 40/84 (47%), Gaps = 13/84 (15%)

Query: 36  SKITFGVSCAVTLATIIGVHYVQELERETLHQGPIKDAKRVAEK--KKLMPAGTDEKKLL 93
           SK+ F   C++TL  +    Y+Q LE+E++H    KDA     K  +KL+ A  D     
Sbjct: 102 SKVEF--ECSLTLDCLDV--YMQLLEQESIHFASSKDATYFPNKSFRKLIKALFDS---- 153

Query: 94  NRSEHELQQELRKKYESMQPLSGE 117
           N  E EL     K  ES  PL  E
Sbjct: 154 NLKEFELDP---KTGESQSPLITE 174

>AFR669W [3862] [Homologous to ScYNL271C (BNI1) - SH]
           complement(1661761..1667517) [5757 bp, 1918 aa]
          Length = 1918

 Score = 28.5 bits (62), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 2/59 (3%)

Query: 57  VQELERETLHQGPIKDAKRVAEKKKLMPAGTDEKKLLNRSEHELQQELRKKYESMQPLS 115
           ++EL +E L +  I  +  V   ++LM  G D+K L+ +   +LQ E +K   SM P S
Sbjct: 194 IEELYQELLQKRNIPQSVSVHGHRELMSYGIDKKWLMVK--QDLQTEYKKMKNSMPPSS 250

>Scas_592.5
          Length = 453

 Score = 28.1 bits (61), Expect = 1.8,   Method: Composition-based stats.
 Identities = 14/40 (35%), Positives = 24/40 (60%)

Query: 65  LHQGPIKDAKRVAEKKKLMPAGTDEKKLLNRSEHELQQEL 104
           LH+G +  A+R+ +    M   TD  +LL  +E+EL++ L
Sbjct: 398 LHRGSLTKAERLLKDSISMAKETDFTELLTEAENELKRAL 437

>YIL149C (MLP2) [2528] chr9 complement(63028..68067) Protein
            associated with the nuclear pore complex, with similarity
            to Mlp1p and myosin heavy chains, has potential
            coiled-coil domain [5040 bp, 1679 aa]
          Length = 1679

 Score = 27.7 bits (60), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 35/52 (67%), Gaps = 2/52 (3%)

Query: 56   YVQELERETLHQGPIKDAKRVAEKKKLMPAGTDEKKLLNRSEHELQQELRKK 107
            +++E E ETL +  IK+A+   +K+  +P+    +K++++ + EL++E RKK
Sbjct: 1436 WLKEYEDETLRR--IKEAEENLKKRIRLPSEERIQKIISKRKEELEEEFRKK 1485

>Scas_718.12
          Length = 1446

 Score = 27.7 bits (60), Expect = 3.3,   Method: Composition-based stats.
 Identities = 13/37 (35%), Positives = 19/37 (51%)

Query: 1    MINEPGGEVIKAGGREGVTAILASIYNQDQTMSRASK 37
            +I  PG E I    +EG   +L +IYNQ     + +K
Sbjct: 1121 LIRIPGYETIIVSTKEGNITLLRAIYNQQGQFKKFTK 1157

>Sklu_2415.2 YJL214W, Contig c2415 2182-3897 reverse complement
          Length = 571

 Score = 27.3 bits (59), Expect = 4.2,   Method: Composition-based stats.
 Identities = 28/105 (26%), Positives = 48/105 (45%), Gaps = 24/105 (22%)

Query: 37  KITFGVSCAVTLATIIGVHYVQELERETLHQGPIKDAKR-VAEKKK-------------L 82
           ++  G+  A  +  ++G+ +V E  R  +  G ++DAKR VA+  K             L
Sbjct: 240 RVPLGLCFAWAIIMVVGMCFVPESPRFLVKVGRVEDAKRSVAKSNKISVEDPAVQAEVDL 299

Query: 83  MPAGTDEKKLLNRSE-HELQQELRKKYE---------SMQPLSGE 117
           + AG + +KL   S   EL  +  K ++         S+Q LSG+
Sbjct: 300 IAAGVEVEKLAGSSSWGELFSKKTKVFQRLVMSVMINSLQQLSGD 344

>YPR023C (EAF3) [5457] chr16 complement(608821..610026) Component of
           the NuA4 histone acetyltransferase complex [1206 bp, 401
           aa]
          Length = 401

 Score = 26.9 bits (58), Expect = 4.8,   Method: Composition-based stats.
 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 2/37 (5%)

Query: 70  IKDAKRVAEKKKL--MPAGTDEKKLLNRSEHELQQEL 104
           + D + V + KK+  +PA    + +LN+ EHE+ QEL
Sbjct: 233 VDDWEYVTKDKKICRLPADVTVEMVLNKYEHEVSQEL 269

>YHR096C (HXT5) [2384] chr8 complement(294671..296449) Member of the
           hexose transporter family of the major facilitator
           superfamily (MFS) [1779 bp, 592 aa]
          Length = 592

 Score = 26.9 bits (58), Expect = 5.6,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 40/85 (47%), Gaps = 5/85 (5%)

Query: 37  KITFGVSCAVTLATIIGVHYVQELERETLHQGPIKDAKR-VAEKKKLMPAGTDEKKLLNR 95
           ++  G+  A ++  I+G+ +V E  R  +  G I++AKR +A   K     T++  L+  
Sbjct: 257 RVPLGLCFAWSIFMIVGMTFVPESPRYLVEVGKIEEAKRSLARANKT----TEDSPLVTL 312

Query: 96  SEHELQQELRKKYESMQPLSGEVVT 120
                Q  +  +  +     GE+VT
Sbjct: 313 EMENYQSSIEAERLAGSASWGELVT 337

>ADR241C [1982] [Homologous to ScYLR039C (RIC1) - SH]
           (1123202..1126183) [2982 bp, 993 aa]
          Length = 993

 Score = 26.6 bits (57), Expect = 6.3,   Method: Composition-based stats.
 Identities = 13/44 (29%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 82  LMPAGTDEKKLLNRSE-HELQQELRKKYESMQPLSGEVVTQDGE 124
           L PAG +  K  ++S+ H+L +E+      + P  G+++  DG+
Sbjct: 629 LHPAGVETIKRFHQSKRHKLPEEVSSNVRWLLPWKGQLLVLDGD 672

>Scas_685.5
          Length = 560

 Score = 26.2 bits (56), Expect = 8.5,   Method: Composition-based stats.
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query: 40  FGVSCAVTLATIIGVHYVQELERETLHQGPIKDAKR-VAEKKKL 82
            G+S A  L  I G+ +V E  R  L  G +++AKR V    KL
Sbjct: 226 LGLSFAWALFMIAGMSFVPESPRYLLEIGKVEEAKRSVGTSNKL 269

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.129    0.349 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,842,110
Number of extensions: 144013
Number of successful extensions: 606
Number of sequences better than 10.0: 45
Number of HSP's gapped: 599
Number of HSP's successfully gapped: 46
Length of query: 125
Length of database: 16,596,109
Length adjustment: 89
Effective length of query: 36
Effective length of database: 13,515,107
Effective search space: 486543852
Effective search space used: 486543852
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 55 (25.8 bits)