Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0J02904g54353525810.0
YER054C (GIP2)5485498831e-112
Scas_715.465705268411e-106
Scas_704.415821865079e-57
Sklu_2260.63991994189e-46
CAGL0L00803g8271864332e-45
YIL045W (PIG2)5382054181e-44
ADL083C3541603599e-38
Kwal_23.57644621833463e-35
KLLA0F27533g4981012262e-19
YOR178C (GAC1)7931161159e-06
YLR273C (PIG1)648117960.002
AGR275C67979950.002
CAGL0H04037g91574900.008
Kwal_56.2326242968890.009
CAGL0F04917g682106870.019
Scas_526.491598830.059
Scas_521.157957780.18
Scas_659.2159428750.43
KLLA0D09240g74888721.0
Sklu_2428.850669682.9
Scas_690.35169647675.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J02904g
         (535 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J02904g complement(279516..281147) similar to sp|P40036 Sac...   998   0.0  
YER054C (GIP2) [1483] chr5 complement(262051..263697) Glc7p-inte...   344   e-112
Scas_715.46                                                           328   e-106
Scas_704.41                                                           199   9e-57
Sklu_2260.6 YIL045W, Contig c2260 9086-10285 reverse complement       165   9e-46
CAGL0L00803g 98548..101031 some similarities with sp|P40036 Sacc...   171   2e-45
YIL045W (PIG2) [2622] chr9 (271160..272776) Protein that interac...   165   1e-44
ADL083C [1658] [Homologous to ScYIL045W (PIG2) - SH; ScYER054C (...   142   9e-38
Kwal_23.5764                                                          137   3e-35
KLLA0F27533g 2549457..2550953 weakly similar to sp|P40036 Saccha...    92   2e-19
YOR178C (GAC1) [4975] chr15 complement(667860..670241) Regulator...    49   9e-06
YLR273C (PIG1) [3666] chr12 complement(689085..691031) Protein t...    42   0.002
AGR275C [4586] [Homologous to ScYOR178C (GAC1) - SH; ScYLR273C (...    41   0.002
CAGL0H04037g complement(379169..381916) weakly similar to sp|P28...    39   0.008
Kwal_56.23262                                                          39   0.009
CAGL0F04917g complement(499132..501180) weakly similar to sp|P28...    38   0.019
Scas_526.4                                                             37   0.059
Scas_521.1                                                             35   0.18 
Scas_659.21                                                            33   0.43 
KLLA0D09240g complement(775848..778094) some similarities with s...    32   1.0  
Sklu_2428.8 YOR066W, Contig c2428 12993-14513 reverse complement       31   2.9  
Scas_690.35                                                            30   5.2  

>CAGL0J02904g complement(279516..281147) similar to sp|P40036
           Saccharomyces cerevisiae YER054c GIP2, hypothetical
           start
          Length = 543

 Score =  998 bits (2581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/535 (91%), Positives = 487/535 (91%)

Query: 1   MTYIRAGAVPLQEKSPREKHTANVYAGKMNGAIVGGSGKLTSLQFLHKPQRVSQLNKDRF 60
           MTYIRAGAVPLQEKSPREKHTANVYAGKMNGAIVGGSGKLTSLQFLHKPQRVSQLNKDRF
Sbjct: 1   MTYIRAGAVPLQEKSPREKHTANVYAGKMNGAIVGGSGKLTSLQFLHKPQRVSQLNKDRF 60

Query: 61  PEEELLRNTQLNKNLHQVDSNYREYSQGPGDGGASERQQARDDLIPLSPKSTLPEXXXXX 120
           PEEELLRNTQLNKNLHQVDSNYREYSQGPGDGGASERQQARDDLIPLSPKSTLPE     
Sbjct: 61  PEEELLRNTQLNKNLHQVDSNYREYSQGPGDGGASERQQARDDLIPLSPKSTLPELDTNM 120

Query: 121 XXXXXXXXXXXXXXAPFSPPVYKKSGEPVKSVLKRRSKSLPGTPGLNTSMHGASPPNKLM 180
                         APFSPPVYKKSGEPVKSVLKRRSKSLPGTPGLNTSMHGASPPNKLM
Sbjct: 121 LDNTLDSDNSSNDLAPFSPPVYKKSGEPVKSVLKRRSKSLPGTPGLNTSMHGASPPNKLM 180

Query: 181 RSKSVHFDQTAPVRYFNENERPIDVSNADIYQQYGAYLNEYGIEDRRKAGRAGGLSAMMQ 240
           RSKSVHFDQTAPVRYFNENERPIDVSNADIYQQYGAYLNEYGIEDRRKAGRAGGLSAMMQ
Sbjct: 181 RSKSVHFDQTAPVRYFNENERPIDVSNADIYQQYGAYLNEYGIEDRRKAGRAGGLSAMMQ 240

Query: 241 EMSLDDKTKERLRALELESKRVDEGYDSTIAAGGQGNAGPKLRKSKRFHAIXXXXXXXXX 300
           EMSLDDKTKERLRALELESKRVDEGYDSTIAAGGQGNAGPKLRKSKRFHAI         
Sbjct: 241 EMSLDDKTKERLRALELESKRVDEGYDSTIAAGGQGNAGPKLRKSKRFHAIKKKDKDNEN 300

Query: 301 XXXXVXXXXXXXXXXXXXXXXLRDMGTAANQGNTPYSNYRTDSGASVSNGGSMFNGSYSG 360
               V                LRDMGTAANQGNTPYSNYRTDSGASVSNGGSMFNGSYSG
Sbjct: 301 NKENVSNPNSTPSSANSSSTSLRDMGTAANQGNTPYSNYRTDSGASVSNGGSMFNGSYSG 360

Query: 361 KQQQRVVGLYNENFPILSNKNPKSLKLNIFINLSQGKEVFLQELSLHIHRERAFYSPGSG 420
           KQQQRVVGLYNENFPILSNKNPKSLKLNIFINLSQGKEVFLQELSLHIHRERAFYSPGSG
Sbjct: 361 KQQQRVVGLYNENFPILSNKNPKSLKLNIFINLSQGKEVFLQELSLHIHRERAFYSPGSG 420

Query: 421 VDIGTPINTRLLSGRVLVKNIFFDKRVLIRYTWDRWRNVQDVEGVWVSSAQGLVPGGAAM 480
           VDIGTPINTRLLSGRVLVKNIFFDKRVLIRYTWDRWRNVQDVEGVWVSSAQGLVPGGAAM
Sbjct: 421 VDIGTPINTRLLSGRVLVKNIFFDKRVLIRYTWDRWRNVQDVEGVWVSSAQGLVPGGAAM 480

Query: 481 DVFHFVIDDATKWEGKASLEFCIQYTTRDDTQRLEFWDNNCGKNYCVDLVMDGFR 535
           DVFHFVIDDATKWEGKASLEFCIQYTTRDDTQRLEFWDNNCGKNYCVDLVMDGFR
Sbjct: 481 DVFHFVIDDATKWEGKASLEFCIQYTTRDDTQRLEFWDNNCGKNYCVDLVMDGFR 535

>YER054C (GIP2) [1483] chr5 complement(262051..263697)
           Glc7p-interacting protein, possible regulatory subunit
           for the PP1 family protein phosphatase Glc7p [1647 bp,
           548 aa]
          Length = 548

 Score =  344 bits (883), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 216/549 (39%), Positives = 286/549 (52%), Gaps = 118/549 (21%)

Query: 40  LTSLQFLHKPQRVSQLNKDRFPEEELLRNTQLNKNLHQV--DSNYREYSQGPGDGGA--- 94
           L SL+FLHKPQRV+Q+  +RFPEEE+ RNT LNK +     D N    S       A   
Sbjct: 56  LNSLKFLHKPQRVTQMRANRFPEEEVQRNTDLNKRIFSAGNDENVDNESGWSKIAAAKNH 115

Query: 95  --------SERQQARDDLIPLSPKSTLPEXXXXXXXXXXX------XXXXXXXXAPFSPP 140
                   S R   + +L PLSPKST+P+                          PF+PP
Sbjct: 116 TSVESLNGSTRPPFKIELPPLSPKSTVPKSFQAEYPEAKSPGNDMNFEYDEEILIPFAPP 175

Query: 141 VYKKSGEPVKSVLKRRSKSLPGTPGLNT----SMHGASPPNKLMRSKSVHFDQTAPVRYF 196
           VYKKSGE +KS LKRRSKSLP TPG+ +         SP   L+RSKSVHFDQ APV+YF
Sbjct: 176 VYKKSGELLKSSLKRRSKSLPTTPGIRSGNGVQARDGSP--MLIRSKSVHFDQAAPVKYF 233

Query: 197 NENERPIDVSNADIYQQYGAYLNEYGIEDRRKAGRAGGLSAMMQEMSLDDKTKERLRALE 256
            E+E PI+V+  + +    ++ ++                     + +D + + ++ +  
Sbjct: 234 AEDESPINVNKTEQHDNCLSFKHK------------------PVNLMVDPEEETKMLSSG 275

Query: 257 LESKRVDEGYDSTIAAG------------GQGNAGPKLRKSKRFHAIXXXXXXXXXXXXX 304
           LE+  +D+   +    G            G+G    KLRKSKRF  +             
Sbjct: 276 LETTSIDDDLTTVAPKGFAHPAKISNPNNGKGTNNTKLRKSKRFQNL------------- 322

Query: 305 VXXXXXXXXXXXXXXXXLRDMGTAANQGNTPYSNYRTDSGASVSNGGSMFNGSYSGKQQQ 364
                                    N+ + P S     S     NGG     S    +  
Sbjct: 323 -----------------------LKNRTDMPPSK----SNKKFVNGGGAHEISDRNSKNY 355

Query: 365 RVVGLYNENFPILSNKNPKSLKLNIFINLSQGKEVFLQELSLHIHRERAFYSPGS----- 419
            VVGLY++NFPILSNKNPKSLKLNIFINLSQ K+VFLQELSL+IHR+  ++S  S     
Sbjct: 356 HVVGLYSKNFPILSNKNPKSLKLNIFINLSQNKKVFLQELSLYIHRDNNYFSNSSSFYNI 415

Query: 420 --------------GVDIGTPINTRLLSGRVLVKNIFFDKRVLIRYTWDRWRNVQDVEGV 465
                         G + G    TRL++GR+LVKNIF+DKRV++RYTWD WR   +VE V
Sbjct: 416 PNSHNGNDCNGVAKGYNAGC---TRLIAGRILVKNIFYDKRVVVRYTWDSWRTTHEVECV 472

Query: 466 WVSSAQGLVPGGAAMDVFHFVIDDATKWEGKASLEFCIQYTTRDDTQRLEFWDNNCGKNY 525
           ++S   G++P G  MD+FHF+IDD +K + +  LEFCI Y+TR+D +R E+WDNN G NY
Sbjct: 473 YISDGDGILP-GTNMDIFHFIIDDVSKVDPRGKLEFCIHYSTRNDYEREEYWDNNNGNNY 531

Query: 526 CVDLVMDGF 534
            VD+VMDGF
Sbjct: 532 KVDVVMDGF 540

>Scas_715.46
          Length = 570

 Score =  328 bits (841), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 208/526 (39%), Positives = 275/526 (52%), Gaps = 63/526 (11%)

Query: 34  VGGSGK-----LTSLQFLHKPQRVSQLNKDRFPEEELLRNTQLNKNLHQVDSNYREYSQG 88
           +GG  K     L S+ FL+KPQRV+Q+N D+FPEEE+ RNT LNKN+  V S        
Sbjct: 76  IGGERKTSLNSLNSMDFLYKPQRVTQMNVDKFPEEEVKRNTDLNKNIRLVTS-------- 127

Query: 89  PGDGGASERQQARD-----DLIPLSPKSTLPEXXXXXXXXXXXXXXXXXXXAPFSPPVYK 143
            G     E +  R+     DL  +SP+ST+                          P+YK
Sbjct: 128 -GSVAKDEEETGREYMSPIDLPEISPRSTIQSSEFIQNNKTQEGVDERYDGITPLSPIYK 186

Query: 144 KSGEPVKSVLKRRSKSLPGTPG-LNTSMHGASPPNKLMRSKSVHFDQTAPVRYFNENERP 202
           KSGE +KS LKRRSKSLP T   L  S+   +   +++RSKSVHFDQ APV+YF E+E P
Sbjct: 187 KSGELLKSSLKRRSKSLPSTSEILQKSLRFENDAMEMVRSKSVHFDQKAPVKYFREDESP 246

Query: 203 IDVSNADIYQQYGAYLNEYGIEDRRKAGRAGGLSAMMQEMSLDDKTKERLRALELESKRV 262
              S  ++  ++   LN       +   R              DK        EL +  +
Sbjct: 247 ---STVNMMAEFDNLLNLM----HKPVNRV---------FEYGDK--------ELAALGL 282

Query: 263 DEGYDSTIAAGGQGNAGPKLRKSKRFHAIXXXXXXXXXXXXXVXXXXXXXXXXXXXXXXL 322
           D+  D+ +  G    A  KLRKSKRF  +                               
Sbjct: 283 DKVGDTAVNKG----AETKLRKSKRFQNVIKDKKKDNDANGNANGNDNDNINDRENNKKK 338

Query: 323 RDMGTAANQGNTPYSNYRTDSGASVSNGGSMFNGSYSGKQQQ------RVVGLYNENFPI 376
                + N+          +   +      +    YS  ++       +VVGLYN NFPI
Sbjct: 339 IKNEDSENEIRRVSDAIADNLKINTKKNNKIVTNPYSNSKRMNVITHTKVVGLYNINFPI 398

Query: 377 LSNKNPKSLKLNIFINLSQGKEVFLQELSLHIHRE----RAFYSPGSGVDIG----TPIN 428
           LSNKNPKSLKLNIFI LS+ K+ FLQE++LHI +E    R   + GS  + G       +
Sbjct: 399 LSNKNPKSLKLNIFIKLSKDKKCFLQEVTLHIEKENPLKRLLPANGSNSEFGQGSIIQRS 458

Query: 429 TRLLSGRVLVKNIFFDKRVLIRYTWDRWRNVQDVEGVWVSSAQGLVPGGAAMDVFHFVID 488
           TRL++G++LVKNIF+DKRV++RYTW+ WR V DVE +WVS   G+VPG   MDVF F+ID
Sbjct: 459 TRLITGKILVKNIFYDKRVIVRYTWNDWRTVHDVECIWVSDGDGIVPG-TNMDVFRFLID 517

Query: 489 DATKWEGKASLEFCIQYTTRDDTQRLEFWDNNCGKNYCVDLVMDGF 534
           DA K E +A LEFCIQYT R+DT+RLE+WDNN GKNY V ++M+GF
Sbjct: 518 DANKLEARAKLEFCIQYTARNDTERLEYWDNNDGKNYKVGVIMNGF 563

>Scas_704.41
          Length = 582

 Score =  199 bits (507), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 131/186 (70%), Gaps = 6/186 (3%)

Query: 350 GGSMFNGSYSGKQQQRVVGLYNENFPILSNKNPKSLKLNIFINLSQGKEVFLQELSLHIH 409
           G   FN + +   ++ V+GLY++NFP L+NKNP+SLKLNIF+N S+GK+VFLQ+L+LHI 
Sbjct: 395 GFVTFNNTTTLTSEKSVIGLYSKNFPTLNNKNPRSLKLNIFVNYSKGKKVFLQDLNLHIQ 454

Query: 410 RERAFYSPGSGVDIGTPINTRLLSGRVLVKNIFFDKRVLIRYTWDRWRNVQDVEGVWVSS 469
            +      G+          + + GR LV+NI+FDK+V+++YTWD WR+ +D+E ++VS 
Sbjct: 455 NDYINNHVGNNNK-----QNKYIIGRALVENIYFDKKVVLKYTWDNWRSYRDIEAIYVSD 509

Query: 470 AQGLVPGGAAMDVFHFVIDDATKWEGKASLEFCIQYTTRDDTQRLEFWDNNCGKNYCVDL 529
           A+ ++P G+ MDVF F+IDD  K   K  LEFCIQY TR++ +R EFWDNN  KNY VD+
Sbjct: 510 AKQIIP-GSNMDVFKFLIDDVNKSVSKCHLEFCIQYQTRNEKERKEFWDNNDDKNYKVDV 568

Query: 530 VMDGFR 535
           V + FR
Sbjct: 569 VTEVFR 574

 Score = 96.3 bits (238), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 68/188 (36%), Positives = 96/188 (51%), Gaps = 21/188 (11%)

Query: 34  VGGSGK-LTSLQFLHKPQRVSQLNKDRFPEEELLRNTQLNKNLHQVDSNYR------EYS 86
           +G S K  +SL FL +P+++ QL  +  P+EEL RNT LNKN++ + +  +       Y 
Sbjct: 90  LGSSTKPFSSLNFLQEPRKLDQLKLNALPQEELRRNTNLNKNINPIPTPIKPTIYKNSYY 149

Query: 87  QGPGDGGASERQQARDDLIPLSPKSTLPEXXXXXXXXXXXXXXXXXXXAPFSPPVYKKSG 146
               D  A + +Q  +D I  SP + +P                         PVYKKSG
Sbjct: 150 LNDNDTDAFKEEQENEDEI--SPITQVPANAKIPFPVPNNAYMEVNRIK----PVYKKSG 203

Query: 147 EPVKSVLKRRSKSLPGTPG--------LNTSMHGASPPNKLMRSKSVHFDQTAPVRYFNE 198
           E +K  LKRRS+SLP TP         +N   +G    + L RSKSVHF  T PVR+F++
Sbjct: 204 ELLKPSLKRRSQSLPVTPNISNLNLRRINGHANGNDRAHHLARSKSVHFANTLPVRFFSK 263

Query: 199 NERPIDVS 206
           +E PI V+
Sbjct: 264 DESPIIVA 271

>Sklu_2260.6 YIL045W, Contig c2260 9086-10285 reverse complement
          Length = 399

 Score =  165 bits (418), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 117/199 (58%), Gaps = 41/199 (20%)

Query: 353 MFNGS-------YSGKQQQRVVGLYNENFPILSNKNPKSLKLNIFINLSQGKEVFLQELS 405
           M NGS        SG     V GLYN+NFPILSNKNP SLKLNIF+N++ GK+VFLQ+LS
Sbjct: 208 MMNGSGPSPATTASGSSMPPVPGLYNKNFPILSNKNPTSLKLNIFLNIAHGKQVFLQDLS 267

Query: 406 LHIHRERAFYSPGSGVDIGTPINTRLLSGRVLVKNIFFDKRVLIRYTWDRWRNVQDVEGV 465
           L           G G           + G+VLVKNI +DK+V++RYTWD+W    DV+ V
Sbjct: 268 LL----------GDG---------NYVVGKVLVKNICYDKQVIVRYTWDQWNTTHDVQCV 308

Query: 466 WVSSAQGLVPGGAAMDVFHFVID-------------DATKWEGKASLEFCIQYTTRDDTQ 512
           W SS   ++P G  MD+F FV+D             D  K EG   ++FCI+YTTRD   
Sbjct: 309 WFSSGDIVLP-GMNMDMFKFVVDVPVDSAEATLATTDPDK-EGGREVQFCIRYTTRDGNY 366

Query: 513 RLEFWDNNCGKNYCVDLVM 531
           R E WDNN GKNY V +V+
Sbjct: 367 REEHWDNNNGKNYIVAVVI 385

 Score = 76.6 bits (187), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 91/191 (47%), Gaps = 48/191 (25%)

Query: 35  GGSGKLTSLQFLHKPQRVSQLNKDRFPEEELLRNTQLNK-------NLHQVDSNYREYSQ 87
            G  K  SL FLHKPQRV+QL K  + E+ L RNT LN+       N+   DS  REY  
Sbjct: 11  SGENKPRSLDFLHKPQRVTQL-KTLYAEDSLQRNTNLNRGPPPDYENVAPTDS--REYY- 66

Query: 88  GPGDGGASERQQARDDLIPLSPKSTLPEXXXXXXXXXXXXXXXXXXXAPFSP-PVYKKSG 146
             GDG               S  S  P+                     + P P+ KKSG
Sbjct: 67  --GDGTLHRGSIG-------SLNSYFPDVDEY-----------------YPPKPIRKKSG 100

Query: 147 EPVKSVLKR--RSKSLPGTPG---LNTSMHGASPPNKLMRSKSVHFDQ--TAPVRYFNEN 199
           E VKS LK+  RSKSLP TP      T +    PP    RSKSVHFDQ     V+YF ++
Sbjct: 101 ELVKSSLKQHHRSKSLPATPTGREPRTEIIIMEPPK---RSKSVHFDQRDVVSVKYFQKD 157

Query: 200 ERPIDVSNADI 210
           ERP++V+  ++
Sbjct: 158 ERPVEVAQREV 168

>CAGL0L00803g 98548..101031 some similarities with sp|P40036
           Saccharomyces cerevisiae YER054c GIP2 or sp|P40187
           Saccharomyces cerevisiae YIL045w PIG2, hypothetical
           start
          Length = 827

 Score =  171 bits (433), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 122/186 (65%), Gaps = 14/186 (7%)

Query: 357 SYSGKQQQRVVGLYNENFPILSNKNPKSLKLNIFINLSQGKEVFLQELSLHIHRERAFY- 415
           S + K+++++  L ++NFP L +K  KSLKLNIF+N +  K+V LQE+SL++ + ++ Y 
Sbjct: 642 SSTSKKEEKMTTLVSKNFPTLGSKTSKSLKLNIFLNSTSDKKVLLQEVSLNVQKRKSNYY 701

Query: 416 -----SPGSGVDIGTPINTRLL-SGRVLVKNIFFDKRVLIRYTWDRWRNVQDVEGVWVSS 469
                 PG G   G   + +L+ +G VLVKNI+FDK+V IRYTWD WR+  +VE ++V S
Sbjct: 702 NSNFGGPGIGFSTGRDEDDKLIITGTVLVKNIYFDKKVSIRYTWDHWRSCNEVESMYVGS 761

Query: 470 AQGLVPGGAAMDVFHFVIDDATKWEGK------ASLEFCIQYTTRDDTQRLEFWDNNCGK 523
               +P G+ MD+F F+ID+     G+        LEFCIQYTTR +T R E+WDNN GK
Sbjct: 762 GNNYLP-GSQMDIFRFMIDNTVLSNGQYVSNRSRELEFCIQYTTRSNTAREEYWDNNNGK 820

Query: 524 NYCVDL 529
           NY V++
Sbjct: 821 NYIVEI 826

 Score = 78.6 bits (192), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 51/77 (66%), Gaps = 6/77 (7%)

Query: 139 PPVYKKSGEPVKSVLKRRSKSLPGTPGLNTSMHGA------SPPNKLMRSKSVHFDQTAP 192
           PPVYKKSGE VKS LKRRSKSLP TP  N     +      +P ++L+RSKSVHFDQ  P
Sbjct: 451 PPVYKKSGELVKSSLKRRSKSLPVTPNSNRRTQNSRGVRMNNPRDQLIRSKSVHFDQRLP 510

Query: 193 VRYFNENERPIDVSNAD 209
           V+YF + E P  VS  D
Sbjct: 511 VKYFFKEESPSVVSIRD 527

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 32/49 (65%), Gaps = 1/49 (2%)

Query: 28  KMNGAIVGGSGKLTSLQFLHKPQRVSQLNKDRF-PEEELLRNTQLNKNL 75
           + +  I  G G++ SL FLHKPQRV+Q+  + F   EEL RNT +NK +
Sbjct: 298 RTSNVIGTGKGRINSLDFLHKPQRVTQMKSEDFISPEELKRNTDMNKQI 346

>YIL045W (PIG2) [2622] chr9 (271160..272776) Protein that interacts
           with Gsy2p, possible regulatory subunit for the
           PP1-family protein phosphatase Glc7p [1617 bp, 538 aa]
          Length = 538

 Score =  165 bits (418), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 92/205 (44%), Positives = 126/205 (61%), Gaps = 31/205 (15%)

Query: 336 YSNYRTDSGASVSNGGSMFNGSYSGKQQQRVVGLYNENFPILSNKNPKSLKLNIFINLSQ 395
           Y   RT+S  S   G ++F G+      +R+VGLYN+NFPILS++N KSLKLNIF+NLS+
Sbjct: 337 YLETRTNSAKS---GANLFIGN-----SKRIVGLYNKNFPILSDRNRKSLKLNIFLNLSR 388

Query: 396 GKEVFLQELSLHIHRERAFYSPGSGVDIGTPINTRLLSGRVLVKNIFFDKRVLIRYTWDR 455
           G+ VFLQE++L                  T  +  ++ G+V VKNI+FDK++++RYTWD 
Sbjct: 389 GRPVFLQEITL-----------------LTGFHNMVIIGKVFVKNIYFDKKIIVRYTWDA 431

Query: 456 WRNVQDVEGVWVSSAQGLVPGGAAMDVFHFVIDDATKWEGKAS----LEFCIQYTTRD-D 510
           WR   + E V+ S+A G++P G+ MD+F F IDD      K S    LEFCIQY T   D
Sbjct: 432 WRTFHESECVYFSNANGILP-GSNMDIFKFSIDDIHNPNDKDSNISQLEFCIQYLTWGVD 490

Query: 511 TQRLEFWDNNCGKNYCVDLVMDGFR 535
             R E+WDNN   NY +D+V +  R
Sbjct: 491 RSRKEYWDNNDSANYKIDVVTNETR 515

 Score =  105 bits (263), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 98/185 (52%), Gaps = 32/185 (17%)

Query: 38  GKLTSLQFLHKPQRVSQLNKDRFPEEELLRNTQLNKNLH----QVDSNYREYSQGPGDGG 93
            +L SL+FLHKP+R+S +   R P++EL RNT +NK ++    QV +++   + G     
Sbjct: 48  ARLNSLEFLHKPRRLSNVKLHRLPQDELQRNTDMNKGMYFNGKQVHAHHPFINSGANFNA 107

Query: 94  ----ASERQQARDDLIPLSPKSTLPEXXXXXXXXXXXXXXXXXXXAPFSPPVYKKSGEPV 149
                S+  +  D++ PLS  +   E                      SPP+YKKSGE V
Sbjct: 108 HHQDVSKLGEEEDEISPLSHDNFQYESEENGNP---------------SPPIYKKSGELV 152

Query: 150 KSVLKRRSKSLPGTPGLNTSMHGASPPNK---------LMRSKSVHFDQTAPVRYFNENE 200
           KS LKRRSKSLP TP    +  G+   +          L RSKSVHFD+  P++ FNENE
Sbjct: 153 KSSLKRRSKSLPITPKSIFNKTGSKSKHVNLDHVDTRLLQRSKSVHFDRVLPIKLFNENE 212

Query: 201 RPIDV 205
           +PIDV
Sbjct: 213 KPIDV 217

>ADL083C [1658] [Homologous to ScYIL045W (PIG2) - SH; ScYER054C
           (GIP2) - SH] (537421..538485) [1065 bp, 354 aa]
          Length = 354

 Score =  142 bits (359), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 70/160 (43%), Positives = 94/160 (58%), Gaps = 21/160 (13%)

Query: 369 LYNENFPILSNKNPKSLKLNIFINLSQGKEVFLQELSLHIHRERAFYSPGSGVDIGTPIN 428
           L N NFPIL+NK+P  L LNIF+N++  ++VFLQ+LSL                     +
Sbjct: 214 LRNVNFPILANKDPAVLTLNIFLNIAYNRKVFLQDLSLD--------------------S 253

Query: 429 TRLLSGRVLVKNIFFDKRVLIRYTWDRWRNVQDVEGVWVSSAQGLVPGGAAMDVFHFVID 488
             +++GRVLVKNI +DK V++RYTWD W +  D   VW+SS   ++P G  MD+F F ID
Sbjct: 254 MLVMTGRVLVKNIHYDKSVIVRYTWDNWAHTSDTASVWISSGNAVLP-GKDMDLFEFAID 312

Query: 489 DATKWEGKASLEFCIQYTTRDDTQRLEFWDNNCGKNYCVD 528
                 G   LEFCI+Y  RD++     WDNN G NY V+
Sbjct: 313 VPAPVSGTPRLEFCIRYQVRDNSDFQTHWDNNHGNNYVVE 352

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 69/185 (37%), Gaps = 57/185 (30%)

Query: 38  GKLTSLQFLHKPQRVSQLNKDRFPEEELLRNTQLNKN----LHQVDSNYREYSQGPGDGG 93
           GK +SL  L KPQR+S   +    E  L RNT  N+         D N       P DG 
Sbjct: 22  GKYSSLALLRKPQRISSRTEREEQENILKRNTDYNRKRGGGTWAADENI-----DPLDGD 76

Query: 94  ASERQQARDDLIPLSPKSTLPEXXXXXXXXXXXXXXXXXXXAPFSPPV----YKKSGEPV 149
            S R+                                       SP V    + +S    
Sbjct: 77  ESPRRAG-------------------------------------SPVVLTDYFSQSHAVY 99

Query: 150 KSVLKRRSKSLPGTPGLNTSMHGASPPNKLMRSKSVHFDQ--TAPVRYFNENERPIDVSN 207
            +V  +RS SLPGTP           P  + RSKSVHFD      V+YFN +E  + V++
Sbjct: 100 DNVGHQRSNSLPGTP-----TSALKRPGGVRRSKSVHFDNRDVVSVKYFNSDESTLLVAH 154

Query: 208 ADIYQ 212
           A  ++
Sbjct: 155 AQSFE 159

>Kwal_23.5764
          Length = 462

 Score =  137 bits (346), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 76/183 (41%), Positives = 99/183 (54%), Gaps = 40/183 (21%)

Query: 368 GLYNENFPILSNKNPKSLKLNIFINLSQGKEVFLQELSLHIHRERAFYSPGSGVDIGTPI 427
           GLY+ NF  L++ +  SLK NIF+N++     FLQELSL                IG   
Sbjct: 284 GLYHANFATLADDDQCSLKSNIFLNIAHNSSCFLQELSL----------------IG--- 324

Query: 428 NTRLLSGRVLVKNIFFDKRVLIRYTWDRWRNVQDVEGVWVSSAQGLVPGGAAMDVFHFVI 487
           +   L G VLVKN++++K VL+RYT D WR  +D+E VW SS   ++P G  MD F  VI
Sbjct: 325 DQHYLVGHVLVKNVYYEKTVLVRYTRDSWRTSRDIECVWASSGDDVLP-GMHMDRFKLVI 383

Query: 488 DDATKWEGKAS--------------------LEFCIQYTTRDDTQRLEFWDNNCGKNYCV 527
           D A   EG  S                    L+FCIQY +RD   R+E+WDNN G+NY V
Sbjct: 384 DLAGLQEGDTSRDSTPSHDSAGHACQLSTVRLQFCIQYVSRDANSRVEYWDNNAGRNYVV 443

Query: 528 DLV 530
           D+V
Sbjct: 444 DVV 446

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 67/223 (30%), Positives = 101/223 (45%), Gaps = 23/223 (10%)

Query: 35  GGSGKLT--SLQFLHKPQRVSQLNKDRFPEEELLRNTQLNKNLHQVDSNYREYSQGPGDG 92
           G +G  T  SL FLHKPQRV+Q  +  + +E L RNT +N+   +V++   +Y      G
Sbjct: 14  GSNGAFTDRSLAFLHKPQRVTQ-PRALYADEWLRRNTDMNRGNVKVENCPEDYFSQNFKG 72

Query: 93  GASERQQARDDLIPLSPKSTLPEXXXXXXXXXX-----XXXXXXXXXAPFSPPVYKKSGE 147
               +Q A  +     P ++                           A   P V KKSGE
Sbjct: 73  DGPTKQTAASEANGFDPSASNASAGDTASPLRVNPYFPAEEDSVVADAAAPPLVRKKSGE 132

Query: 148 PVKSVLK--RRSKSLPGTPGLNT--SMHGASPPNKLMRSKSVHFDQTAPV--RYFNENER 201
            V+  LK  +RS+SLP TP         G  P     RSKSVHFDQ   V  +YF + + 
Sbjct: 133 VVRPSLKMAQRSRSLPATPSDREPDKRLGGPPAAGPKRSKSVHFDQRDVVKFKYFWQEDS 192

Query: 202 PIDVSNADIYQQYGAYLNEYGIEDRRKAGRAGGLSAMMQEMSL 244
           P+DV+  D+ +         G  D ++A    G ++M +++++
Sbjct: 193 PLDVAEQDVLE---------GPLDDQRAKTVVGPTSMARDLTV 226

>KLLA0F27533g 2549457..2550953 weakly similar to sp|P40036
           Saccharomyces cerevisiae YER054c GIP2 GLC7P-interacting
           protein, hypothetical start
          Length = 498

 Score = 91.7 bits (226), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 44/101 (43%), Positives = 64/101 (63%), Gaps = 3/101 (2%)

Query: 431 LLSGRVLVKNIFFDKRVLIRYTWDRWRNVQDVEGVWVSSAQGLVPGGAA--MDVFHFVID 488
           +L G V+V+NI ++KRV++RYT D W++ QDVE VW+++   L  G  A  +DVF F I 
Sbjct: 396 MLIGNVIVRNISYEKRVIVRYTLDSWKSQQDVESVWITNHCNLKSGTGAIDIDVFQFAI- 454

Query: 489 DATKWEGKASLEFCIQYTTRDDTQRLEFWDNNCGKNYCVDL 529
           D  K      +E CI Y TR+ +  ++ WDNN G+NY V +
Sbjct: 455 DLGKINTIEHIEMCILYQTREGSSWIDHWDNNSGQNYKVSV 495

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 38/75 (50%), Gaps = 13/75 (17%)

Query: 135 APFSPPVYKKSGEPVKSVLKRRSKSLPGTPGLNTSMHGASPPNKLMRSKSVHFDQTA--P 192
           A F+PP          S+L  RSKSLP +P          PP    RSKSVHF Q+    
Sbjct: 159 AIFNPP----------SILLTRSKSLPTSPLEGRVSQEQRPP-VFKRSKSVHFAQSEKFE 207

Query: 193 VRYFNENERPIDVSN 207
           V+YF E+E P+ + N
Sbjct: 208 VKYFREDESPLFLRN 222

 Score = 37.0 bits (84), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 32/60 (53%)

Query: 37 SGKLTSLQFLHKPQRVSQLNKDRFPEEELLRNTQLNKNLHQVDSNYREYSQGPGDGGASE 96
          SGK +SL FL KPQR+S   +     + L RNT LNK+   VD + ++      D   +E
Sbjct: 12 SGKFSSLNFLRKPQRISCQVETTAMNDALKRNTDLNKSKIIVDKSLQDSQHDEHDPVGNE 71

>YOR178C (GAC1) [4975] chr15 complement(667860..670241) Regulatory
           subunit for protein serine/threonine phosphatase Glc7p
           [2382 bp, 793 aa]
          Length = 793

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 55/116 (47%), Gaps = 20/116 (17%)

Query: 432 LSGRVLVKNIFFDKRVLIRYTWDRWRNVQDVEGVWVSSAQGLVPGGAAMDVFHFVID-DA 490
           ++G V VKN+ F+K + I++T++ WR++  V   +  +    V      D F F ID ++
Sbjct: 258 ITGLVYVKNLSFEKYLEIKFTFNSWRDIHYVTANFNRTINSNV------DEFKFTIDLNS 311

Query: 491 TKW-----------EGKASLEFCIQYTTRDDTQRLEFWDNNCGKNYCVDLVMDGFR 535
            K+           +  +S    I+   R D     ++DNN GKNY   L M  F+
Sbjct: 312 LKYILLIKRIITMEKNTSSCPLNIELCCRYDVNNETYYDNNNGKNY--HLFMTTFK 365

>YLR273C (PIG1) [3666] chr12 complement(689085..691031) Protein that
           interacts with Gsy2p, possible regulatory subunit for
           the PP1 family protein phosphatase Glc7p [1947 bp, 648
           aa]
          Length = 648

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 51/117 (43%), Gaps = 23/117 (19%)

Query: 434 GRVLVKNIFFDKRVLIRYTWDRWRNVQDVEGVWVSSAQGLVPGGAAMDVFHFVID-DATK 492
           G + V N+ F+K++ I++T + W ++  +   +  S    V      D F F+ID  A K
Sbjct: 226 GLIFVNNLNFEKKIEIKFTLNNWADIHYINAHYNKSVTPHV------DEFKFIIDISALK 279

Query: 493 -------------WEGKASLEFCIQYTTRDDTQRLE---FWDNNCGKNYCVDLVMDG 533
                        +E K +    +Q+  R D    E   F+DNN  KNY + + +  
Sbjct: 280 LNLISKNLIYTNFFERKTTCLLNLQFCCRYDVNGFEYRSFYDNNDYKNYEITISLSA 336

>AGR275C [4586] [Homologous to ScYOR178C (GAC1) - SH; ScYLR273C
           (PIG1) - SH] (1254768..1256807) [2040 bp, 679 aa]
          Length = 679

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 44/79 (55%), Gaps = 8/79 (10%)

Query: 427 INTRLLSGRVLVKNIFFDKRVLIRYTWDRWRNVQDVEGVWVSSAQGLVPGGAAMDVFHFV 486
           ++   + G + V N+ F+K + +++++D W+N+  V      +AQ L    + +D F F+
Sbjct: 281 VDMHTIKGSLYVTNLHFEKFIEVKFSFDEWKNIHYV------TAQYLKTVTSKVDEFQFI 334

Query: 487 ID-DATKWEGKA-SLEFCI 503
           ID  + K+  K  +L +C+
Sbjct: 335 IDLSSYKYFMKVKNLLYCV 353

>CAGL0H04037g complement(379169..381916) weakly similar to sp|P28006
           Saccharomyces cerevisiae YOR178c GAC1 ser/thr
           phosphoprotein phosphatase 1, hypothetical start
          Length = 915

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 39/74 (52%), Gaps = 13/74 (17%)

Query: 432 LSGRVLVKNIFFDKRVLIRYTWDRWRNVQDVEGVWVSSAQGLVPGGAAMDVFHFVIDDAT 491
           + G++LVKN+ ++K + ++YT++ W ++  +   +  S        A +D F F I    
Sbjct: 298 IVGKILVKNLNYEKFIEVKYTFNNWNDIHYITAYFTKSI------SAEIDEFEFKI---- 347

Query: 492 KWEGKASLEFCIQY 505
                +SL++ +Q+
Sbjct: 348 ---NLSSLKYILQF 358

>Kwal_56.23262
          Length = 429

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 6/68 (8%)

Query: 423 IGTPINTRLLSGRVLVKNIFFDKRVLIRYTWDRWRNVQDVEGVWVSSAQGLVPGGAAMDV 482
           I   ++++ L G + V N+ F+K + I++T++ WR+V  V      S         A+D 
Sbjct: 27  ISACLDSKKLQGLIYVANLNFEKSLEIKFTFNNWRDVHYVAAHHHRSITD------AIDE 80

Query: 483 FHFVIDDA 490
           F F ID A
Sbjct: 81  FKFTIDLA 88

>CAGL0F04917g complement(499132..501180) weakly similar to sp|P28006
           Saccharomyces cerevisiae YOR178c GAC1 ser/thr
           phosphoprotein phosphatase 1, hypothetical start
          Length = 682

 Score = 38.1 bits (87), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 47/106 (44%), Gaps = 22/106 (20%)

Query: 429 TRLLSGRVLVKNIFFDKRVLIRYTWDRWRNVQDVEGVWVSSAQGLVPGGAAMDVFHFVID 488
           T  L G + V N+ F+K + ++++++ W+++      +  S    +      D F F ID
Sbjct: 189 TNKLKGLIYVNNLNFEKFIEVKFSFNNWKDIHYATATYNKSITDHI------DEFRFTID 242

Query: 489 DAT-KWEGKAS-LEFCIQYTTRDDTQRLEFWDNNCGKNYCVDLVMD 532
             T K+  K+  L +C  Y+  D T             YC DL MD
Sbjct: 243 VMTFKYILKSKGLIYCDSYSNEDCT-------------YC-DLSMD 274

>Scas_526.4
          Length = 915

 Score = 36.6 bits (83), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 22/98 (22%), Positives = 46/98 (46%), Gaps = 20/98 (20%)

Query: 428 NTRLLSGRVLVKNIFFDKRVLIRYTWDRWRNVQDVEGVWVSSAQGLVPGGAAMDVFHFVI 487
           N+  L G + V N+ F+K + I+++++ W+++  V      S        + +D F FVI
Sbjct: 304 NSSKLIGLIYVNNLNFEKFIEIKFSFNHWKDIHYVTAFLNKSV------TSNIDEFKFVI 357

Query: 488 D-DATKW-------------EGKASLEFCIQYTTRDDT 511
           D ++ K+             +   ++E C +Y   ++T
Sbjct: 358 DLNSLKFFLQVKNLLSSKLPKNNLNMELCCRYDVNNET 395

>Scas_521.1
          Length = 579

 Score = 34.7 bits (78), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 6/57 (10%)

Query: 432 LSGRVLVKNIFFDKRVLIRYTWDRWRNVQDVEGVWVSSAQGLVPGGAAMDVFHFVID 488
           L G +LV NI F+K + +++T++ W N+      +  S        A  D F F ID
Sbjct: 205 LVGLILVNNIQFEKNIEVKFTFNNWENICYQVAYFNRSL------NAKFDEFKFTID 255

>Scas_659.21
          Length = 594

 Score = 33.5 bits (75), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 20/28 (71%)

Query: 432 LSGRVLVKNIFFDKRVLIRYTWDRWRNV 459
           L G +LV NI F+K + +++T++ W N+
Sbjct: 223 LVGLILVNNIQFEKNIEVKFTFNNWENI 250

>KLLA0D09240g complement(775848..778094) some similarities with
           sp|P28006 Saccharomyces cerevisiae YOR178c GAC1 ser/thr
           phosphoprotein phosphatase 1, regulatory chain,
           hypothetical start
          Length = 748

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/88 (22%), Positives = 46/88 (52%), Gaps = 10/88 (11%)

Query: 405 SLHIHRERAFYSPGSGVDIGTPINTRL----LSGRVLVKNIFFDKRVLIRYTWDRWRNVQ 460
           SL I+++ + Y  G+ + +    + +L    L+G + V N+ F+K + I+++++ W+++ 
Sbjct: 441 SLDINQDLSKYLQGNNIKLHECNSLQLSQGKLTGLIYVNNLSFEKFIEIKFSFNGWKDIH 500

Query: 461 DVEGVWVSSAQGLVPGGAAMDVFHFVID 488
            V   +  +    V      D F F+I+
Sbjct: 501 YVTANFKRTITDTV------DEFQFLIN 522

>Sklu_2428.8 YOR066W, Contig c2428 12993-14513 reverse complement
          Length = 506

 Score = 30.8 bits (68), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 2/69 (2%)

Query: 358 YSGKQQQRVVGLYNENFPILSNKNPKSLKLNIFINLSQGKEVFLQELSLHIHRERAFYSP 417
           Y  + Q   V   +   P+L   +P++  L  + N S   E+F Q+L     R   F +P
Sbjct: 336 YVSQPQHHFVFKLSSGDPLLMTDDPQAELLTQYNNSSA--ELFYQQLLASPKRSLCFNTP 393

Query: 418 GSGVDIGTP 426
            S V++GTP
Sbjct: 394 PSLVNLGTP 402

>Scas_690.35
          Length = 1696

 Score = 30.4 bits (67), Expect = 5.2,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 26/47 (55%)

Query: 34   VGGSGKLTSLQFLHKPQRVSQLNKDRFPEEELLRNTQLNKNLHQVDS 80
            V G+GK+T +  L    ++  LNK+ F    LL++T L   +H + S
Sbjct: 1454 VQGAGKITGILLLDSLIQLGNLNKENFILTTLLKSTHLLSIVHSLKS 1500

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.133    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,972,708
Number of extensions: 723337
Number of successful extensions: 1736
Number of sequences better than 10.0: 26
Number of HSP's gapped: 1724
Number of HSP's successfully gapped: 39
Length of query: 535
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 429
Effective length of database: 12,926,601
Effective search space: 5545511829
Effective search space used: 5545511829
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 64 (29.3 bits)