Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0J02882g53052227830.0
YER052C (HOM3)52751823070.0
Scas_715.4452852122640.0
Sklu_2260.352352021100.0
KLLA0F27599g52252120520.0
Kwal_47.1816352252320390.0
ADL086C55250919440.0
Scas_34.1*2392408271e-108
YDL010W23150750.29
CAGL0H01441g42740760.34
AAL131C101494721.0
CAGL0D03894g48540692.0
YHR033W42340682.7
AAL061C42046682.8
ADL237C756151683.0
Sklu_2395.979573683.0
Scas_692.15472107683.1
YML112W (CTK3)29652673.6
Kwal_23.304990158683.7
Kwal_23.494373673674.2
Scas_669.950386656.6
Kwal_55.2197345542656.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J02882g
         (522 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J02882g complement(277395..278987) highly similar to sp|P10...  1076   0.0  
YER052C (HOM3) [1480] chr5 complement(256374..257957) Aspartate ...   893   0.0  
Scas_715.44                                                           876   0.0  
Sklu_2260.3 YER052C, Contig c2260 3320-4891 reverse complement        817   0.0  
KLLA0F27599g 2558178..2559746 highly similar to sp|P10869 Saccha...   795   0.0  
Kwal_47.18163                                                         790   0.0  
ADL086C [1655] [Homologous to ScYER052C (HOM3) - SH] (533181..53...   753   0.0  
Scas_34.1*                                                            323   e-108
YDL010W (YDL010W) [848] chr4 (432327..433022) Protein predicted ...    33   0.29 
CAGL0H01441g complement(140740..142023) highly similar to sp|P32...    34   0.34 
AAL131C [56] [Homologous to ScYGR170W (PSD2) - SH] (117329..1203...    32   1.0  
CAGL0D03894g 389509..390966 similar to sp|P32264 Saccharomyces c...    31   2.0  
YHR033W (YHR033W) [2320] chr8 (175540..176811) Protein with simi...    31   2.7  
AAL061C [126] [Homologous to ScYDR300C (PRO1) - SH; ScYHR033W - ...    31   2.8  
ADL237C [1504] [Homologous to ScYIL107C (PFK26) - SH] (287076..2...    31   3.0  
Sklu_2395.9 YIL107C, Contig c2395 14041-16428                          31   3.0  
Scas_692.15                                                            31   3.1  
YML112W (CTK3) [3859] chr13 (45063..45953) C-terminal domain (RN...    30   3.6  
Kwal_23.3049                                                           31   3.7  
Kwal_23.4943                                                           30   4.2  
Scas_669.9                                                             30   6.6  
Kwal_55.21973                                                          30   6.9  

>CAGL0J02882g complement(277395..278987) highly similar to sp|P10869
           Saccharomyces cerevisiae YER052c HOM3, hypothetical
           start
          Length = 530

 Score = 1076 bits (2783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/522 (100%), Positives = 522/522 (100%)

Query: 1   MAYSTSATSNWVVQKFGGTSVGKFPVQIVDEIVKYYSSSKQDGGFDNDVAVVCSARSSYT 60
           MAYSTSATSNWVVQKFGGTSVGKFPVQIVDEIVKYYSSSKQDGGFDNDVAVVCSARSSYT
Sbjct: 1   MAYSTSATSNWVVQKFGGTSVGKFPVQIVDEIVKYYSSSKQDGGFDNDVAVVCSARSSYT 60

Query: 61  KQEGTTSRLLKCCDLASQDQEYSDIIETIRQDHVSNAERFLEDSPLVAKLIDDTNKELAL 120
           KQEGTTSRLLKCCDLASQDQEYSDIIETIRQDHVSNAERFLEDSPLVAKLIDDTNKELAL
Sbjct: 61  KQEGTTSRLLKCCDLASQDQEYSDIIETIRQDHVSNAERFLEDSPLVAKLIDDTNKELAL 120

Query: 121 VDKYLSASKVLGEVSNRTIDLVMSCGEKLSCLFITALCNDRGCKAKYVDLSNVVPSDYQT 180
           VDKYLSASKVLGEVSNRTIDLVMSCGEKLSCLFITALCNDRGCKAKYVDLSNVVPSDYQT
Sbjct: 121 VDKYLSASKVLGEVSNRTIDLVMSCGEKLSCLFITALCNDRGCKAKYVDLSNVVPSDYQT 180

Query: 181 TTLDTSFYTFLVQALKEKLEPFVNSKERIVPVFTGFFGFIPMGLLNGVGRGYTDLCAALI 240
           TTLDTSFYTFLVQALKEKLEPFVNSKERIVPVFTGFFGFIPMGLLNGVGRGYTDLCAALI
Sbjct: 181 TTLDTSFYTFLVQALKEKLEPFVNSKERIVPVFTGFFGFIPMGLLNGVGRGYTDLCAALI 240

Query: 241 AVALNADELQVWKEVDGIFTADPRKVPQARLLDSVTPEEASELTYYGSEVIHPFTMEQVI 300
           AVALNADELQVWKEVDGIFTADPRKVPQARLLDSVTPEEASELTYYGSEVIHPFTMEQVI
Sbjct: 241 AVALNADELQVWKEVDGIFTADPRKVPQARLLDSVTPEEASELTYYGSEVIHPFTMEQVI 300

Query: 301 RAKIPIRIKNVQNPKGNGTIIYPDNVAKKGESTPPHPPEALSSTFFEKKRRGATAITTKN 360
           RAKIPIRIKNVQNPKGNGTIIYPDNVAKKGESTPPHPPEALSSTFFEKKRRGATAITTKN
Sbjct: 301 RAKIPIRIKNVQNPKGNGTIIYPDNVAKKGESTPPHPPEALSSTFFEKKRRGATAITTKN 360

Query: 361 DIVVLNVHSNKKTLSHGFLAQIFTVLDKYKLVVDLISTSEVHVSMALPIPDSDSMKALRS 420
           DIVVLNVHSNKKTLSHGFLAQIFTVLDKYKLVVDLISTSEVHVSMALPIPDSDSMKALRS
Sbjct: 361 DIVVLNVHSNKKTLSHGFLAQIFTVLDKYKLVVDLISTSEVHVSMALPIPDSDSMKALRS 420

Query: 421 AVEKLKPLGSVDIIKKMSIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINI 480
           AVEKLKPLGSVDIIKKMSIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINI
Sbjct: 421 AVEKLKPLGSVDIIKKMSIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINI 480

Query: 481 SCVIDEMDSIKALQSIHKKLLDELPENGSGSEQFEKAVDERL 522
           SCVIDEMDSIKALQSIHKKLLDELPENGSGSEQFEKAVDERL
Sbjct: 481 SCVIDEMDSIKALQSIHKKLLDELPENGSGSEQFEKAVDERL 522

>YER052C (HOM3) [1480] chr5 complement(256374..257957) Aspartate
           kinase (L-aspartate 4-P-transferase), catalyzes the
           first step in the common pathway for methionine and
           threonine biosynthesis [1584 bp, 527 aa]
          Length = 527

 Score =  893 bits (2307), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/518 (83%), Positives = 474/518 (91%), Gaps = 6/518 (1%)

Query: 5   TSATSNWVVQKFGGTSVGKFPVQIVDEIVKYYSSSKQDGGFDNDVAVVCSARSSYTKQEG 64
           TS+ SNWVVQKFGGTSVGKFPVQIVD+IVK+YS  K DG  +N+VAVVCSARSSYTK EG
Sbjct: 8   TSSHSNWVVQKFGGTSVGKFPVQIVDDIVKHYS--KPDGP-NNNVAVVCSARSSYTKAEG 64

Query: 65  TTSRLLKCCDLASQDQEYSDIIETIRQDHVSNAERFLEDSPLVAKLIDDTNKELALVDKY 124
           TTSRLLKCCDLASQ+ E+ DIIE IRQDH+ NA+RF+ +  L AKL+DDTNKEL LV KY
Sbjct: 65  TTSRLLKCCDLASQESEFQDIIEVIRQDHIDNADRFILNPALQAKLVDDTNKELELVKKY 124

Query: 125 LSASKVLGEVSNRTIDLVMSCGEKLSCLFITALCNDRGCKAKYVDLSNVVPSDYQTTTLD 184
           L+ASKVLGEVS+RT+DLVMSCGEKLSCLF+TALCNDRGCKAKYVDLS++VPSD+  + LD
Sbjct: 125 LNASKVLGEVSSRTVDLVMSCGEKLSCLFMTALCNDRGCKAKYVDLSHIVPSDFSASALD 184

Query: 185 TSFYTFLVQALKEKLEPFVNSKERIVPVFTGFFGFIPMGLLNGVGRGYTDLCAALIAVAL 244
            SFYTFLVQALKEKL PFV++KERIVPVFTGFFG +P GLLNGVGRGYTDLCAALIAVA+
Sbjct: 185 NSFYTFLVQALKEKLAPFVSAKERIVPVFTGFFGLVPTGLLNGVGRGYTDLCAALIAVAV 244

Query: 245 NADELQVWKEVDGIFTADPRKVPQARLLDSVTPEEASELTYYGSEVIHPFTMEQVIRAKI 304
           NADELQVWKEVDGIFTADPRKVP+ARLLDSVTPEEASELTYYGSEVIHPFTMEQVIRAKI
Sbjct: 245 NADELQVWKEVDGIFTADPRKVPEARLLDSVTPEEASELTYYGSEVIHPFTMEQVIRAKI 304

Query: 305 PIRIKNVQNPKGNGTIIYPDNVAKKGESTPPHPPEALSSTFFEKKRRGATAITTKNDIVV 364
           PIRIKNVQNP GNGTIIYPDNVAKKGESTPPHPPE LSS+F+EK++RGATAITTKNDI V
Sbjct: 305 PIRIKNVQNPLGNGTIIYPDNVAKKGESTPPHPPENLSSSFYEKRKRGATAITTKNDIFV 364

Query: 365 LNVHSNKKTLSHGFLAQIFTVLDKYKLVVDLISTSEVHVSMALPIPDSDSMKALRSAVEK 424
           +N+HSNKKTLSHGFLAQIFT+LDKYKLVVDLISTSEVHVSMALPIPD+DS+K+LR A EK
Sbjct: 365 INIHSNKKTLSHGFLAQIFTILDKYKLVVDLISTSEVHVSMALPIPDADSLKSLRQAEEK 424

Query: 425 LKPLGSVDIIKKMSIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINISCVI 484
           L+ LGSVDI KK+SIVSLVGK MKQ+IGIAGTMFTTLAE+GINIEMISQGANEINISCVI
Sbjct: 425 LRILGSVDITKKLSIVSLVGKHMKQYIGIAGTMFTTLAEEGINIEMISQGANEINISCVI 484

Query: 485 DEMDSIKALQSIHKKLLDELPENGSGSEQFEKAVDERL 522
           +E DSIKALQ IH KLL    E  + S QFE A+DERL
Sbjct: 485 NESDSIKALQCIHAKLLS---ERTNTSNQFEHAIDERL 519

>Scas_715.44
          Length = 528

 Score =  876 bits (2264), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/521 (80%), Positives = 467/521 (89%), Gaps = 7/521 (1%)

Query: 6   SATSNWVVQKFGGTSVGKFPVQIVDEIVKYYSSSKQDGGFDNDVAVVCSARSSYTKQEGT 65
           S  SNWVVQKFGGTSVGKFPVQIVD+I+K+YS    +  ++N+VAVVCSARSSYTK EGT
Sbjct: 3   SPPSNWVVQKFGGTSVGKFPVQIVDDIIKFYSDP-SNKTYNNNVAVVCSARSSYTKAEGT 61

Query: 66  TSRLLKCCDLASQDQEYSDIIETIRQDHVSNAERFLEDSPLVAKLIDDTNKELALVDKYL 125
           TSRLL+CCDLASQ+ E++DIIE I+ DH+ NAER+++D  L  KLI DT KEL LV KYL
Sbjct: 62  TSRLLRCCDLASQEMEFNDIIEVIKADHIDNAERYVQDPVLQTKLIADTTKELTLVKKYL 121

Query: 126 SASKVLGEVSNRTIDLVMSCGEKLSCLFITALCNDRGCKAKYVDLSNVVPSDYQTTTLDT 185
            ASK+LGEVS RTIDLVMS GEKLSCLF+TAL NDRGCKAKYVDL+++VPSDY  T LD 
Sbjct: 122 DASKILGEVSTRTIDLVMSVGEKLSCLFMTALLNDRGCKAKYVDLTHIVPSDYNATVLDN 181

Query: 186 SFYTFLVQALKEKLEPFVNSKERIVPVFTGFFGFIPMGLLNGVGRGYTDLCAALIAVALN 245
           SFYTFL QA KEKL+PF+ SKER++PVFTGFFG +PMGLLNGVGRGYTDLCAALIAVA+N
Sbjct: 182 SFYTFLFQAFKEKLQPFIESKERVIPVFTGFFGLVPMGLLNGVGRGYTDLCAALIAVAVN 241

Query: 246 ADELQVWKEVDGIFTADPRKVPQARLLDSVTPEEASELTYYGSEVIHPFTMEQVIRAKIP 305
           ADELQVWKEVDGIFTADPRKVPQARLL SVTPEEASELTYYGSEVIHPFTMEQVI+AKIP
Sbjct: 242 ADELQVWKEVDGIFTADPRKVPQARLLASVTPEEASELTYYGSEVIHPFTMEQVIQAKIP 301

Query: 306 IRIKNVQNPKGNGTIIYPDNVAKKGESTPPHPPEALSSTFFEKKRRGATAITTKNDIVVL 365
           IRIKNVQNP+G GTIIYPDN+AKKGESTPPHPPE LSS+FFE+++RGATAITTKNDIVV+
Sbjct: 302 IRIKNVQNPRGEGTIIYPDNIAKKGESTPPHPPETLSSSFFERRKRGATAITTKNDIVVI 361

Query: 366 NVHSNKKTLSHGFLAQIFTVLDKYKLVVDLISTSEVHVSMALPIPDSDSMKALRSAVEKL 425
           N+HSNKKTLSHGFLAQIFT+LDK+KLVVDLISTSEVHVSMALPIPDS+S K+LR AVEKL
Sbjct: 362 NIHSNKKTLSHGFLAQIFTILDKFKLVVDLISTSEVHVSMALPIPDSESHKSLRQAVEKL 421

Query: 426 KPLGSVDIIKKMSIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINISCVID 485
           + LG VD+ KKM+IVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINISCVID
Sbjct: 422 RVLGHVDVTKKMAIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINISCVID 481

Query: 486 EMDSIKALQSIHKKLLD----ELPENGSGSEQFEKAVDERL 522
           E DS+KALQSIH KLLD     L E  +G+  FE A++ERL
Sbjct: 482 ETDSLKALQSIHAKLLDAHEASLEEMTTGN--FEHAINERL 520

>Sklu_2260.3 YER052C, Contig c2260 3320-4891 reverse complement
          Length = 523

 Score =  817 bits (2110), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/520 (76%), Positives = 451/520 (86%), Gaps = 15/520 (2%)

Query: 9   SNWVVQKFGGTSVGKFPVQIVDEIVKYYSSSKQDGGFDNDVAVVCSARSSYTKQEGTTSR 68
           SNW+VQKFGGTSVGKFP QIV++IVK Y++      ++N+VAVVCSARSSYTK EGTTSR
Sbjct: 5   SNWIVQKFGGTSVGKFPEQIVEQIVKVYTTQ-----YENNVAVVCSARSSYTKAEGTTSR 59

Query: 69  LLKCCDLASQ-DQEYSDIIETIRQDHVSNAERFLEDSPLVAKLIDDTNKELALVDKYLSA 127
           LL  C+LA+  D  ++D+++ +R DHVSNA+  ++DS L  KL+ DTN EL LV+KYLSA
Sbjct: 60  LLNACELAANNDPTFTDVLQLVRNDHVSNAQEKIKDSTLQQKLVKDTNAELDLVEKYLSA 119

Query: 128 SKVLGEVSNRTIDLVMSCGEKLSCLFITALCNDRGCKAKYVDLSNVVPSDYQTT--TLDT 185
           S++LGEVS+RT+DLVMSCGEKLSCLF+ ALCND G  A+YVDLS VVP+DY+    +LD 
Sbjct: 120 SQILGEVSSRTMDLVMSCGEKLSCLFMAALCNDLGVPAQYVDLSFVVPTDYECKDGSLDN 179

Query: 186 SFYTFLVQALKEKLEPFVNSK---ERIVPVFTGFFGFIPMGLLNGVGRGYTDLCAALIAV 242
           +FYTFLV A KE L+P + S    + +VPV TGFFG +PMGLLNGVGRGYTDLCAALIAV
Sbjct: 180 NFYTFLVNAFKEALQPVLKSHSIGKPVVPVITGFFGLVPMGLLNGVGRGYTDLCAALIAV 239

Query: 243 ALNADELQVWKEVDGIFTADPRKVPQARLLDSVTPEEASELTYYGSEVIHPFTMEQVIRA 302
            LNADELQVWKEVDGIFTADPRKVPQARLL SVTPEEASELTYYGSEVIHPFTMEQVIRA
Sbjct: 240 GLNADELQVWKEVDGIFTADPRKVPQARLLSSVTPEEASELTYYGSEVIHPFTMEQVIRA 299

Query: 303 KIPIRIKNVQNPKGNGTIIYPDNVAKKGESTPPHPPEALSSTFFEKKRRGATAITTKNDI 362
           KIPIRIKNVQNP G GT+IYPDN+AKKGESTPPHPP  L+S+FFE KRRGATAITTKNDI
Sbjct: 300 KIPIRIKNVQNPTGEGTVIYPDNIAKKGESTPPHPPVTLTSSFFETKRRGATAITTKNDI 359

Query: 363 VVLNVHSNKKTLSHGFLAQIFTVLDKYKLVVDLISTSEVHVSMALPIPDSDSMKALRSAV 422
           VVLN+HSNKKTLSHGFLAQIF+VLDKYKLVVDLISTSEVHVSMALP+PD++S +AL+SAV
Sbjct: 360 VVLNIHSNKKTLSHGFLAQIFSVLDKYKLVVDLISTSEVHVSMALPVPDAESSRALKSAV 419

Query: 423 EKLKPLGSVDIIKKMSIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINISC 482
           E+L  LGS+D+ KKM+IVSLVGKQMKQFIGIAGTMFTTLAEQ INIEMISQGANEINISC
Sbjct: 420 EELNRLGSIDLTKKMAIVSLVGKQMKQFIGIAGTMFTTLAEQNINIEMISQGANEINISC 479

Query: 483 VIDEMDSIKALQSIHKKLLDELPENGSGSEQFEKAVDERL 522
           VIDE DSIKALQSIH KLLDE     SGS  FE AV+ERL
Sbjct: 480 VIDEQDSIKALQSIHAKLLDE----NSGSLDFEHAVNERL 515

>KLLA0F27599g 2558178..2559746 highly similar to sp|P10869
           Saccharomyces cerevisiae YER052c HOM3 L-aspartate
           4-P-transferase singleton, start by similarity
          Length = 522

 Score =  795 bits (2052), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/521 (74%), Positives = 446/521 (85%), Gaps = 16/521 (3%)

Query: 8   TSNWVVQKFGGTSVGKFPVQIVDEIVKYYSSSKQDGGFDNDVAVVCSARSSYTKQEGTTS 67
           TSNWVVQKFGGTS+GKF  QIV+EI+K YS       +DN+VAVVCSARSSYTK EGTTS
Sbjct: 4   TSNWVVQKFGGTSIGKFSKQIVNEIIKVYSQE-----YDNNVAVVCSARSSYTKAEGTTS 58

Query: 68  RLLKCCDLASQDQ-EYSDIIETIRQDHVSNAERFLEDSPLVAKLIDDTNKELALVDKYLS 126
           RLL  CDLAS +  EY ++++ + +DHV+NAE  ++D  +   LI+DT +E+ +V +YL 
Sbjct: 59  RLLLACDLASNNNYEYKNVLDLVERDHVANAEESVKDITIQETLIEDTKREINIVRRYLD 118

Query: 127 ASKVLGEVSNRTIDLVMSCGEKLSCLFITALCNDRGCKAKYVDLSNVVPSDYQTT--TLD 184
           AS+VLGEVS RT+DLVMS GEKLSCL++TALC D G  A+YVDLS +VPSDY+    TLD
Sbjct: 119 ASQVLGEVSTRTLDLVMSLGEKLSCLYVTALCQDNGVNARYVDLSFIVPSDYECKEGTLD 178

Query: 185 TSFYTFLVQALKEKLEPFVNSKE---RIVPVFTGFFGFIPMGLLNGVGRGYTDLCAALIA 241
            SFYTFLV A +EKL P +   E   +I+PV TGFFG +PMGLLNGVGRGYTDLCAALIA
Sbjct: 179 NSFYTFLVTAFREKLSPILKETENGTKIIPVITGFFGVVPMGLLNGVGRGYTDLCAALIA 238

Query: 242 VALNADELQVWKEVDGIFTADPRKVPQARLLDSVTPEEASELTYYGSEVIHPFTMEQVIR 301
           VALNADELQVWKEVDGIFTADPRKVPQARLLD+VTP+EA+ELTYYGSEVIHPFTMEQVIR
Sbjct: 239 VALNADELQVWKEVDGIFTADPRKVPQARLLDTVTPDEAAELTYYGSEVIHPFTMEQVIR 298

Query: 302 AKIPIRIKNVQNPKGNGTIIYPDNVAKKGESTPPHPPEALSSTFFEKKRRGATAITTKND 361
             IPIRIKNVQNPKGNGTIIYP + AKKGESTPPHPP AL+S+ FE K++GATAITTK+D
Sbjct: 299 THIPIRIKNVQNPKGNGTIIYPSDQAKKGESTPPHPPVALTSSIFESKKKGATAITTKSD 358

Query: 362 IVVLNVHSNKKTLSHGFLAQIFTVLDKYKLVVDLISTSEVHVSMALPIPDSDSMKALRSA 421
           IVV+N+HSNKKTLSHGFLA++F+ LDKYKLVVDLISTSEVHVSMALP+PDSDS+KALR A
Sbjct: 359 IVVVNIHSNKKTLSHGFLAEMFSTLDKYKLVVDLISTSEVHVSMALPVPDSDSLKALRCA 418

Query: 422 VEKLKPLGSVDIIKKMSIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINIS 481
           VE+LK LG+VD+IKKM+IVSLVGKQMKQF+GIAGTMFTTLAEQ INIEMISQGANEINIS
Sbjct: 419 VEELKRLGTVDVIKKMAIVSLVGKQMKQFVGIAGTMFTTLAEQHINIEMISQGANEINIS 478

Query: 482 CVIDEMDSIKALQSIHKKLLDELPENGSGSEQFEKAVDERL 522
           CVIDE ++++ALQSIH KLLD  P+N    E FE AV+ERL
Sbjct: 479 CVIDESNAVRALQSIHAKLLDS-PQN----ENFESAVNERL 514

>Kwal_47.18163
          Length = 522

 Score =  790 bits (2039), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/523 (74%), Positives = 449/523 (85%), Gaps = 16/523 (3%)

Query: 6   SATSNWVVQKFGGTSVGKFPVQIVDEIVKYYSSSKQDGGFDNDVAVVCSARSSYTKQEGT 65
           S+ +NW+VQKFGGTSVGKFP QIV+EIVK Y++      + N+VAVVCSARSS TK EGT
Sbjct: 2   SSQTNWIVQKFGGTSVGKFPEQIVNEIVKVYTTK-----YKNNVAVVCSARSSDTKAEGT 56

Query: 66  TSRLLKCCDL-ASQDQEYSDIIETIRQDHVSNAERFLEDSPLVAKLIDDTNKELALVDKY 124
           TSRLL+ CDL  + D  ++D+++ +R DH+SNA++ +    L  KLI DTN EL LV+KY
Sbjct: 57  TSRLLRACDLVCNSDPAFADVLQKVRDDHISNAKQRITSPDLQQKLIHDTNAELDLVEKY 116

Query: 125 LSASKVLGEVSNRTIDLVMSCGEKLSCLFITALCNDRGCKAKYVDLSNVVPSDYQTT--T 182
           L+AS+VLGEVS RT+DLVMSCGEKLSCLF+ ALCN+ G +A+YVDLS+V+P DY+    T
Sbjct: 117 LNASQVLGEVSLRTMDLVMSCGEKLSCLFMAALCNEYGVRAQYVDLSSVIPHDYECRQGT 176

Query: 183 LDTSFYTFLVQALKEKLEPFVNSKER---IVPVFTGFFGFIPMGLLNGVGRGYTDLCAAL 239
           LDTSFYTFLV+A KEKL P + +  +   +VPV TGFFG +PMGLLNGVGRGYTDLCAAL
Sbjct: 177 LDTSFYTFLVRAFKEKLAPVLEAHSQGTPVVPVITGFFGLVPMGLLNGVGRGYTDLCAAL 236

Query: 240 IAVALNADELQVWKEVDGIFTADPRKVPQARLLDSVTPEEASELTYYGSEVIHPFTMEQV 299
           IAV LNADELQVWKEVDGIFTADPRKVPQARLL SVTPEEASELTYYGSEVIHPFTMEQV
Sbjct: 237 IAVGLNADELQVWKEVDGIFTADPRKVPQARLLGSVTPEEASELTYYGSEVIHPFTMEQV 296

Query: 300 IRAKIPIRIKNVQNPKGNGTIIYPDNVAKKGESTPPHPPEALSSTFFEKKRRGATAITTK 359
           IRAKIPIRIKNVQNP G+GT+IYPDN+AKKGESTPPHPP  LS++FFE+K+RGATAIT+K
Sbjct: 297 IRAKIPIRIKNVQNPTGDGTVIYPDNIAKKGESTPPHPPVTLSNSFFEQKKRGATAITSK 356

Query: 360 NDIVVLNVHSNKKTLSHGFLAQIFTVLDKYKLVVDLISTSEVHVSMALPIPDSDSMKALR 419
           +DIVV+++HSNKKTLSHGFLAQIFT LDKYKLVVDLISTSEVHVSMALP+PD DS KAL+
Sbjct: 357 SDIVVVSIHSNKKTLSHGFLAQIFTTLDKYKLVVDLISTSEVHVSMALPVPDVDSSKALK 416

Query: 420 SAVEKLKPLGSVDIIKKMSIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEIN 479
            AVE+LK LG+V++ KK+ IVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEIN
Sbjct: 417 KAVEELKVLGAVELTKKLVIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEIN 476

Query: 480 ISCVIDEMDSIKALQSIHKKLLDELPENGSGSEQFEKAVDERL 522
           ISCVIDE D++KALQSIH KLLD   + G G     KAV+E+L
Sbjct: 477 ISCVIDEEDALKALQSIHSKLLDLDSDVGLG-----KAVNEKL 514

>ADL086C [1655] [Homologous to ScYER052C (HOM3) - SH]
           (533181..534839) [1659 bp, 552 aa]
          Length = 552

 Score =  753 bits (1944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/509 (72%), Positives = 434/509 (85%), Gaps = 11/509 (2%)

Query: 9   SNWVVQKFGGTSVGKFPVQIVDEIVKYYSSSKQDGGFDNDVAVVCSARSSYTKQEGTTSR 68
           +NWVVQKFGGTS+GKFP  IV++IVK +S       +  +VAVVCSARSSYTK EGTTSR
Sbjct: 34  TNWVVQKFGGTSIGKFPTNIVNDIVKVFSHD-----YGKNVAVVCSARSSYTKSEGTTSR 88

Query: 69  LLKCCDLA-SQDQEYSDIIETIRQDHVSNAERFLEDSPLVAKLIDDTNKELALVDKYLSA 127
           LL  CD A S D+ + DI+  IR+DHV NA   ++D+ +  +L++ TN EL  V++YL A
Sbjct: 89  LLMACDAAASYDETFQDIVRVIREDHVENASHHIKDAEIRVRLVEQTNDELDQVERYLQA 148

Query: 128 SKVLGEVSNRTIDLVMSCGEKLSCLFITALCNDRGCKAKYVDLSNVVPSDYQTT--TLDT 185
           S++LGEVSNRT+DLVMS GEKLSCLF+TALC D G  A+YVD S++VP+D++    +LD 
Sbjct: 149 SQILGEVSNRTMDLVMSVGEKLSCLFLTALCEDCGVTAEYVDFSSIVPTDFRCAEGSLDN 208

Query: 186 SFYTFLVQALKEKLEPFVNSKE---RIVPVFTGFFGFIPMGLLNGVGRGYTDLCAALIAV 242
           SFY  LV A KE+L   V + +   RIVPV TGFFG +PMGLLNGVGRGYTDLCAAL+AV
Sbjct: 209 SFYALLVVAFKERLAQIVQANKEGKRIVPVITGFFGLLPMGLLNGVGRGYTDLCAALVAV 268

Query: 243 ALNADELQVWKEVDGIFTADPRKVPQARLLDSVTPEEASELTYYGSEVIHPFTMEQVIRA 302
           ALNADELQVWKEVDGIFTADPRKVPQARLL++VTPEEA+ELTYYGSEVIHPFTMEQVIRA
Sbjct: 269 ALNADELQVWKEVDGIFTADPRKVPQARLLETVTPEEAAELTYYGSEVIHPFTMEQVIRA 328

Query: 303 KIPIRIKNVQNPKGNGTIIYPDNVAKKGESTPPHPPEALSSTFFEKKRRGATAITTKNDI 362
           KIPIRIKNVQNP G+GT+IY DN+AKKGESTPPHPP ++SS+FFE+++RGATAITTKNDI
Sbjct: 329 KIPIRIKNVQNPTGDGTVIYADNIAKKGESTPPHPPISVSSSFFEQRKRGATAITTKNDI 388

Query: 363 VVLNVHSNKKTLSHGFLAQIFTVLDKYKLVVDLISTSEVHVSMALPIPDSDSMKALRSAV 422
           VVLN+HSNKKTLSHGFLAQIFT+LD YKL+VDLISTSEVHVSMALP+PDSDS ++LR+AV
Sbjct: 389 VVLNIHSNKKTLSHGFLAQIFTILDNYKLIVDLISTSEVHVSMALPVPDSDSQRSLRNAV 448

Query: 423 EKLKPLGSVDIIKKMSIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINISC 482
           E+LK LG+VD+IKKM+IVSLVGKQMK FIGIAG MFTTL+EQ INIEMISQGANEINISC
Sbjct: 449 EELKKLGTVDLIKKMAIVSLVGKQMKHFIGIAGAMFTTLSEQNINIEMISQGANEINISC 508

Query: 483 VIDEMDSIKALQSIHKKLLDELPENGSGS 511
           VIDE +S++ALQSIH KLL+ L    SG+
Sbjct: 509 VIDEKNSVRALQSIHAKLLEPLAPTSSGA 537

>Scas_34.1*
          Length = 239

 Score =  323 bits (827), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 161/240 (67%), Positives = 191/240 (79%), Gaps = 7/240 (2%)

Query: 66  TSRLLKCCDLASQ-DQEYSDIIETIRQDHVSNAERFLEDSPLVAKLIDDTNKELALVDKY 124
           TSRLL  C+LA+  D  ++D+++ +R DHVSNA+  ++DS L  KL+ DTN EL LV+KY
Sbjct: 1   TSRLLNACELAANNDPTFTDVLQLVRNDHVSNAQEKIKDSTLQQKLVKDTNAELDLVEKY 60

Query: 125 LSASKVLGEVSNRTIDLVMSCGEKLSCLFITALCNDRGCKAKYVDLSNVVPSDYQTT--T 182
           LSAS++LGEVS+RT+DLVMSCGEKLSCLF+ ALCND G  A+YVDLS VVP+DY+    +
Sbjct: 61  LSASQILGEVSSRTMDLVMSCGEKLSCLFMAALCNDLGVPAQYVDLSFVVPTDYECKDGS 120

Query: 183 LDTSFYTFLVQALKEKLEPFVNSK---ERIVPVFTGFFGFIPMGLLNGVGRGYTDLCAAL 239
           LD +FYTFLV A KE L+P + S    + +VPV TGFFG +PMGLLNGVGRGYTDLCAAL
Sbjct: 121 LDNNFYTFLVNAFKEALQPVLKSHSIGKPVVPVITGFFGLVPMGLLNGVGRGYTDLCAAL 180

Query: 240 IAVALNADELQVWKEVDGIFTADPRKVPQARLLDSVTPEEASELTYYGSEVIHPFTMEQV 299
           IAV LNADELQVWKEVDGIFTADPR+  +   L SVTPE A  LTYYGS VIHPFTMEQV
Sbjct: 181 IAVGLNADELQVWKEVDGIFTADPRRFLKQDCLSSVTPERAL-LTYYGSGVIHPFTMEQV 239

>YDL010W (YDL010W) [848] chr4 (432327..433022) Protein predicted to
           have structural similarity to disulfide oxidoreductases
           [696 bp, 231 aa]
          Length = 231

 Score = 33.5 bits (75), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 218 GFIPMGLLNGVGRGYTDLCAALIAVALNADELQVWKEVDGIFTADPRKVP 267
           G +P  L+NGV RG  +    L       + LQVW   DG F+ + R+ P
Sbjct: 181 GTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWS--DGKFSVEQREKP 228

>CAGL0H01441g complement(140740..142023) highly similar to sp|P32264
           Saccharomyces cerevisiae YDR300c PRO1 glutamate
           5-kinase, hypothetical start
          Length = 427

 Score = 33.9 bits (76), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 25/40 (62%)

Query: 231 GYTDLCAALIAVALNADELQVWKEVDGIFTADPRKVPQAR 270
           G  D  +A+ A  ++AD L +  +VD ++TADPR  P A+
Sbjct: 154 GDNDTLSAITAGLIHADYLFLLTDVDCLYTADPRSDPDAK 193

>AAL131C [56] [Homologous to ScYGR170W (PSD2) - SH] (117329..120373)
           [3045 bp, 1014 aa]
          Length = 1014

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 41/94 (43%), Gaps = 18/94 (19%)

Query: 147 EKLSCLFITALCNDRGCKAKYVDLSNVVPSDYQT------------TTLDTSFYTFLVQA 194
           EKL+      LCN+R C    V +  + P DY                +   +YT    A
Sbjct: 792 EKLTGGQFPELCNERSCS---VGIFRLAPQDYHRFHSPCNGVIGKPHYISGEYYTVNPMA 848

Query: 195 LKEKLEPFVNSKERIVPVFTGFFG---FIPMGLL 225
           ++ +L+ F  +   +VP+ +  +G   +IP+G +
Sbjct: 849 VRTELDVFAENVRVVVPIISEEYGTLLYIPIGAM 882

>CAGL0D03894g 389509..390966 similar to sp|P32264 Saccharomyces
           cerevisiae YDR300c PRO1 or sp|P38690 Saccharomyces
           cerevisiae YHR033w, hypothetical start
          Length = 485

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%)

Query: 231 GYTDLCAALIAVALNADELQVWKEVDGIFTADPRKVPQAR 270
           G  D  +A+ A  ++AD L +  +VD ++T +PR  P A+
Sbjct: 146 GDNDTLSAITAALVSADHLFLLTDVDCLYTENPRTNPDAK 185

>YHR033W (YHR033W) [2320] chr8 (175540..176811) Protein with
           similarity to Pro1p [1272 bp, 423 aa]
          Length = 423

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%)

Query: 231 GYTDLCAALIAVALNADELQVWKEVDGIFTADPRKVPQAR 270
           G  D  +A+ A  + AD L +  +VD ++T +PR  P AR
Sbjct: 148 GDNDTLSAITAALVGADFLFLLTDVDCLYTDNPRTNPDAR 187

>AAL061C [126] [Homologous to ScYDR300C (PRO1) - SH; ScYHR033W - SH]
           (239518..240780) [1263 bp, 420 aa]
          Length = 420

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%)

Query: 225 LNGVGRGYTDLCAALIAVALNADELQVWKEVDGIFTADPRKVPQAR 270
           ++GV  G  D  +A+ A  + AD L +  +VD ++T +PR  P A+
Sbjct: 145 ISGVKFGDNDTLSAITAGLIGADYLFLMTDVDCLYTDNPRTNPDAK 190

>ADL237C [1504] [Homologous to ScYIL107C (PFK26) - SH]
           (287076..289346) [2271 bp, 756 aa]
          Length = 756

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 63/151 (41%), Gaps = 23/151 (15%)

Query: 71  KCCDLASQDQEYSDIIETIRQDHVSNAERFLEDS-----PLVAKLIDDTNKEL--ALVD- 122
           K  ++ +  +EY    E + QD      RF + S      L  K   DT  EL   L+D 
Sbjct: 194 KVFNVGNTRREYGKQHELMEQD-----SRFFDPSNDEAKALREKWAMDTLNELLDYLLDG 248

Query: 123 ----KYLSASKVLGEVSNRTIDLVMSCGEKLSCLFITALCNDRGCKAKYVDLSNVVPSDY 178
                   A+    E   +  D + S   +L+ LF+ ++C+DR    K + L  + P DY
Sbjct: 249 PGSVAIFDATNSTQERRRKIYDKIKSRNSQLNVLFLESICSDRQTVEKNIRLKLLGP-DY 307

Query: 179 QTTTLDTSFYTFLVQALKEKLEPFVNSKERI 209
           +    + S   F     K++L  +V + E +
Sbjct: 308 KGKDPELSLRDF-----KDRLANYVRAYEAV 333

>Sklu_2395.9 YIL107C, Contig c2395 14041-16428
          Length = 795

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 35/73 (47%), Gaps = 6/73 (8%)

Query: 137 RTIDLVMSCGEKLSCLFITALCNDRGCKAKYVDLSNVVPSDYQTTTLDTSFYTFLVQALK 196
           R +D + S   ++  LF+ ++C+DR    K + L    P DY+      S     +Q  K
Sbjct: 292 RVLDKIHSRNSQIKILFLESICSDRATVEKNIQLKLFGP-DYKGKDPSVS-----LQDFK 345

Query: 197 EKLEPFVNSKERI 209
           E+L  ++ + E I
Sbjct: 346 ERLANYLTAYEPI 358

>Scas_692.15
          Length = 472

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 51/107 (47%), Gaps = 5/107 (4%)

Query: 372 KTLSHGFLAQIFTVLDKYKLVVDLISTSEVHVSMALPIPDSDSMKALRSAVEKLKPLGSV 431
           K L +G L+Q+FT +D+Y++  D    S+   ++ L   + D +K + ++ +K K     
Sbjct: 183 KHLQNGTLSQVFTEMDQYEM--DHSKKSKGTKNLHLKYMNPDYLKLVDTSFKKRK---HS 237

Query: 432 DIIKKMSIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEI 478
           +  K    + +  K   Q IG   +    +  QGI  +++ +  N +
Sbjct: 238 NYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWL 284

>YML112W (CTK3) [3859] chr13 (45063..45953) C-terminal domain (RNA
           polymerase II CTD) kinase gamma subunit, associates with
           Ctk1p and Ctk2p [891 bp, 296 aa]
          Length = 296

 Score = 30.4 bits (67), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 126 SASKVLGEVSNRTIDLVMSCGEKLSCLFITALCNDRGCKAKYVDLSNVVPSD 177
           + +KVL EV    IDLV      L C    +L N   CK  ++DLS ++  D
Sbjct: 101 NVTKVLNEVLLMDIDLVFELC--LPCQDWKSLTNQATCKELFLDLSKLIHYD 150

>Kwal_23.3049
          Length = 901

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 33/58 (56%), Gaps = 4/58 (6%)

Query: 166 KYVDLSNVVPSDYQTTTLDTSFYTFLVQALKEKLEPFVNSKERIVPVFTGFFGFIPMG 223
           +++D+ NV P D +T  L +  Y  +V AL+  L  + + +E ++PV  G  G +P G
Sbjct: 316 EFIDI-NVTP-DKRTVLLHSEEY--VVDALRNALTDYYSDQEMVLPVSGGTTGNVPAG 369

>Kwal_23.4943
          Length = 736

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 37/73 (50%), Gaps = 6/73 (8%)

Query: 137 RTIDLVMSCGEKLSCLFITALCNDRGCKAKYVDLSNVVPSDYQTTTLDTSFYTFLVQALK 196
           + +D + S   ++  LF+ ++C+D+    K + L    P DY+    +TS     +Q  K
Sbjct: 260 KVLDKIYSRNNQIKVLFLESVCSDKATVEKNIKLKLFGP-DYKGKDPETS-----LQDFK 313

Query: 197 EKLEPFVNSKERI 209
           E+L  ++ + E +
Sbjct: 314 ERLSNYMKAYEPV 326

>Scas_669.9
          Length = 503

 Score = 29.6 bits (65), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 41/86 (47%), Gaps = 11/86 (12%)

Query: 9   SNWVVQKFGGTSVGKFPVQIVDEIVKYYSSSKQDGGFDNDVAVVCSARSSYTKQ------ 62
           SN  V+   G  +  F     +++  +Y+ S+ D     +VAV  +AR+SYTK       
Sbjct: 23  SNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETD----VNVAVR-AARTSYTKTWSKTSP 77

Query: 63  EGTTSRLLKCCDLASQDQEYSDIIET 88
           E  T  LLK   L  +D+E    IET
Sbjct: 78  EQRTDLLLKLASLVERDKEILASIET 103

>Kwal_55.21973
          Length = 455

 Score = 29.6 bits (65), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 20/42 (47%), Gaps = 1/42 (2%)

Query: 329 KGESTPPHPPEALSSTFFEKKRRGATAITTKNDIVVLNVHSN 370
           K +   PHPP      + EKK+R    +T K D+   + H N
Sbjct: 6   KRQHLDPHPPRLQCEFYLEKKKRRC-GMTRKQDVAYCSEHFN 46

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,806,533
Number of extensions: 728401
Number of successful extensions: 2466
Number of sequences better than 10.0: 29
Number of HSP's gapped: 2509
Number of HSP's successfully gapped: 29
Length of query: 522
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 416
Effective length of database: 12,926,601
Effective search space: 5377466016
Effective search space used: 5377466016
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)