Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0J02860g40339720430.0
Sklu_2260.14773759791e-129
YER051W4923909481e-125
Kwal_47.181554653969411e-124
KLLA0F27643g4783908771e-114
ADL088W4863888131e-104
Sklu_1281.1282106710.84
Sklu_2377.746269672.5
KLLA0A07293g58392655.5
Scas_698.1159269638.0
CAGL0H03047g74165639.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J02860g
         (397 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J02860g 276002..277213 similar to sp|P40034 Saccharomyces c...   791   0.0  
Sklu_2260.1 YER051W, Contig c2260 321-1754                            381   e-129
YER051W (YER051W) [1479] chr5 (254655..256133) Protein containin...   369   e-125
Kwal_47.18155                                                         367   e-124
KLLA0F27643g complement(2561213..2562649) similar to sp|P40034 S...   342   e-114
ADL088W [1653] [Homologous to ScYER051W - SH] complement(530548....   317   e-104
Sklu_1281.1 YGL105W, Contig c1281 243-1086                             32   0.84 
Sklu_2377.7 YPL120W, Contig c2377 17957-19345 reverse complement       30   2.5  
KLLA0A07293g 652702..654453 weakly similar to sgd|S0005477 Sacch...    30   5.5  
Scas_698.11                                                            29   8.0  
CAGL0H03047g 285868..288093 weakly similar to sp|P53148 Saccharo...    29   9.1  

>CAGL0J02860g 276002..277213 similar to sp|P40034 Saccharomyces
           cerevisiae YER051w, hypothetical start
          Length = 403

 Score =  791 bits (2043), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/397 (96%), Positives = 382/397 (96%)

Query: 1   MAVKIEQALGEKRSLNDNDEVPRKKRYNFRKKVELDYSALNEGEDKKSKFFHPHIALFEK 60
           MAVKIEQALGEKRSLNDNDEVPRKKRYNFRKKVELDYSALNEGEDKKSKFFHPHIALFEK
Sbjct: 1   MAVKIEQALGEKRSLNDNDEVPRKKRYNFRKKVELDYSALNEGEDKKSKFFHPHIALFEK 60

Query: 61  EFEKCLSNVTEDMSMTCSEYCKRFDDIDFPLKISDPENSGMVVSTNNKTTRDLTVDDITQ 120
           EFEKCLSNVTEDMSMTCSEYCKRFDDIDFPLKISDPENSGMVVSTNNKTTRDLTVDDITQ
Sbjct: 61  EFEKCLSNVTEDMSMTCSEYCKRFDDIDFPLKISDPENSGMVVSTNNKTTRDLTVDDITQ 120

Query: 121 AVGDDYFVNVMDVQSQENERWSLREWCNYFNKPAEEKDRIRNVISLEVSHVEDLQYXXXX 180
           AVGDDYFVNVMDVQSQENERWSLREWCNYFNKPAEEKDRIRNVISLEVSHVEDLQY    
Sbjct: 121 AVGDDYFVNVMDVQSQENERWSLREWCNYFNKPAEEKDRIRNVISLEVSHVEDLQYDRPD 180

Query: 181 XXXXXXXXXXXWNNVENLDTENDPRPKVTKYCLMSVKNAFTDYHLDFAGTSVYYNLAFGK 240
                      WNNVENLDTENDPRPKVTKYCLMSVKNAFTDYHLDFAGTSVYYNLAFGK
Sbjct: 181 IVDDKDLVDIVWNNVENLDTENDPRPKVTKYCLMSVKNAFTDYHLDFAGTSVYYNLAFGK 240

Query: 241 KKFILYPPTPENIENYIEWSTSTYQNMLFLGEKLTGGVAMELNGGDLFMIPSGYIHVVYT 300
           KKFILYPPTPENIENYIEWSTSTYQNMLFLGEKLTGGVAMELNGGDLFMIPSGYIHVVYT
Sbjct: 241 KKFILYPPTPENIENYIEWSTSTYQNMLFLGEKLTGGVAMELNGGDLFMIPSGYIHVVYT 300

Query: 301 PEDSLIFGGNYLTFRDISQQLKIVDVEKQTGVTKRYTFPMFDEVMGRTCEWLCQNQKKGK 360
           PEDSLIFGGNYLTFRDISQQLKIVDVEKQTGVTKRYTFPMFDEVMGRTCEWLCQNQKKGK
Sbjct: 301 PEDSLIFGGNYLTFRDISQQLKIVDVEKQTGVTKRYTFPMFDEVMGRTCEWLCQNQKKGK 360

Query: 361 QMQVKKETVNDLISYMKSGKTKYKPTNFINKKQMLQE 397
           QMQVKKETVNDLISYMKSGKTKYKPTNFINKKQMLQE
Sbjct: 361 QMQVKKETVNDLISYMKSGKTKYKPTNFINKKQMLQE 397

>Sklu_2260.1 YER051W, Contig c2260 321-1754
          Length = 477

 Score =  381 bits (979), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 199/375 (53%), Positives = 256/375 (68%), Gaps = 22/375 (5%)

Query: 35  LDYSALNEGEDKKSKFFHPHIALFEKEFEKCLSNVTEDMSMTCSEYCKRFDDIDFPLKIS 94
           +DY ALNEGED++ K  HPHI  F K F+K  SN T  +S    E    FD I  PLK+ 
Sbjct: 101 IDYIALNEGEDRRLKDEHPHIPAFLKCFDK-WSNTTNIISSESLE--ATFDSITVPLKVK 157

Query: 95  DPENSGMVVSTNNKTTRD--------LTVDDITQAVGDDYFVNVMDVQSQENERWSLREW 146
           DPENSGM + T  +  R+        +TV+DI + +GDDY ++VMDVQ+Q+N  W++ +W
Sbjct: 158 DPENSGMKIPTVQELGRENMENESSKITVNDIARVLGDDYPLDVMDVQTQQNSDWTISQW 217

Query: 147 CNYFNK-PAEEKDRIRNVISLEVSHVEDLQ--YXXXXXXXXXXXXXXXWNNVENLDTEND 203
            +YF+K P E++DRIRNVISLEVSHV+  +                  W +V  +D ++D
Sbjct: 218 NDYFSKTPTEQRDRIRNVISLEVSHVQQFRDGIRRPTAVEVNDLADLVWEDV--VDKKSD 275

Query: 204 -PRPKVTKYCLMSVKNAFTDYHLDFAGTSVYYNLAFGKKKFILYPPTPENIENYIEWSTS 262
            PRPKVTKY LMSV NA+TD+HLDFAGTSVYYN+  GKKKFIL+PPT  N+  Y  W  S
Sbjct: 276 VPRPKVTKYILMSVGNAYTDFHLDFAGTSVYYNVISGKKKFILFPPTIHNLGQYKRWCDS 335

Query: 263 TYQNMLFLGEKLTGGVAMELNGGDLFMIPSGYIHVVYTPEDSLIFGGNYLTFRDISQQLK 322
            +QN++FLG+ L  GVAMELN GDLFMIP GYIH VYTP DSL+ GGN+LT RDI+ QLK
Sbjct: 336 DHQNLVFLGDMLEDGVAMELNSGDLFMIPCGYIHAVYTPIDSLVVGGNFLTLRDITTQLK 395

Query: 323 IVDVEKQTGVTKRYTFPMFDEVMGRTCEWLCQNQKKGKQMQVKKETVNDLISYMKSGKTK 382
           IV++E+ T V KR+TFP FD VMG+TCEW+ +++K      +  E +  LIS+M   K K
Sbjct: 396 IVEIERLTKVPKRFTFPHFDIVMGKTCEWVLKHRKA-----IPDEHIKTLISHMSDPKVK 450

Query: 383 YKPTNFINKKQMLQE 397
           YKP N+ NKK++LQE
Sbjct: 451 YKPVNYRNKKELLQE 465

>YER051W (YER051W) [1479] chr5 (254655..256133) Protein containing a
           PHD-finger, which may be involved in chromatin-mediated
           transcriptional regulation, and a Jumonji (jmjC) domain,
           has low similarity to uncharacterized C. albicans
           Orf6.8281p [1479 bp, 492 aa]
          Length = 492

 Score =  369 bits (948), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 196/390 (50%), Positives = 255/390 (65%), Gaps = 23/390 (5%)

Query: 25  KRYNFRKKVELDYSALNEGEDKKSKFFHPHIALFEKEFEKCL--SNVTEDMSMTCSEYCK 82
           KRYNFRKK  LDY ALNEGE K+ K  HPH   F K FEK    SN+     +  +++ +
Sbjct: 101 KRYNFRKKKLLDYIALNEGESKRDKMNHPHKESFMKSFEKWKNGSNI-----INAADFAE 155

Query: 83  RFDDIDFPLKISDPENSGMVVSTNNKTTRDLTVDDITQAVGDDYFVNVMDVQSQENERWS 142
           +FD+ID P KI DP NSG+ V         LTV+ IT+ +G+DY V+VMDVQSQ NE W+
Sbjct: 156 KFDNIDVPYKIIDPLNSGVYVPNVGTDNGCLTVNYITEMIGEDYHVDVMDVQSQMNENWN 215

Query: 143 LREWCNYF-NKPAEEKDRIRNVISLEVSHVEDLQYXXXXXXXXXXXXXXXWNNVENLDT- 200
           L  W  YF N   + +DRIRNVISLEVS++E L+                W+   +L+  
Sbjct: 216 LGSWNEYFTNTEPDRRDRIRNVISLEVSNIEGLELERPTAVRQNDLVDKIWSFNGHLEKV 275

Query: 201 ------ENDPRPKVTKYCLMSVKNAFTDYHLDFAGTSVYYNLAFGKKKFILYPPTPENIE 254
                 ENDP+PKVTKY LMSVK+A+TD+HLDFAGTSVYYN+  G+KKF+L+PPT  NI+
Sbjct: 276 NGEKAEENDPKPKVTKYILMSVKDAYTDFHLDFAGTSVYYNVISGQKKFLLFPPTQSNID 335

Query: 255 NYIEWSTSTYQNMLFLGEKLTGGVAMELNGGDLFMIPSGYIHVVYTPEDSLIFGGNYLTF 314
            YIEWS    QN +FLG+ L  G+AMEL+ GDLFMIP+GYIH VYTP DSL+FGGN+LT 
Sbjct: 336 KYIEWSLKEDQNSVFLGDILEDGIAMELDAGDLFMIPAGYIHAVYTPVDSLVFGGNFLTI 395

Query: 315 RDISQQLKIVDVEKQTGVTKRYTFPMFDEVMGRTCEWLCQNQKK-------GKQM-QVKK 366
           RD+   LKIV++EK T V +R+TFP FD+VMG+ CE+L  ++ K       G  + +   
Sbjct: 396 RDLETHLKIVEIEKLTKVPRRFTFPKFDQVMGKLCEYLALDKNKITSDVSDGDLLSRTTN 455

Query: 367 ETVNDLISYMKSGKTKYKPTNFINKKQMLQ 396
             +  L +Y+   + KYKP NF +KK + +
Sbjct: 456 CAIQSLHAYVIKPEVKYKPLNFTSKKHLAK 485

>Kwal_47.18155
          Length = 465

 Score =  367 bits (941), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 191/396 (48%), Positives = 256/396 (64%), Gaps = 8/396 (2%)

Query: 2   AVKIEQALGEKRSLNDNDEVPRKKRYNFRKKVELDYSALNEGEDKKSKFFHPHIALFEKE 61
           A++I   L +KR LN        KR   RKK ++DY +LNEG D++ K  HPH+  F   
Sbjct: 69  ALEINMGL-KKRKLNSTMADLSAKRQGLRKKKQVDYISLNEGADRRLKNEHPHMHAFLAC 127

Query: 62  FEKCLSNVTEDMSMTCSEYCKRFDDIDFPLKISDPENSGMVVSTNNKTTRDLTVDDITQA 121
           F +   N T    M C E   +F+ I  PLKI DPENSGM +   +    + TVD +T+ 
Sbjct: 128 FSR-WENKTN--VMDCLELEDKFNSIKVPLKIKDPENSGMQIP-KDVDGGNFTVDTVTRF 183

Query: 122 VGDDYFVNVMDVQSQENERWSLREWCNYF-NKPAEEKDRIRNVISLEVSHVEDLQYXXXX 180
           +G+DY V+VMDVQSQ+N  W++ EW  YF   P E +DRIRNVISLEVSHVE  Q+    
Sbjct: 184 LGEDYRVDVMDVQSQQNSTWTMAEWNKYFMQTPIESRDRIRNVISLEVSHVE--QFKSGL 241

Query: 181 XXXXXXXXXXXWNNVENLDTENDPRPKVTKYCLMSVKNAFTDYHLDFAGTSVYYNLAFGK 240
                       + + N   +N  RPKVTKY LMSV+NA+TD+HLDFAGTSVYY +  G 
Sbjct: 242 RRPRVVESNDVVDLLWNAIPDNTVRPKVTKYILMSVQNAYTDFHLDFAGTSVYYKVISGS 301

Query: 241 KKFILYPPTPENIENYIEWSTSTYQNMLFLGEKLTGGVAMELNGGDLFMIPSGYIHVVYT 300
           KKFIL+PPTP N+  Y +W  +  QN++FLG++L  G+AM+L+ GDLFMIP GYIH VYT
Sbjct: 302 KKFILFPPTPRNLAAYTQWCGNDDQNLIFLGDQLEEGIAMDLSAGDLFMIPCGYIHAVYT 361

Query: 301 PEDSLIFGGNYLTFRDISQQLKIVDVEKQTGVTKRYTFPMFDEVMGRTCEWLCQNQKKGK 360
           P D+L+ GGN+LT RD+  QL IVD+EK T V K++TFP F+ VMG+TCE++ + +  G 
Sbjct: 362 PVDTLVIGGNFLTLRDLKTQLMIVDIEKVTKVPKKFTFPQFESVMGKTCEYIVKKEANGI 421

Query: 361 QMQVKKETVNDLISYMKSGKTKYKPTNFINKKQMLQ 396
            + +K E    L+ Y++  K KY+P NF  K+Q+L+
Sbjct: 422 DLGIKNEQKEALLHYIQDPKFKYRPVNFSTKRQLLE 457

>KLLA0F27643g complement(2561213..2562649) similar to sp|P40034
           Saccharomyces cerevisiae YER051w singleton, start by
           similarity
          Length = 478

 Score =  342 bits (877), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 185/390 (47%), Positives = 247/390 (63%), Gaps = 21/390 (5%)

Query: 19  DEVPRKKRYNFRKKVELDYSALNEGEDKKSKFFHPHIALFEKEFEKCLSNVTEDMSMTCS 78
           +++   KR   R K  +DY ALNEG DK+ K  HPH   F   FEK      +  +++ S
Sbjct: 88  EDIAFTKRNRLRNKRPIDYIALNEGNDKRLKHEHPHTQAFLACFEKW----KDPKAISSS 143

Query: 79  EYCKRFDDIDFPLKISDPENSGM-VVSTN------NKTTRDLTVDDITQAVGDDYFVNVM 131
           E    F  I  PL++SDP +SGM V+S N      +K    L V+ +T+ +GDDY ++VM
Sbjct: 144 ELESDFQIIKVPLRVSDPADSGMYVISANELGLVDSKDHVKLNVEYLTKIMGDDYPLDVM 203

Query: 132 DVQSQENERWSLREWCNYFNKPA-EEKDRIRNVISLEVSHVEDLQ--YXXXXXXXXXXXX 188
           DVQ+Q NE+W+L +W  Y++  +  ++DRIRNVISLEVSHVE  +               
Sbjct: 204 DVQTQMNEKWTLSQWNEYYSHTSPSDRDRIRNVISLEVSHVESFKDGIRRPNAVNNNDLV 263

Query: 189 XXXWNNVENLDTEND-PRPKVTKYCLMSVKNAFTDYHLDFAGTSVYYNLAFGKKKFILYP 247
              WN      TE D  RPKVTKY LMSV NA+TD+HLDFAGTSVYYN+  G KKFIL+P
Sbjct: 264 DIVWNFGR---TETDIERPKVTKYILMSVGNAYTDFHLDFAGTSVYYNVISGSKKFILFP 320

Query: 248 PTPENIENYIEWSTSTYQNMLFLGEKLTGGVAMELNGGDLFMIPSGYIHVVYTPEDSLIF 307
           PT  N++ Y EW  +  QN +FLG++L  G+AMEL  G+LFMIP GYIH VYTPEDS I 
Sbjct: 321 PTDYNLKKYREWCDNDNQNDIFLGDQLEAGIAMELTEGNLFMIPCGYIHAVYTPEDSFIV 380

Query: 308 GGNYLTFRDISQQLKIVDVEKQTGVTKRYTFPMFDEVMGRTCEWLCQNQKKGKQMQVKKE 367
           GGN+LT RDI+ QL +V++E QT V K++TFP F+ VMG+TCEWL  +        +  E
Sbjct: 381 GGNFLTLRDITTQLNVVEIEHQTKVPKKFTFPQFESVMGKTCEWLLNSD---HIQSISSE 437

Query: 368 TVNDLISYMKSGKTKYKPTNFINKKQMLQE 397
            + +L+ Y+ S   KYKP N+ +KK+++ E
Sbjct: 438 DIENLVKYLSSSNIKYKPINYQSKKELITE 467

>ADL088W [1653] [Homologous to ScYER051W - SH]
           complement(530548..532008) [1461 bp, 486 aa]
          Length = 486

 Score =  317 bits (813), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 163/388 (42%), Positives = 230/388 (59%), Gaps = 13/388 (3%)

Query: 10  GEKRSLNDNDEVPRK--KRYNFRKKVELDYSALNEGEDKKSKFFHPHIALFEKEFEKCLS 67
           G++R +   +E  R   +RY  RK+  LDY ALNEG+D + +  HPH A F+  F K  S
Sbjct: 94  GKRRRVEAKEEPERAGTRRYRLRKRGPLDYIALNEGQDVRLRHEHPHRAAFQGCFTK-WS 152

Query: 68  NVTEDMSMTCSEYCKRFDDIDFPLKISDPENSGMVVSTNNKTTRDLTVDDITQAVGDDYF 127
            +    ++T +E  + F ++  P+ ++DPE+SGM     ++         +   +G DY 
Sbjct: 153 GLGR--TVTSAELQQSFAELREPVLVADPEHSGMQTPAMDEQV-------LADVLGADYS 203

Query: 128 VNVMDVQSQENERWSLREWCNYFNKPAEEKDRIRNVISLEVSHVEDLQYXXXXXXXXXXX 187
           ++VMDVQSQ+NERW++ +W  Y +     +DRIRNVISLEVSHV +              
Sbjct: 204 LDVMDVQSQQNERWTMGQWKEYMHTARGVRDRIRNVISLEVSHVPEFGQRIRRPRAVEDN 263

Query: 188 XXXXWNNVENLDTENDPRPKVTKYCLMSVKNAFTDYHLDFAGTSVYYNLAFGKKKFILYP 247
                        E   +PKV KY LMS  NA+TD+HLDFAGTSVYY+L  G K+F+L+P
Sbjct: 264 DLVDLVWPVQPAPEIGAKPKVQKYVLMSAANAYTDFHLDFAGTSVYYSLLRGAKQFLLFP 323

Query: 248 PTPENIENYIEWSTSTYQNMLFLGEKLTGGVAMELNGGDLFMIPSGYIHVVYTPEDSLIF 307
           PTP N+  Y  W     Q ++FLG++L  GV   L  GDLFMIPSG+IH VYTPEDS + 
Sbjct: 324 PTPANLGAYKAWCADDNQGLIFLGDRLQDGVLFSLRPGDLFMIPSGFIHAVYTPEDSFVV 383

Query: 308 GGNYLTFRDISQQLKIVDVEKQTGVTKRYTFPMFDEVMGRTCEWLCQNQKKGKQMQVKKE 367
           GGNYL  RD+S  ++IV +E++T V K++TFP F+ VMG T EWL +   +  Q+ +  E
Sbjct: 384 GGNYLCLRDLSTHIRIVRIEQETQVPKKFTFPKFERVMGLTAEWLLEGLPERLQL-ITHE 442

Query: 368 TVNDLISYMKSGKTKYKPTNFINKKQML 395
               L+ Y++  + KYKP ++  K  ML
Sbjct: 443 HAVALLDYLRDTRLKYKPAHYHTKSTML 470

>Sklu_1281.1 YGL105W, Contig c1281 243-1086
          Length = 282

 Score = 32.0 bits (71), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 23/106 (21%), Positives = 51/106 (48%), Gaps = 5/106 (4%)

Query: 63  EKCLSNVTEDMSMTCSEYCKRFDDIDFPLKISDPENSGMVVSTNNKTTRDLTVDDITQAV 122
           E+    V  D  +   +  K  D+++  L+     +S  ++ST N TT D++V ++T  +
Sbjct: 21  EQSALQVQWDSVVKSGQITKHLDELNSSLR-----DSAFILSTLNPTTVDVSVFEVTFPL 75

Query: 123 GDDYFVNVMDVQSQENERWSLREWCNYFNKPAEEKDRIRNVISLEV 168
             D   +  DV+    +   +  W +Y  K  +  ++ + V++L++
Sbjct: 76  VKDLISSTKDVKGNYAKYRHVLRWSDYLQKLLQVPEQEQIVLNLDL 121

>Sklu_2377.7 YPL120W, Contig c2377 17957-19345 reverse complement
          Length = 462

 Score = 30.4 bits (67), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 34/69 (49%), Gaps = 2/69 (2%)

Query: 35  LDYSALNEGEDKKSKFFHPHIALFEKEFEKCLSNVTEDMSMTCSEYCKRFDDIDFPLKIS 94
           + Y A N GE K  KFF+   + F+K  E C+  V + M+   S      + I+ P  + 
Sbjct: 360 VSYDAFNNGEFKLGKFFYKETS-FDKALE-CILAVVDQMASRLSSTSTEQEVIELPYTMH 417

Query: 95  DPENSGMVV 103
           + + +G+ +
Sbjct: 418 NDKINGITI 426

>KLLA0A07293g 652702..654453 weakly similar to sgd|S0005477
           Saccharomyces cerevisiae YOL117w, hypothetical start
          Length = 583

 Score = 29.6 bits (65), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 40/92 (43%), Gaps = 13/92 (14%)

Query: 302 EDSLIFGGNYLT-FRDISQQLKIVDVEKQTGVTKRYTFPMFDEVMGRTCEWLCQNQKKGK 360
           ED + FG  Y    R  S++L IV+   Q          M  E++G+  EWLC      K
Sbjct: 475 EDYVYFGEEYFVPLR--SEELNIVNPLSQ---------QMGSEIIGKD-EWLCNVSNWHK 522

Query: 361 QMQVKKETVNDLISYMKSGKTKYKPTNFINKK 392
               KK +  + + YMK+ +     TN  + +
Sbjct: 523 PKVPKKLSAIEFMDYMKAARVTISQTNLAHHE 554

>Scas_698.11
          Length = 592

 Score = 28.9 bits (63), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 31/69 (44%), Gaps = 9/69 (13%)

Query: 316 DISQQLKIVDVEKQTGVTKRYTFPMFDEVMGRTCEWLCQNQKK------GKQMQVKKETV 369
           ++ Q  +  +   Q+GV +R  F   D   G+    L     K       +QM  KK+ V
Sbjct: 470 EVKQMKRATETTLQSGVIQRLGF---DPTHGKIANVLRTTHSKEEKDTLSEQMSGKKDKV 526

Query: 370 NDLISYMKS 378
           NDL+ + KS
Sbjct: 527 NDLLHFRKS 535

>CAGL0H03047g 285868..288093 weakly similar to sp|P53148
           Saccharomyces cerevisiae YGL093w SPC105 spindle pole
           body protein, start by similarity
          Length = 741

 Score = 28.9 bits (63), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 6/65 (9%)

Query: 304 SLIFGGNYLTFRDISQQLKIVDVEKQTGVTKRYTFPMFDEVMGRTCEWLCQNQKKGKQMQ 363
           SLIF   Y    ++S+ LKI D++  +     YT P+ D +    C   C+N      ++
Sbjct: 651 SLIFNVKYEMENEVSKNLKISDIDYYSNANISYTIPINDIL---KC---CRNNNSILSIK 704

Query: 364 VKKET 368
           V+ E+
Sbjct: 705 VRSES 709

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.134    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,267,124
Number of extensions: 665231
Number of successful extensions: 1977
Number of sequences better than 10.0: 23
Number of HSP's gapped: 1984
Number of HSP's successfully gapped: 23
Length of query: 397
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 293
Effective length of database: 12,995,837
Effective search space: 3807780241
Effective search space used: 3807780241
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)