Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0J02838g1601588441e-118
Kwal_47.181531711343752e-46
KLLA0E04477g1551113301e-39
ADL117W1731083251e-38
YER050C (RSM18)2021263271e-38
Scas_715.27d1741103144e-37
KLLA0E04785g31963670.60
Kwal_56.23885167456622.5
Sklu_2428.581768613.7
KLLA0B09218g138541604.9
Scas_669.637356596.1
KLLA0A04235g73693587.6
Kwal_23.313772393587.8
YMR166C36887588.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J02838g
         (158 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J02838g complement(275124..275606) similar to sp|P40033 Sac...   329   e-118
Kwal_47.18153                                                         149   2e-46
KLLA0E04477g complement(409814..410281) some similarities with s...   131   1e-39
ADL117W [1624] [Homologous to ScYER050C (RSM18) - SH] complement...   129   1e-38
YER050C (RSM18) [1478] chr5 complement(253970..254578) Component...   130   1e-38
Scas_715.27d                                                          125   4e-37
KLLA0E04785g 432181..433140 similar to sp|Q06624 Saccharomyces c...    30   0.60 
Kwal_56.23885                                                          28   2.5  
Sklu_2428.5 YKR079C, Contig c2428 6542-8995                            28   3.7  
KLLA0B09218g 805915..810072 gi|22080764|emb|CAD43185.1 Kluyverom...    28   4.9  
Scas_669.6                                                             27   6.1  
KLLA0A04235g complement(383275..385485) similar to sp|P32501 Sac...    27   7.6  
Kwal_23.3137                                                           27   7.8  
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    27   8.1  

>CAGL0J02838g complement(275124..275606) similar to sp|P40033
           Saccharomyces cerevisiae YER050c RSM18, hypothetical
           start
          Length = 160

 Score =  329 bits (844), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 158/158 (100%), Positives = 158/158 (100%)

Query: 1   MFMVGRICGIESANVAMGLRMVQKRGIVDMRPKKKSVIDVDFEGSRENIKTINANFVPQF 60
           MFMVGRICGIESANVAMGLRMVQKRGIVDMRPKKKSVIDVDFEGSRENIKTINANFVPQF
Sbjct: 1   MFMVGRICGIESANVAMGLRMVQKRGIVDMRPKKKSVIDVDFEGSRENIKTINANFVPQF 60

Query: 61  QRSAVYDPFDFSLSRLNLDRKMNRPKIQHHDLFEKYGLNPLNFYARPEILSYYVGSTGKI 120
           QRSAVYDPFDFSLSRLNLDRKMNRPKIQHHDLFEKYGLNPLNFYARPEILSYYVGSTGKI
Sbjct: 61  QRSAVYDPFDFSLSRLNLDRKMNRPKIQHHDLFEKYGLNPLNFYARPEILSYYVGSTGKI 120

Query: 121 LHRDVTGLSAKNQRRMAKAIRRCQAIGLMSKTHRFTNF 158
           LHRDVTGLSAKNQRRMAKAIRRCQAIGLMSKTHRFTNF
Sbjct: 121 LHRDVTGLSAKNQRRMAKAIRRCQAIGLMSKTHRFTNF 158

>Kwal_47.18153
          Length = 171

 Score =  149 bits (375), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 76/134 (56%), Positives = 97/134 (72%), Gaps = 4/134 (2%)

Query: 28  VDMRPKKKSVIDVDFEGSRENI---KTINANFVPQFQRSAVYDPFDFSLSRLNLDRKMNR 84
           + + P +KS I+V  + S  +    K I+   V +FQ    YDPFDFSL+RL+LD+K + 
Sbjct: 30  IKLTPNEKSQINVKAKESGSSASQNKKIDPRLVKKFQSGTTYDPFDFSLARLHLDKKFSS 89

Query: 85  PKIQHHDLFEKYGLNPLNFYARPEILSYYVGSTGKILHRDVTGLSAKNQRRMAKAIRRCQ 144
            K   +DLFEK G++PL+ Y  PE LS +V S+GKILHRDVTGLSAKNQRR++KAIRRCQ
Sbjct: 90  -KNSSNDLFEKNGVDPLDLYTNPEFLSQFVTSSGKILHRDVTGLSAKNQRRLSKAIRRCQ 148

Query: 145 AIGLMSKTHRFTNF 158
           AIGLMSKTHR  +F
Sbjct: 149 AIGLMSKTHRDVSF 162

>KLLA0E04477g complement(409814..410281) some similarities with
           sp|P40033 Saccharomyces cerevisiae YER050c RSM18
           component of the mitochondrial ribosomal small subunit
           singleton, hypothetical start
          Length = 155

 Score =  131 bits (330), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 65/111 (58%), Positives = 80/111 (72%), Gaps = 3/111 (2%)

Query: 45  SRENIKTINANFVPQFQRSAVYDPFDFSLSRLNLDRKMN-RPKIQHHDLFEKYGLNPLNF 103
           S+  IK + +  +  FQ  +VY+PFDFSL R++LD+K   RP     D F K  +NPL+ 
Sbjct: 34  SKPTIKKLESKLIKNFQPGSVYNPFDFSLERIHLDKKFGVRP--GSFDPFNKLKINPLDL 91

Query: 104 YARPEILSYYVGSTGKILHRDVTGLSAKNQRRMAKAIRRCQAIGLMSKTHR 154
           Y  PE LS +V STGKILHRDVTGLSAKNQRR+ KAI+RCQAIGLMSK H+
Sbjct: 92  YTNPEFLSRFVTSTGKILHRDVTGLSAKNQRRLTKAIKRCQAIGLMSKVHK 142

>ADL117W [1624] [Homologous to ScYER050C (RSM18) - SH]
           complement(480459..480980) [522 bp, 173 aa]
          Length = 173

 Score =  129 bits (325), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 57/108 (52%), Positives = 84/108 (77%), Gaps = 1/108 (0%)

Query: 47  ENIKTINANFVPQFQRSAVYDPFDFSLSRLNLDRKMNRPKIQHHDLFEKYGLNPLNFYAR 106
           + +K +    + +F   ++YDPFDFS++RL+L++K +R   +  D+FE+  L+PL+ Y  
Sbjct: 54  DQVKKVPPEMMKKFATGSLYDPFDFSMARLHLEKK-HRKNARKVDIFEELNLDPLDLYTS 112

Query: 107 PEILSYYVGSTGKILHRDVTGLSAKNQRRMAKAIRRCQAIGLMSKTHR 154
           P ILS +VG+TGKILHRDVTGLS ++Q+RM++A+RRCQAIGLMSKTH+
Sbjct: 113 PAILSRFVGNTGKILHRDVTGLSVRSQKRMSRAVRRCQAIGLMSKTHK 160

>YER050C (RSM18) [1478] chr5 complement(253970..254578) Component of
           the mitochondrial ribosomal small subunit [609 bp, 202
           aa]
          Length = 202

 Score =  130 bits (327), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 64/126 (50%), Positives = 86/126 (68%), Gaps = 1/126 (0%)

Query: 24  KRGIVDMRPKKKSVIDVDFEGSRENIKTINANFVPQFQRSAVYDPFDFSLSRLNLDRKMN 83
           KR + +   K+K  ++++  G  +  K I+ +   +  +  +YDPFDFS+ R++LDRK  
Sbjct: 78  KRALYNFGIKEKKSVNIEM-GRTQQTKKIDQSLSKKLPKGTIYDPFDFSMGRIHLDRKYQ 136

Query: 84  RPKIQHHDLFEKYGLNPLNFYARPEILSYYVGSTGKILHRDVTGLSAKNQRRMAKAIRRC 143
             K  + +   K G NPL FYARP ILS YV STG+I HRD+TGLSAKNQRR++KAIRRC
Sbjct: 137 ANKNSNRNDIMKSGANPLEFYARPRILSRYVTSTGRIQHRDITGLSAKNQRRLSKAIRRC 196

Query: 144 QAIGLM 149
           QAIGLM
Sbjct: 197 QAIGLM 202

>Scas_715.27d
          Length = 174

 Score =  125 bits (314), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 57/110 (51%), Positives = 81/110 (73%)

Query: 45  SRENIKTINANFVPQFQRSAVYDPFDFSLSRLNLDRKMNRPKIQHHDLFEKYGLNPLNFY 104
           +  ++K I+  FV +FQ+ ++YDPFDFS++++NLDRK              Y +NPL+ Y
Sbjct: 55  TNSSVKAIDEVFVKKFQQGSIYDPFDFSMAKVNLDRKTKSLIGTSKTYNISYNINPLDLY 114

Query: 105 ARPEILSYYVGSTGKILHRDVTGLSAKNQRRMAKAIRRCQAIGLMSKTHR 154
           + P  L+ ++ STGKILHRDVTGLSAKNQRR++KAI+R Q+IGL+SKTH+
Sbjct: 115 SSPSELNKFISSTGKILHRDVTGLSAKNQRRLSKAIKRAQSIGLLSKTHK 164

>KLLA0E04785g 432181..433140 similar to sp|Q06624 Saccharomyces
           cerevisiae YPR180w AOS1 forms together with UBA2P a
           heterodimeric activating enzyme for SMT3P, start by
           similarity
          Length = 319

 Score = 30.4 bits (67), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 7/63 (11%)

Query: 24  KRGIVDMRPKKKSVIDVDFEGSRENIKTINANFVPQFQRSAVYDPFDFSLSRLN-LDRKM 82
           +R I DM P+ K  +D+       ++++ N  F  QF    + D F   + +LN + R++
Sbjct: 69  RRHIEDMNPRVKLTVDI------SDLQSKNKEFFSQFNLIVITDLFPADIEKLNEVTREL 122

Query: 83  NRP 85
           N P
Sbjct: 123 NVP 125

>Kwal_56.23885
          Length = 1674

 Score = 28.5 bits (62), Expect = 2.5,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 8/56 (14%)

Query: 55  NFVPQFQRSAVYDPFDFSLSRL-------NLDRKMNRPKIQHHD-LFEKYGLNPLN 102
           ++ PQFQ    Y PF + +SR        NL   +++  ++ ++ +F K G++ LN
Sbjct: 57  SWTPQFQNVKYYVPFPYQVSRRLASSLSPNLPSGVHQKTLEVYNVIFSKIGIDALN 112

>Sklu_2428.5 YKR079C, Contig c2428 6542-8995
          Length = 817

 Score = 28.1 bits (61), Expect = 3.7,   Method: Composition-based stats.
 Identities = 17/68 (25%), Positives = 33/68 (48%)

Query: 20  RMVQKRGIVDMRPKKKSVIDVDFEGSRENIKTINANFVPQFQRSAVYDPFDFSLSRLNLD 79
           +++  + IV  +P + S  D        +++ I +   PQ + SA YDP       + L 
Sbjct: 125 KLICVKAIVVKKPVESSEEDSLTSKLVSSLRAIVSRMFPQHEPSARYDPSSDPYMNVELP 184

Query: 80  RKMNRPKI 87
           ++++ PKI
Sbjct: 185 KEIHVPKI 192

>KLLA0B09218g 805915..810072 gi|22080764|emb|CAD43185.1
           Kluyveromyces lactis alpha-aminoadipate reductase, start
           by similarity
          Length = 1385

 Score = 27.7 bits (60), Expect = 4.9,   Method: Composition-based stats.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 35  KSVIDVDFEGSRENIKTINA-NFVPQFQRSAVYDPFDFSLS 74
           KS+  V+F+   E++K  N    +PQF R    D  DFSL+
Sbjct: 108 KSLESVNFDELSEHVKAQNELEVLPQFFRLGFVDQEDFSLT 148

>Scas_669.6
          Length = 373

 Score = 27.3 bits (59), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 3/56 (5%)

Query: 33  KKKSVIDVDFEGSRENIKTINANFVPQFQRSAVYDPFDFSLSRLNLDRKMNRPKIQ 88
           K+K + D+ F    + +  ++A  +  F  S VY P +   +RL L  ++N P  Q
Sbjct: 134 KRKMIGDLGFN---DTVSHLSAGLLGDFVSSFVYVPSEVLKTRLQLQGRVNNPFFQ 186

>KLLA0A04235g complement(383275..385485) similar to sp|P32501
           Saccharomyces cerevisiae YDR211w GCD6 translation
           initiation factor eIF2b epsilon, 81 kDa subunit
           singleton, start by similarity
          Length = 736

 Score = 26.9 bits (58), Expect = 7.6,   Method: Composition-based stats.
 Identities = 23/93 (24%), Positives = 41/93 (44%), Gaps = 15/93 (16%)

Query: 2   FMVGRICGIESANVAMGLRMVQKRGIVD---MRPKKKSVIDVDFE-----------GSRE 47
           F V  I  +ES +V   +R V  RG++    +      V ++DFE             ++
Sbjct: 100 FKVNTIMSLESRSVGDAMRDVDNRGLITGDFVLVSGDLVTNMDFEKALDIHKQRRKADKD 159

Query: 48  NIKTINANFVPQFQRSAVYDPFDFSLSRLNLDR 80
           +I T+  +   QF ++  ++P  F   + N DR
Sbjct: 160 HIVTMCLSKATQFHKTRSHEPATFIFDKSN-DR 191

>Kwal_23.3137
          Length = 723

 Score = 26.9 bits (58), Expect = 7.8,   Method: Composition-based stats.
 Identities = 23/93 (24%), Positives = 43/93 (46%), Gaps = 15/93 (16%)

Query: 2   FMVGRICGIESANVAMGLRMVQKRGIVD---MRPKKKSVIDVDFEGS-----------RE 47
           F V  I  +ES +V   +R +  RG++    +      V +++F+ +           R+
Sbjct: 102 FRVSTIMSLESRSVGDAMRDLDNRGVITGDFILVSGDLVTNMEFDKALEFHRKKKAEDRD 161

Query: 48  NIKTINANFVPQFQRSAVYDPFDFSLSRLNLDR 80
           +I T+  +   QF R+  ++P  F L + N DR
Sbjct: 162 HIVTMCLSKASQFYRTRCHEPAAFILDKSN-DR 193

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 26.9 bits (58), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 36/87 (41%), Gaps = 12/87 (13%)

Query: 2   FMVGRICGIESANVAMGLRMVQKRGIVDMRPKKKSVIDVDFEGSRENIKTINANFVPQFQ 61
           +M   +    SA +  G     KR +++           D++   + I  ++A F+  F 
Sbjct: 114 YMAAMLGSFPSAAIFFGTYEYTKRTMIE-----------DWQ-INDTITHLSAGFLGDFI 161

Query: 62  RSAVYDPFDFSLSRLNLDRKMNRPKIQ 88
            S VY P +   +RL L  + N P  Q
Sbjct: 162 SSFVYVPSEVLKTRLQLQGRFNNPFFQ 188

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.139    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,843,823
Number of extensions: 199553
Number of successful extensions: 721
Number of sequences better than 10.0: 17
Number of HSP's gapped: 717
Number of HSP's successfully gapped: 17
Length of query: 158
Length of database: 16,596,109
Length adjustment: 93
Effective length of query: 65
Effective length of database: 13,376,635
Effective search space: 869481275
Effective search space used: 869481275
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 57 (26.6 bits)