Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0J02816g62561531930.0
YER049W64463123140.0
Sklu_2174.463261921620.0
Kwal_47.1814562461820620.0
Scas_715.28*63262619390.0
ADL114C61461919370.0
KLLA0E04411g60061617560.0
CAGL0B00924g438147730.89
AGL305W105788693.3
AGR086C53463683.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J02816g
         (615 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J02816g 272944..274821 highly similar to sp|P40032 Saccharo...  1234   0.0  
YER049W (YER049W) [1477] chr5 (251727..253661) Component of NuA3...   895   0.0  
Sklu_2174.4 YER049W, Contig c2174 3142-5040 reverse complement        837   0.0  
Kwal_47.18145                                                         798   0.0  
Scas_715.28*                                                          751   0.0  
ADL114C [1627] [Homologous to ScYER049W - SH] (484310..486154) [...   750   0.0  
KLLA0E04411g 404611..406413 similar to sp|P40032 Saccharomyces c...   681   0.0  
CAGL0B00924g complement(81492..82808) similar to sp|P11709 Sacch...    33   0.89 
AGL305W [4007] [Homologous to ScYJR091C (JSN1) - SH; ScYPR042C (...    31   3.3  
AGR086C [4396] [Homologous to ScYDR110W (FOB1) - SH] (888764..89...    31   3.8  

>CAGL0J02816g 272944..274821 highly similar to sp|P40032
           Saccharomyces cerevisiae YER049w, start by similarity
          Length = 625

 Score = 1234 bits (3193), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 599/615 (97%), Positives = 599/615 (97%)

Query: 1   MKRKAEAQENGNKQLDLEEDKVKGLFNQKLWTPEFREGLKNQIDSSAPYNWGNISGLVND 60
           MKRKAEAQENGNKQLDLEEDKVKGLFNQKLWTPEFREGLKNQIDSSAPYNWGNISGLVND
Sbjct: 1   MKRKAEAQENGNKQLDLEEDKVKGLFNQKLWTPEFREGLKNQIDSSAPYNWGNISGLVND 60

Query: 61  DLLRAVRKEIETEIHFTKKETDIYKVNQSGDLANLSGLNWDDLSRLPNMYKLRQILYSDV 120
           DLLRAVRKEIETEIHFTKKETDIYKVNQSGDLANLSGLNWDDLSRLPNMYKLRQILYSDV
Sbjct: 61  DLLRAVRKEIETEIHFTKKETDIYKVNQSGDLANLSGLNWDDLSRLPNMYKLRQILYSDV 120

Query: 121 YRDLIGYVTGAGKLSGSKMDMSVNTYTKGCHLLTHDDVIGSRRISFILYLPDPDRKWKPQ 180
           YRDLIGYVTGAGKLSGSKMDMSVNTYTKGCHLLTHDDVIGSRRISFILYLPDPDRKWKPQ
Sbjct: 121 YRDLIGYVTGAGKLSGSKMDMSVNTYTKGCHLLTHDDVIGSRRISFILYLPDPDRKWKPQ 180

Query: 181 YGGGLRLFSSILPNIPETDPCAKFVPQFNEIAFFKVLPGFSFHDVEEVKVDKHRLSIQGW 240
           YGGGLRLFSSILPNIPETDPCAKFVPQFNEIAFFKVLPGFSFHDVEEVKVDKHRLSIQGW
Sbjct: 181 YGGGLRLFSSILPNIPETDPCAKFVPQFNEIAFFKVLPGFSFHDVEEVKVDKHRLSIQGW 240

Query: 241 YHFPQPGEPGYTPGQEEAWVKNNTSTLTQLETNVLQDFEYPKQERDILPYHQVKHFEKVL 300
           YHFPQPGEPGYTPGQEEAWVKNNTSTLTQLETNVLQDFEYPKQERDILPYHQVKHFEKVL
Sbjct: 241 YHFPQPGEPGYTPGQEEAWVKNNTSTLTQLETNVLQDFEYPKQERDILPYHQVKHFEKVL 300

Query: 301 YAADGKKIDEDEVKSVVQDTDSLSEKEYKYLSQYISAEHLTKEGIKKLQEQFLENSTLQI 360
           YAADGKKIDEDEVKSVVQDTDSLSEKEYKYLSQYISAEHLTKEGIKKLQEQFLENSTLQI
Sbjct: 301 YAADGKKIDEDEVKSVVQDTDSLSEKEYKYLSQYISAEHLTKEGIKKLQEQFLENSTLQI 360

Query: 361 KDFLNEEVSELLKKMIKTEELEKACPYMAKDVETPWQTAMPSHKWRYMYIDGKNPRKLLK 420
           KDFLNEEVSELLKKMIKTEELEKACPYMAKDVETPWQTAMPSHKWRYMYIDGKNPRKLLK
Sbjct: 361 KDFLNEEVSELLKKMIKTEELEKACPYMAKDVETPWQTAMPSHKWRYMYIDGKNPRKLLK 420

Query: 421 ASDIMXXXXXXXXXXXXXXXXTLPKDGSVDVELKLIDLAIFYKSTIFKKYLALLTALCPL 480
           ASDIM                TLPKDGSVDVELKLIDLAIFYKSTIFKKYLALLTALCPL
Sbjct: 421 ASDIMEALNNEELPNFELLRETLPKDGSVDVELKLIDLAIFYKSTIFKKYLALLTALCPL 480

Query: 481 SEQILIRRFRPGNDFTLATQCRLNEFLQDVEGILPSILVGNLCLTPSSGWESGEVGGYEL 540
           SEQILIRRFRPGNDFTLATQCRLNEFLQDVEGILPSILVGNLCLTPSSGWESGEVGGYEL
Sbjct: 481 SEQILIRRFRPGNDFTLATQCRLNEFLQDVEGILPSILVGNLCLTPSSGWESGEVGGYEL 540

Query: 541 YMMDDENTEEEERMHKDVEDASVYRTDDNGDSVLVNNPPSWNTFNLVLRDQSVLEFVKYV 600
           YMMDDENTEEEERMHKDVEDASVYRTDDNGDSVLVNNPPSWNTFNLVLRDQSVLEFVKYV
Sbjct: 541 YMMDDENTEEEERMHKDVEDASVYRTDDNGDSVLVNNPPSWNTFNLVLRDQSVLEFVKYV 600

Query: 601 SCAAKSSRWDVKMEW 615
           SCAAKSSRWDVKMEW
Sbjct: 601 SCAAKSSRWDVKMEW 615

>YER049W (YER049W) [1477] chr5 (251727..253661) Component of NuA3
           histone acetyltransferase complex [1935 bp, 644 aa]
          Length = 644

 Score =  895 bits (2314), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/631 (68%), Positives = 513/631 (81%), Gaps = 17/631 (2%)

Query: 1   MKRK-AEAQ---ENGNKQLDLEEDKVKGLFNQKLWTPEFREGLKNQIDSSAPYNWGNISG 56
           MKRK AE +   E  +KQ+ LEEDK+KG+FN K+W   F++GLK +I+ S PYNWG I  
Sbjct: 1   MKRKTAEVKGEKERNSKQISLEEDKIKGMFNPKIWDKTFQDGLKKEIEDSQPYNWGTIHE 60

Query: 57  LVNDDLLRAVRKEIETEIHFTKKETDIYKVNQSGDLANLSGLNWDDLSRLPNMYKLRQIL 116
           LVNDDLLRAVRKEIETEIHFTKKETDIY+VNQSGDLANLSGL+WDDLSRLPN++KLRQIL
Sbjct: 61  LVNDDLLRAVRKEIETEIHFTKKETDIYRVNQSGDLANLSGLDWDDLSRLPNLFKLRQIL 120

Query: 117 YSDVYRDLIGYVTGAGKLSGSKMDMSVNTYTKGCHLLTHDDVIGSRRISFILYLPDPDRK 176
           YS  YRD  GYVT AGKLSGSK DMS+NTYTKGCHLLTHDDVIGSRRISFILYLPDPDRK
Sbjct: 121 YSKQYRDFFGYVTKAGKLSGSKTDMSINTYTKGCHLLTHDDVIGSRRISFILYLPDPDRK 180

Query: 177 WKPQYGGGLRLFSSILPNIPETDPCAKFVPQFNEIAFFKVLPGFSFHDVEEVKVDKHRLS 236
           WK  YGGGLRLF SILPN+P +DP AK VPQFN+IAFFKVLPGFSFHDVEEVKVDKHRLS
Sbjct: 181 WKSHYGGGLRLFPSILPNVPHSDPSAKLVPQFNQIAFFKVLPGFSFHDVEEVKVDKHRLS 240

Query: 237 IQGWYHFPQPGEPGYTPGQEEAWVKNNTSTLTQLETNVLQDFEYPKQERDILPYHQVKHF 296
           IQGWYH PQ GE GY PG+EEAWV+NNTSTL Q+E+NVL+DFE+PK ER+IL +H+VKHF
Sbjct: 241 IQGWYHIPQVGEEGYIPGEEEAWVRNNTSTLAQIESNVLEDFEFPKDERNILSFHEVKHF 300

Query: 297 EKVLYAADGKKID---EDEVKSVVQDTDSLSEKEYKYLSQYISAEHLTKEGIKKLQEQFL 353
           EK+L    G K D   ++ + SV+ D+  LSE E+ YLSQYIS EHL+ +GI+KLQ+QF+
Sbjct: 301 EKMLKGDAGAKTDNTPKESMTSVISDSVKLSEAEFTYLSQYISPEHLSSKGIEKLQKQFV 360

Query: 354 ENSTLQIKDFLNEEVSELLKKMIKTEELEKACPYMAKDVETPWQTAMPSHKWRYMYIDGK 413
           ENS+LQI+ FLN++ SELLKK+IK +ELE+ CPY +KDV+ PW+TA+P HK RY+YIDGK
Sbjct: 361 ENSSLQIESFLNDDKSELLKKVIKQKELEQECPYHSKDVKAPWKTAIPPHKARYLYIDGK 420

Query: 414 NPRKLLKASDIMXXXXXXXXXXXXXXXXTL---------PKDGSVDVELKLIDLAIFYKS 464
             R     +DI+                 +          ++ + D EL LIDLA+F+KS
Sbjct: 421 EYRNFQTEADILEALNNNDLPNFQFTKDAIKIISDASGNSRENNFDAELALIDLAVFHKS 480

Query: 465 TIFKKYLALLTALCPLSEQILIRRFRPGNDFTLATQCRLNEFLQDVEGILPSILVGNLCL 524
           TIFKKYLALLT+LCP+SEQILIRRFRPG DFTLAT+CR NE L+    I+ ++L G LCL
Sbjct: 481 TIFKKYLALLTSLCPVSEQILIRRFRPGMDFTLATKCRFNELLKSNPDIIDAVLEGTLCL 540

Query: 525 TPSSGWESGEVGGYELYMMDDENTEEEERMHKDVEDASVYRTDDNGDSVLVNNPPSWNTF 584
           TPS+GWESGE+GGYELYMMDD+  + ++ + +DVEDASVYR DD+GDSVL+N+PP+WNTF
Sbjct: 541 TPSAGWESGELGGYELYMMDDDE-DNKQYLKEDVEDASVYRADDSGDSVLINDPPAWNTF 599

Query: 585 NLVLRDQSVLEFVKYVSCAAKSSRWDVKMEW 615
           NLVLRD+SVLEFVKYVS +AKSSRWDVKM+W
Sbjct: 600 NLVLRDESVLEFVKYVSWSAKSSRWDVKMKW 630

>Sklu_2174.4 YER049W, Contig c2174 3142-5040 reverse complement
          Length = 632

 Score =  837 bits (2162), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/619 (64%), Positives = 486/619 (78%), Gaps = 8/619 (1%)

Query: 1   MKRKAEAQE--NGNKQLDLEEDKVKGLFNQKLWTPEFREGLKNQIDSSAPYNWGNISGLV 58
           MKR A ++   N  KQ   EE KVK LFN K+W PEF+  L+ +I  S PYNWG I  L+
Sbjct: 1   MKRSAPSKSVVNPTKQQAGEESKVKPLFNSKIWDPEFQAALRQEIAESKPYNWGTIRDLI 60

Query: 59  NDDLLRAVRKEIETEIHFTKKETDIYKVNQSGDLANLSGLNWDDLSRLPNMYKLRQILYS 118
           NDDLLRAVRKEIET+IHFT KETDIYKVNQSGDLANLSGL+W+DLSRLPN++KLR+ILYS
Sbjct: 61  NDDLLRAVRKEIETQIHFTNKETDIYKVNQSGDLANLSGLDWNDLSRLPNLFKLREILYS 120

Query: 119 DVYRDLIGYVTGAGKLSGSKMDMSVNTYTKGCHLLTHDDVIGSRRISFILYLPDPDRKWK 178
           ++YRD+I YVTGAGKLSGSK DMS+NTYTKGCHLLTHDDVIGSRR+SFILYLPDPD++WK
Sbjct: 121 EIYRDVISYVTGAGKLSGSKTDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPDKQWK 180

Query: 179 PQYGGGLRLFSSILPNIPETDPCAKFVPQFNEIAFFKVLPGFSFHDVEEVKVDKHRLSIQ 238
             YGGGLRLF SI+ N+P +D  AK VPQFN+IAFF+V PGFSFHDVEEV+VDKHRLSIQ
Sbjct: 181 DHYGGGLRLFPSIVANVPHSDHSAKLVPQFNQIAFFQVQPGFSFHDVEEVRVDKHRLSIQ 240

Query: 239 GWYHFPQPGEPGYTPGQEEAWVKNNTSTLTQLETNVLQDFEYPKQERDILPYHQVKHFEK 298
           GWYH PQ GEPG+ PG+EE WVK NTSTL QLE+NVLQD+E+PK ERDILPYHQVKHFEK
Sbjct: 241 GWYHIPQVGEPGHIPGEEEEWVKTNTSTLAQLESNVLQDYEFPKNERDILPYHQVKHFEK 300

Query: 299 VLYAADGKKIDEDEVK--SVVQDTDSLSEKEYKYLSQYISAEHLTKEGIKKLQEQFLENS 356
           VL  +        E    S + DT +L+E+E  YLSQ++S E+LT  GI+ LQ +FLENS
Sbjct: 301 VLQDSSPDSDSSKEKSPVSAIVDTKNLTEEELHYLSQFVSEEYLTPTGIQSLQSRFLENS 360

Query: 357 TLQIKDFLNEEVSELLKKMIKTEELEKACPYMAKDVETPWQTAMPSHKWRYMYIDGKNPR 416
            LQI  FLN+  S+LLK++IK +EL K CPY +  V+ PW+TA+P HKWRY+YIDGK+  
Sbjct: 361 FLQIGSFLNDSKSKLLKRLIKNDELNKDCPYESDKVDAPWKTAIPPHKWRYLYIDGKSHE 420

Query: 417 KLLKASDIMXXXXXXXXXXXXXXXXTLPKDGSVDVELKLIDLAIFYKSTIFKKYLALLTA 476
                +DI+                TL K+   D E +L+ L  F++STIFKKYLALLT+
Sbjct: 421 NFRSEADILAKLNNEELPNYTFLKQTLDKEKH-DTEYELVQLVEFFQSTIFKKYLALLTS 479

Query: 477 LCPLSEQILIRRFRPGNDFTLATQCRLNEFLQDVEGILPSILVGNLCLTPSSGWESGEVG 536
           LCPLSEQIL+RRFRPG DFTLAT+   N+ L +VEG + ++L G LCLTP++GW+SGEVG
Sbjct: 480 LCPLSEQILVRRFRPGKDFTLATKINQNKLLSNVEGYVDAVLEGTLCLTPTNGWDSGEVG 539

Query: 537 GYELYMMDDENTEEEERMHKDVEDASVYRTDDNGDSVLVNNPPSWNTFNLVLRDQSVLEF 596
           GYELYM D    ++EE   KD+EDA+VY+ DD+GDSVL+N+PPSWN+ NLVLRD+SVL+F
Sbjct: 540 GYELYMND---QDDEEMRDKDLEDAAVYKADDSGDSVLINSPPSWNSLNLVLRDESVLQF 596

Query: 597 VKYVSCAAKSSRWDVKMEW 615
           VKY+S +AKSSRWDV M+W
Sbjct: 597 VKYISWSAKSSRWDVSMQW 615

>Kwal_47.18145
          Length = 624

 Score =  798 bits (2062), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/618 (63%), Positives = 483/618 (78%), Gaps = 7/618 (1%)

Query: 1   MKRKAEAQ--ENGNKQLDLEEDKVKGLFNQKLWTPEFREGLKNQIDSSAPYNWGNISGLV 58
           MKR +     E   KQ   E  K+K LFN K+W P+F++ LK +I  S PYNWG I  LV
Sbjct: 1   MKRTSSTHNDEISKKQPTNEVGKIKSLFNSKIWDPKFQDDLKQEIADSKPYNWGTIRDLV 60

Query: 59  NDDLLRAVRKEIETEIHFTKKETDIYKVNQSGDLANLSGLNWDDLSRLPNMYKLRQILYS 118
           +DDLLRAVRKE+ET+IHFTKKETDIYKVNQSGDLANLSGL+W+DLSRLPN+ KLR+ILYS
Sbjct: 61  DDDLLRAVRKEVETQIHFTKKETDIYKVNQSGDLANLSGLDWEDLSRLPNLCKLREILYS 120

Query: 119 DVYRDLIGYVTGAGKLSGSKMDMSVNTYTKGCHLLTHDDVIGSRRISFILYLPDPDRKWK 178
           +VYRD+I +VTGAGKLSGSKMDMS+NTYTKGCHLLTHDDVIGSRR+SFILYLPDP+ +WK
Sbjct: 121 EVYRDVISHVTGAGKLSGSKMDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPNTRWK 180

Query: 179 PQYGGGLRLFSSILPNIPETDPCAKFVPQFNEIAFFKVLPGFSFHDVEEVKVDKHRLSIQ 238
             YGGGLRLF SI+ N+P++D  AK +PQFN+IAFF+V PGFSFHDVEEV+V++HRLSIQ
Sbjct: 181 EHYGGGLRLFPSIVANVPQSDHSAKLIPQFNQIAFFQVQPGFSFHDVEEVRVNRHRLSIQ 240

Query: 239 GWYHFPQPGEPGYTPGQEEAWVKNNTSTLTQLETNVLQDFEYPKQERDILPYHQVKHFEK 298
           GWYH PQ GE GY PG+EE WVK NTSTL QLE+NVLQD+E+PK ERDILP HQ+KH+E 
Sbjct: 241 GWYHIPQEGEKGYIPGEEEEWVKTNTSTLAQLESNVLQDYEFPKGERDILPNHQIKHYEH 300

Query: 299 VLYAADGKKIDEDEVKSV-VQDTDSLSEKEYKYLSQYISAEHLTKEGIKKLQEQFLENST 357
           +L A    K +E     + + D   L++KE K+LS ++SAE+LT EGI KLQ++F++NS 
Sbjct: 301 LLEAQPANKEEESSSDELALPDLSFLTDKEMKFLSSFVSAEYLTPEGIAKLQKRFIDNSH 360

Query: 358 LQIKDFLNEEVSELLKKMIKTEELEKACPYMAKDVETPWQTAMPSHKWRYMYIDGKNPRK 417
           LQ+ DFL++E + LLK++IK +EL+K CPY + +VE PW+TAMP HKWRY+YIDGK+   
Sbjct: 361 LQVDDFLSDERANLLKQLIKRDELDKECPYESVNVEMPWKTAMPPHKWRYLYIDGKSHEN 420

Query: 418 LLKASDIMXXXXXXXXXXXXXXXXTLPKDGSVDVELKLIDLAIFYKSTIFKKYLALLTAL 477
                DI+                +L K    D E +LI +A F++ST FKKYLALLT L
Sbjct: 421 FTTEQDILDKLNNEERPNYVLLKQSLDK-KKYDTETELISVAEFFQSTAFKKYLALLTLL 479

Query: 478 CPLSEQILIRRFRPGNDFTLATQCRLNEFLQDVEGILPSILVGNLCLTPSSGWESGEVGG 537
            PLSEQ+LIRRFRPG DFTLATQ   N+ L  VEGI+ ++L G LCLTP++GWESGEVGG
Sbjct: 480 SPLSEQVLIRRFRPGKDFTLATQLNKNDLLGHVEGIVDAVLEGTLCLTPTNGWESGEVGG 539

Query: 538 YELYMMDDENTEEEERMHKDVEDASVYRTDDNGDSVLVNNPPSWNTFNLVLRDQSVLEFV 597
           YELYM   +N +E E M KD+EDA+VY+TDD GD+VL+N PPSWN+ NLVLRD+SVL+F+
Sbjct: 540 YELYM---DNQDESEDMDKDIEDAAVYKTDDAGDAVLINKPPSWNSLNLVLRDESVLQFI 596

Query: 598 KYVSCAAKSSRWDVKMEW 615
           KYVS +AKSSRWD+  +W
Sbjct: 597 KYVSWSAKSSRWDITAQW 614

>Scas_715.28*
          Length = 632

 Score =  751 bits (1939), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/626 (58%), Positives = 468/626 (74%), Gaps = 18/626 (2%)

Query: 1   MKRKAEAQENGNKQLD-LEEDKVKGLFNQKLWTPEFREGLKNQIDSSAPYNWGNISGLVN 59
           MKR +        ++  LE+DK+K LFN ++W P++++ L+++I +S P+NWG+I  L++
Sbjct: 1   MKRSSGDDSAAQAKMQTLEDDKLKALFNPRIWEPDYQKELRDEIANSKPFNWGSIPKLID 60

Query: 60  DDLLRAVRKEIETEIHFTKKETDIYKVNQSGDLANLSGLNWDDLSRLPNMYKLRQILYSD 119
           DDLLRAVRKEIETEIHF+KKETDIYKVNQSGDLANLS L+W+DLSRLPN++KLRQ+LYS+
Sbjct: 61  DDLLRAVRKEIETEIHFSKKETDIYKVNQSGDLANLSKLDWNDLSRLPNLFKLRQLLYSE 120

Query: 120 VYRDLIGYVTGAGKLSGSKMDMSVNTYTKGCHLLTHDDVIGSRRISFILYLPDPDRKWKP 179
            YRD   Y+T +G LSG K DMS+NTYTKGCHL+ HDDVIGSRRISFILYLPDPDRKWK 
Sbjct: 121 KYRDFFAYITQSGHLSGKKTDMSINTYTKGCHLVPHDDVIGSRRISFILYLPDPDRKWKS 180

Query: 180 QYGGGLRLFSSILPNIPETDPCAKFVPQFNEIAFFKVLPGFSFHDVEEVKVDKHRLSIQG 239
            YGGGLRL+ +I+PN+PE DPCAK VPQFN+IAFFKV PGFSFHDVEEVKVDKHRLSIQG
Sbjct: 181 HYGGGLRLYDTIMPNVPENDPCAKLVPQFNQIAFFKVNPGFSFHDVEEVKVDKHRLSIQG 240

Query: 240 WYHFPQPGEPGYTPGQEEAWVKNNTSTLTQLETNVLQDFEYPKQERDILPYHQVKHFEKV 299
           WYH PQ G+ GY P +E  ++  N + L +L++ VL+DFE+PK+ER++LP +Q+KHFEK+
Sbjct: 241 WYHIPQEGDKGYIPNEEATYIDKNITQLGELDSAVLEDFEFPKEERELLPNYQIKHFEKI 300

Query: 300 LYAADGKKIDEDEV-------KSVVQDTDSLSEKEYKYLSQYISAEHLTKEGIKKLQEQF 352
           L  ++    D   V       K +  +  SL+E+E  YLS+Y++ EHLTKEGI KLQE F
Sbjct: 301 LERSNSGDNDSSNVLSIPSGMKVIPSEIPSLTEEEVAYLSEYVALEHLTKEGISKLQESF 360

Query: 353 LENSTLQIKDFLNEEVSELLKKMIKTEELEKACPYMAKDVETPWQTAMPSHKWRYMYIDG 412
           LENS L I+ FLNEE S LL+  IK  ELEK CP  +KDV  PW+TAMPSHK +Y+YIDG
Sbjct: 361 LENSFLSIESFLNEEKSSLLENQIKRTELEKDCPLFSKDVAYPWKTAMPSHKCKYLYIDG 420

Query: 413 KNPRKLLKASDIMXXXXXXXXXXXXXXXXTLPKDGS--VDVELKLIDLAIFYKSTIFKKY 470
           K  + L  A D +                 L   G   +D E  LI+L+IF+KS IFKKY
Sbjct: 421 KKQQDLATA-DGLITTLNNDENSNFEMVKELVNIGKEDIDTEKSLIELSIFFKSLIFKKY 479

Query: 471 LALLTALCPLSEQILIRRFRPGNDFTLATQCRLN-EFLQDVEGILPSILVGNLCLTPSSG 529
           L LLT+LC ++EQ+LIRRFRPGNDFTLA +C++N ++L +V   L ++L          G
Sbjct: 480 LVLLTSLCLITEQVLIRRFRPGNDFTLANKCKMNTKYLNEV---LDNVLRRYFMFDSIKG 536

Query: 530 WESGEVGGYELYMMDDENTEEEERMHKDVEDASVYRTDDNGDSVLVNNPPSWNTFNLVLR 589
           WE+G+VGGYE+YMMD   T+E+     DVE A  Y+ D+NG+S+L+N+P SWNTFNLVLR
Sbjct: 537 WETGDVGGYEIYMMD--GTKEKAEDEDDVE-AERYKNDENGESILLNSPASWNTFNLVLR 593

Query: 590 DQSVLEFVKYVSCAAKSSRWDVKMEW 615
           D+SVLEFVKY+S  AKSSRWD+K++W
Sbjct: 594 DESVLEFVKYISWEAKSSRWDIKLKW 619

>ADL114C [1627] [Homologous to ScYER049W - SH] (484310..486154)
           [1845 bp, 614 aa]
          Length = 614

 Score =  750 bits (1937), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/619 (62%), Positives = 463/619 (74%), Gaps = 25/619 (4%)

Query: 1   MKRKAEAQEN-GNKQLDLEEDKVKGLFNQKLWTPEFREGLKNQIDSSAPYNWGNISGLVN 59
           MKR+A +Q    +KQ  LE +KVK  FN K+W   +RE L+ ++ S+ PYNWG I  LV+
Sbjct: 1   MKRRAPSQPVFESKQPFLEIEKVKASFNSKIWDDSYREQLREEVASNKPYNWGTIHDLVD 60

Query: 60  DDLLRAVRKEIETEIHFTKKETDIYKVNQSGDLANLSGLNWDDLSRLPNMYKLRQILYSD 119
            DLLR+VR+EIE EIHFT KETDIYKVNQSGDLANLSGL+W DLSRLP++ +LRQILYSD
Sbjct: 61  PDLLRSVRREIEKEIHFTNKETDIYKVNQSGDLANLSGLDWKDLSRLPSLCRLRQILYSD 120

Query: 120 VYRDLIGYVTGAGKLSGSKMDMSVNTYTKGCHLLTHDDVIGSRRISFILYLPDPDRKWKP 179
           VYRD IGYV GAGKLSG+KMDMS+NTYTKGCHLLTHDDVIGSRR+SFILYLPDPD+ WK 
Sbjct: 121 VYRDFIGYVAGAGKLSGTKMDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPDKTWKE 180

Query: 180 QYGGGLRLFSSILPNIPETDPCAKFVPQFNEIAFFKVLPGFSFHDVEEVKVDKHRLSIQG 239
            YGG LRLF SI+PN+P +D  AK VPQFN++AFF V PG+SFHDVEEVKVDKHRLSIQG
Sbjct: 181 HYGGALRLFPSIIPNVPTSDFSAKLVPQFNQLAFFHVHPGYSFHDVEEVKVDKHRLSIQG 240

Query: 240 WYHFPQPGEPGYTPGQEEAWVKNNTSTLTQLETNVLQDFEYPKQERDILPYHQVKHFEKV 299
           WYH PQ GE G+ PG+EE +V  N STL QLE+ +LQD+E+ K ER ILP  Q+K  EK 
Sbjct: 241 WYHIPQEGEEGFVPGEEEQYVNTNISTLAQLESILLQDYEFLKSERSILPLQQLKQLEKF 300

Query: 300 LYAADGKKIDEDEVKSVVQDTDSLSEKEYKYLSQYISAEHLTKEGIKKLQEQFLENSTLQ 359
           L +       E E  +   + D L+     YLS YIS EHL+ EGIK LQ +F ENS LQ
Sbjct: 301 LGS-------ESEDTAFYLNADELA-----YLSMYISEEHLSLEGIKSLQSKFTENSYLQ 348

Query: 360 IKDFLNEEVSELLKKMIKTEELEKACPYMAKDVETPWQTAMPSHKWRYMYIDGKNPRKLL 419
           I  FLNE+ S LLKK+IK EELEK CPY A +VE PW+TA+P +KWR+MYIDGK+     
Sbjct: 349 IDSFLNEQKSALLKKLIKIEELEKECPYKAAEVEKPWKTAIPPYKWRFMYIDGKSHEHFC 408

Query: 420 KASDIMXXXXXXXXXXXXXXXXTLPKDGSVD---VELKLIDLAIFYKSTIFKKYLALLTA 476
              DI                 TL K G  D   VE  L++L  F+KS  FKKYLALLT 
Sbjct: 409 SEDDI-----KRRLVHEELPNFTLLKQGLSDHLSVEPALLELVEFFKSFAFKKYLALLTL 463

Query: 477 LCPLSEQILIRRFRPGNDFTLATQCRLNEFLQDVEGILPSILVGNLCLTPSSGWESGEVG 536
           LCPL+EQ+LIRRFRPG+DFTLAT+   ++ LQ VEG + ++L G LCLTP+ GWESGE+G
Sbjct: 464 LCPLTEQLLIRRFRPGHDFTLATKIYPSQLLQHVEGFVDAVLEGVLCLTPTDGWESGELG 523

Query: 537 GYELYMMDDENTEEEERMHKDVEDASVYRTDDNGDSVLVNNPPSWNTFNLVLRDQSVLEF 596
           GYELYM D    +++E M+KDVEDA+VYR+DD+G SVL+N P SWN+FNLVLRD+SVL+F
Sbjct: 524 GYELYMGD----QDDEDMNKDVEDAAVYRSDDSGSSVLINKPASWNSFNLVLRDESVLQF 579

Query: 597 VKYVSCAAKSSRWDVKMEW 615
           VKYVS AAKSSRWD+ M W
Sbjct: 580 VKYVSWAAKSSRWDISMNW 598

>KLLA0E04411g 404611..406413 similar to sp|P40032 Saccharomyces
           cerevisiae YER049w singleton, start by similarity
          Length = 600

 Score =  681 bits (1756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/616 (55%), Positives = 435/616 (70%), Gaps = 30/616 (4%)

Query: 2   KRKAEAQENGN--KQLDLEEDKVKGLFNQKLWTPEFREGLKNQIDSSAPYNWGNISGLVN 59
           KR AE    G+  K   LE  K  G FN K+W   F++ L+ +I ++ PYNWG I  LV+
Sbjct: 7   KRPAEETALGSDEKVRLLESSKAVGSFNSKIWDKSFQDDLRQEIKNAQPYNWGTIRDLVD 66

Query: 60  DDLLRAVRKEIETEIHFTKKETDIYKVNQSGDLANLSGLNWDDLSRLPNMYKLRQILYSD 119
            +LL+ VR+EIET IHFT+KETDIYKVNQSGDLANLSGL+  DLS+LP++ KLR++LYS+
Sbjct: 67  PNLLQEVRREIETSIHFTQKETDIYKVNQSGDLANLSGLDDADLSKLPSLVKLRELLYSE 126

Query: 120 VYRDLIGYVTGAGKLSGSKMDMSVNTYTKGCHLLTHDDVIGSRRISFILYLPDPDRKWKP 179
            YRD I YVT +GKLSGSK D+S+NTYTKGCHLLTHDDVIGSRR+SFILYLP+P+R WK 
Sbjct: 127 KYRDFIAYVTQSGKLSGSKTDISINTYTKGCHLLTHDDVIGSRRVSFILYLPEPERVWKE 186

Query: 180 QYGGGLRLFSSILPNIPETDPCAKFVPQFNEIAFFKVLPGFSFHDVEEVKVDKHRLSIQG 239
            YGGGLRLF SI+PN+P +D  AK VPQFN+IAFFKV PGFSFHDVEEVKVDKHRLSIQG
Sbjct: 187 HYGGGLRLFPSIVPNVPFSDHSAKLVPQFNQIAFFKVQPGFSFHDVEEVKVDKHRLSIQG 246

Query: 240 WYHFPQPGEPGYTPGQEEAWVKNNTSTLTQLETNVLQDFEYPKQERDILPYHQVKHFEKV 299
           WYH PQ GEPGYTPG+EE W+K N STL+QL  + LQD+E+PK +R  L      H+E  
Sbjct: 247 WYHIPQEGEPGYTPGEEEEWIKTNISTLSQLVNSPLQDYEFPKIDRTPL-----SHYE-- 299

Query: 300 LYAADGKKIDEDEVKSVVQDTDSLSEKEYKYLSQYISAEHLTKEGIKKLQEQFLENSTLQ 359
                  K+D  +        D L+E +  +LS++++ EHLT E ++K+ ++F+E+S + 
Sbjct: 300 -----SGKLDRTD--------DLLTEDDITFLSKFLNPEHLTTESMRKISDKFVEDSFIN 346

Query: 360 IKDFLNEEVSELLKKMIKTEELEKACPYMAKDVETPWQTAMPSHKWRYMYIDGKNPRKLL 419
           I+ FLN+E S LLKK+I  +E    CPY + +V  PW+T++P HKWRY+YIDGK+     
Sbjct: 347 IESFLNDEYSSLLKKLIMDKEFNYDCPYESVNVRHPWKTSLPPHKWRYLYIDGKSYTNFR 406

Query: 420 KASDIMXXXXXXXXXXXXXXXXTLPKDGSVDVELKLIDLAIFYKSTIFKKYLALLTALCP 479
              DI                 +       + E KL +LAIF +S  FKK++  LT L  
Sbjct: 407 NEEDIKKALNNPELPNFHQLLSSFADKEEFNCEAKLCELAIFLQSISFKKWIVQLTKLVI 466

Query: 480 LSEQILIRRFRPGNDFTLATQCRLNEFLQDVEGILPSILVGNLCLTPSSGWESGEVGGYE 539
           LSEQ+LIRRFRPG DFTLAT   +NE L+ + G + +IL   LCLTPS GW+SGEVGGYE
Sbjct: 467 LSEQLLIRRFRPGKDFTLATTTEVNELLKTIPGFVEAILECTLCLTPSKGWDSGEVGGYE 526

Query: 540 LYMMDDENTEEEERMHKDVEDASVYRTDDNGDSVLVNNPPSWNTFNLVLRDQSVLEFVKY 599
           LYM +        +   + +DA++YR DD+GDSVL+N P SWN+ NLVLRD++VL+F+KY
Sbjct: 527 LYMNN--------QDDDEDDDAAIYRADDDGDSVLINKPASWNSLNLVLRDENVLQFIKY 578

Query: 600 VSCAAKSSRWDVKMEW 615
           VS AAKSSRWD+ ++W
Sbjct: 579 VSWAAKSSRWDISLQW 594

>CAGL0B00924g complement(81492..82808) similar to sp|P11709
           Saccharomyces cerevisiae YCL029c BIK1 nuclear fusion
           protein, hypothetical start
          Length = 438

 Score = 32.7 bits (73), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 78/147 (53%), Gaps = 15/147 (10%)

Query: 252 TPGQEEAWVKNNTSTLTQLETNVLQDFEY--PKQERDILPYHQVKHFEKVLYAADGKKID 309
           TP Q E    ++ ++ +Q E+ +++D+E    KQER+IL Y ++   ++++       ID
Sbjct: 155 TPTQGERMDIDSRASDSQTES-IIKDYELRIEKQEREILQYRKLLEDQRIVLEEIQPTID 213

Query: 310 EDE-----VKSVVQDTDS-LSEKEYKYLSQ--YISAEHLTKEG-IKKLQEQFLENSTLQI 360
           E E     ++S VQ+ ++ L ++  K+ SQ  +  AEH      + +LQ    EN    I
Sbjct: 214 EYENNERRLRSRVQELETELDKQREKFKSQKEFFEAEHEQLLAVVSQLQVAIEENEQKAI 273

Query: 361 --KDFLNEEVSELLKKMIK-TEELEKA 384
             K+ L E+ +E+ K +   T+E E+A
Sbjct: 274 SRKESLREDTTEITKTIQDLTDEHERA 300

>AGL305W [4007] [Homologous to ScYJR091C (JSN1) - SH; ScYPR042C
           (PUF2) - SH] complement(128699..131872) [3174 bp, 1057
           aa]
          Length = 1057

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 43/88 (48%), Gaps = 11/88 (12%)

Query: 317 VQDTDSLSEKEYKYLSQY-------ISAEHLTKEGIKKLQEQFLENSTLQIKDFLNEEVS 369
           + DTD++S+ E + L+         +S+++L    ++KL     ENS+  IKD +  + S
Sbjct: 610 LMDTDNVSDLEIEQLAVAMLDELPELSSDYLGNTIVQKL----FENSSTIIKDIMLRQTS 665

Query: 370 ELLKKMIKTEELEKACPYMAKDVETPWQ 397
           + L  M   +    AC  M    +TP Q
Sbjct: 666 KYLTSMGVHKNGTWACQKMTTMADTPRQ 693

>AGR086C [4396] [Homologous to ScYDR110W (FOB1) - SH]
           (888764..890368) [1605 bp, 534 aa]
          Length = 534

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%)

Query: 109 MYKLRQILYSDVYRDLIGYVTGAGKLSGSKMDMSVNTYTKGCHLLTHDDVIGSRRISFIL 168
           +Y+  + LY++V R+L   VTG    S   MD SV  +++  H   H+ ++   R    +
Sbjct: 151 VYQHMKGLYANVTRELTNMVTGY--CSHCNMDRSVRRFSRYKHYNVHEKLMPLERCHVEV 208

Query: 169 YLP 171
           + P
Sbjct: 209 FAP 211

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.135    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 21,840,220
Number of extensions: 1035396
Number of successful extensions: 3863
Number of sequences better than 10.0: 48
Number of HSP's gapped: 4001
Number of HSP's successfully gapped: 48
Length of query: 615
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 507
Effective length of database: 12,857,365
Effective search space: 6518684055
Effective search space used: 6518684055
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)