Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0J02794g103794111e-53
Kwal_47.1814299762824e-34
YER048W-A94772591e-30
KLLA0E04389g91772538e-30
Sklu_2174.593772303e-26
ADL113C108772166e-24
Scas_715.28d95772122e-23
CAGL0F04653g29241750.014
Scas_696.30*29254650.36
Scas_587.1122955573.8
AGL254W43154566.5
Sklu_1532.141177559.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J02794g
         (102 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J02794g 272273..272584 similar to gi|6320889|sgd|S0007237 S...   162   1e-53
Kwal_47.18142                                                         113   4e-34
YER048W-A (YER048W-A) [1476] chr5 (250717..251001) Protein of un...   104   1e-30
KLLA0E04389g 403312..403587 similar to sgd|S0007237 Saccharomyce...   102   8e-30
Sklu_2174.5 YER048W-A, Contig c2174 5568-5849 reverse complement       93   3e-26
ADL113C [1628] [Homologous to ScYER048W-A - SH] (486497..486823)...    88   6e-24
Scas_715.28d                                                           86   2e-23
CAGL0F04653g complement(470517..471395) highly similar to sp|P32...    33   0.014
Scas_696.30*                                                           30   0.36 
Scas_587.11                                                            27   3.8  
AGL254W [4058] [Homologous to ScYDR255C - SH] complement(226535....    26   6.5  
Sklu_1532.1 YGR149W, Contig c1532 124-1359 reverse complement          26   9.0  

>CAGL0J02794g 272273..272584 similar to gi|6320889|sgd|S0007237
          Saccharomyces cerevisiae YER048wa, hypothetical start
          Length = 103

 Score =  162 bits (411), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%)

Query: 1  MVARQQVLQLYKQIIKNANQFSNYNFREYFLRKARTEFKANKALTDAAKIESLFQGAQRD 60
          MVARQQVLQLYKQIIKNANQFSNYNFREYFLRKARTEFKANKALTDAAKIESLFQGAQRD
Sbjct: 1  MVARQQVLQLYKQIIKNANQFSNYNFREYFLRKARTEFKANKALTDAAKIESLFQGAQRD 60

Query: 61 LGVLKRQSIISQMYTFDKL 79
          LGVLKRQSIISQMYTFDKL
Sbjct: 61 LGVLKRQSIISQMYTFDKL 79

>Kwal_47.18142
          Length = 99

 Score =  113 bits (282), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 63/76 (82%)

Query: 3  ARQQVLQLYKQIIKNANQFSNYNFREYFLRKARTEFKANKALTDAAKIESLFQGAQRDLG 62
           R QVL LYKQ IKNAN F+NYN+REYFLRKART F+ +K LTD A +E+ ++ A ++LG
Sbjct: 8  TRAQVLALYKQFIKNANGFNNYNYREYFLRKARTTFREHKTLTDPASVETAWEIANKELG 67

Query: 63 VLKRQSIISQMYTFDK 78
          VLKRQS+ISQMYTFDK
Sbjct: 68 VLKRQSVISQMYTFDK 83

>YER048W-A (YER048W-A) [1476] chr5 (250717..251001) Protein of
          unknown function [285 bp, 94 aa]
          Length = 94

 Score =  104 bits (259), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 50/77 (64%), Positives = 60/77 (77%)

Query: 3  ARQQVLQLYKQIIKNANQFSNYNFREYFLRKARTEFKANKALTDAAKIESLFQGAQRDLG 62
           R+QVL LYK+ IKNANQF+NYNFREYFL K RT F+ N    D   + +LF+ A+ DLG
Sbjct: 8  TRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLG 67

Query: 63 VLKRQSIISQMYTFDKL 79
          VLKRQS+ISQMYTFD+L
Sbjct: 68 VLKRQSVISQMYTFDRL 84

>KLLA0E04389g 403312..403587 similar to sgd|S0007237 Saccharomyces
          cerevisiae YER048wa, start by similarity
          Length = 91

 Score =  102 bits (253), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 60/77 (77%)

Query: 3  ARQQVLQLYKQIIKNANQFSNYNFREYFLRKARTEFKANKALTDAAKIESLFQGAQRDLG 62
          ++ Q+L +YK+ I+NA++  NYNFREYFLR+AR  F+ANK + +  KI  L   A++DLG
Sbjct: 7  SKTQILHMYKEFIRNASKIQNYNFREYFLRRARESFRANKNVENPEKISELLSEAEKDLG 66

Query: 63 VLKRQSIISQMYTFDKL 79
          VLKRQS+IS MYTFDKL
Sbjct: 67 VLKRQSVISNMYTFDKL 83

>Sklu_2174.5 YER048W-A, Contig c2174 5568-5849 reverse complement
          Length = 93

 Score = 93.2 bits (230), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 53/77 (68%), Positives = 64/77 (83%)

Query: 3  ARQQVLQLYKQIIKNANQFSNYNFREYFLRKARTEFKANKALTDAAKIESLFQGAQRDLG 62
           R QVL LY+Q +KNAN F+NYNFREYFLRKART FK +K L D+ K+ + ++ AQR+LG
Sbjct: 7  TRPQVLALYRQFVKNANNFNNYNFREYFLRKARTTFKESKQLQDSTKVNAAWEEAQRELG 66

Query: 63 VLKRQSIISQMYTFDKL 79
          VLKRQS+ISQMYTFDKL
Sbjct: 67 VLKRQSVISQMYTFDKL 83

>ADL113C [1628] [Homologous to ScYER048W-A - SH] (486497..486823)
           [327 bp, 108 aa]
          Length = 108

 Score = 87.8 bits (216), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 39/77 (50%), Positives = 59/77 (76%), Gaps = 1/77 (1%)

Query: 3   ARQQVLQLYKQIIKNANQFSNYNFREYFLRKARTEFKANKALTDAAKIESLFQGAQRDLG 62
            R  VL LY++ +++A QF+NYNFREYF+R +R  F+ ++      +++ L++ AQ+++G
Sbjct: 26  TRAGVLHLYREFVRSARQFNNYNFREYFMRHSRDTFRKHRE-ASGEELQQLWERAQQEVG 84

Query: 63  VLKRQSIISQMYTFDKL 79
           VLKRQS+ISQMYTFDKL
Sbjct: 85  VLKRQSVISQMYTFDKL 101

>Scas_715.28d
          Length = 95

 Score = 86.3 bits (212), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 50/77 (64%), Positives = 62/77 (80%)

Query: 3  ARQQVLQLYKQIIKNANQFSNYNFREYFLRKARTEFKANKALTDAAKIESLFQGAQRDLG 62
          +R QVL LYKQ I+N+NQF+N+NFREYFLR +R +FK N  + D  K+  L++ AQRDLG
Sbjct: 6  SRLQVLSLYKQFIRNSNQFNNFNFREYFLRISREKFKENAPIQDKEKVAKLYEAAQRDLG 65

Query: 63 VLKRQSIISQMYTFDKL 79
          VLKRQ +ISQMYTFDKL
Sbjct: 66 VLKRQKLISQMYTFDKL 82

>CAGL0F04653g complement(470517..471395) highly similar to sp|P32602
           Saccharomyces cerevisiae YBL050w SEC17 transport vesicle
           fusion protein, start by similarity
          Length = 292

 Score = 33.5 bits (75), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 26/41 (63%), Gaps = 2/41 (4%)

Query: 6   QVLQLYKQIIKNA--NQFSNYNFREYFLRKARTEFKANKAL 44
           +   LY ++IKN+  N+ S ++ +EYFL+K  T+  AN  +
Sbjct: 176 EASDLYTKLIKNSLGNRLSQWSLKEYFLKKGLTQLAANDTV 216

>Scas_696.30*
          Length = 292

 Score = 29.6 bits (65), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 6/54 (11%)

Query: 9   QLYKQIIKNA--NQFSNYNFREYFLRKARTEFKANKALTDAAKIESLFQGAQRD 60
            LY ++IKN+  N+ S ++ +EY+L+K   +  A    TD        Q  Q D
Sbjct: 179 DLYSKLIKNSIGNRLSEWSLKEYYLKKGLCQLAA----TDNVAATRTLQEGQHD 228

>Scas_587.11
          Length = 229

 Score = 26.6 bits (57), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 13/55 (23%), Positives = 29/55 (52%)

Query: 5   QQVLQLYKQIIKNANQFSNYNFREYFLRKARTEFKANKALTDAAKIESLFQGAQR 59
           Q+ L++  Q  KN    +   F  Y +RK + E +    LT++++++ + Q  ++
Sbjct: 65  QEGLEIEIQTFKNDTDEARTKFESYQIRKRQLEMQHTALLTESSELDGMLQEKEK 119

>AGL254W [4058] [Homologous to ScYDR255C - SH]
           complement(226535..227830) [1296 bp, 431 aa]
          Length = 431

 Score = 26.2 bits (56), Expect = 6.5,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 12/54 (22%)

Query: 12  KQIIKNANQFSNYNF------------REYFLRKARTEFKANKALTDAAKIESL 53
           KQ++   ++   YN+            R+Y +R+      AN A+ DAAK ESL
Sbjct: 234 KQLLLEGDRLLTYNYVMNNIPGLMLQTRKYGIRRDIGTLLANIAVGDAAKFESL 287

>Sklu_1532.1 YGR149W, Contig c1532 124-1359 reverse complement
          Length = 411

 Score = 25.8 bits (55), Expect = 9.0,   Method: Composition-based stats.
 Identities = 18/77 (23%), Positives = 36/77 (46%), Gaps = 1/77 (1%)

Query: 2  VARQQVLQLYKQIIKNANQFSNYNFREYFLRKARTEFKANKALTDAAKIESLFQGAQRDL 61
          V    +L+L   I      +S     + +L  AR +FK+++      K++S  Q     L
Sbjct: 18 VTLSNILELLDPISSTVQSYSIAEQPKKYLSNARRKFKSSRTHQKLTKLKSSAQDFSPQL 77

Query: 62 GVLKRQSIISQMYTFDK 78
             KR++++ ++ + DK
Sbjct: 78 EEFKRKTLL-KLQSIDK 93

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.323    0.133    0.354 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,098,513
Number of extensions: 61606
Number of successful extensions: 291
Number of sequences better than 10.0: 15
Number of HSP's gapped: 290
Number of HSP's successfully gapped: 15
Length of query: 102
Length of database: 16,596,109
Length adjustment: 73
Effective length of query: 29
Effective length of database: 14,068,995
Effective search space: 408000855
Effective search space used: 408000855
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 54 (25.4 bits)