Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0J01848g1202118464110.0
YPR010C (RPA135)1203118758620.0
Scas_707.471200118558410.0
Kwal_14.14921197118456490.0
KLLA0B06303g1203118956390.0
ABR029W1198118553340.0
Scas_70.125923510391e-132
Kwal_26.85531171104610201e-119
Scas_605.141150105210071e-117
YOR207C (RET1)1149103710021e-116
ADL275C1141104310001e-116
CAGL0L02849g113310399991e-116
KLLA0F01078g114210409921e-115
Kwal_47.18783122011479601e-110
YOR151C (RPB2)122411539451e-108
AFR404C122211449341e-106
CAGL0L04246g122311559311e-106
Scas_714.41122411559241e-105
KLLA0B05577g12214807583e-83
CAGL0J07942g1244106810.29
AFL133C31881750.96
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J01848g
         (1184 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J01848g 177319..180927 highly similar to sp|P22138 Saccharo...  2474   0.0  
YPR010C (RPA135) [5446] chr16 complement(577580..581191) RNA pol...  2262   0.0  
Scas_707.47                                                          2254   0.0  
Kwal_14.1492                                                         2180   0.0  
KLLA0B06303g complement(555780..559391) highly similar to sp|P22...  2176   0.0  
ABR029W [620] [Homologous to ScYPR010C (RPA135) - SH] complement...  2059   0.0  
Scas_70.1                                                             404   e-132
Kwal_26.8553                                                          397   e-119
Scas_605.14                                                           392   e-117
YOR207C (RET1) [5000] chr15 complement(730008..733457) RNA polym...   390   e-116
ADL275C [1466] [Homologous to ScYOR207C (RET1) - SH] (219105..22...   389   e-116
CAGL0L02849g 332195..335596 highly similar to sp|P22276 Saccharo...   389   e-116
KLLA0F01078g 98331..101759 highly similar to sp|P22276 Saccharom...   386   e-115
Kwal_47.18783                                                         374   e-110
YOR151C (RPB2) [4950] chr15 complement(612997..616671) RNA polym...   368   e-108
AFR404C [3596] [Homologous to ScYOR151C (RPB2) - SH] (1162949..1...   364   e-106
CAGL0L04246g complement(493026..496697) highly similar to sp|P08...   363   e-106
Scas_714.41                                                           360   e-105
KLLA0B05577g complement(501690..505355) highly similar to sp|P08...   296   3e-83
CAGL0J07942g 772758..776492 similar to sp|P38717 Saccharomyces c...    36   0.29 
AFL133C [3062] [Homologous to ScYPL227C (ALG5) - SH] (182740..18...    33   0.96 

>CAGL0J01848g 177319..180927 highly similar to sp|P22138 Saccharomyces
            cerevisiae YPR010c RPA135, start by similarity
          Length = 1202

 Score = 2474 bits (6411), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1184/1184 (100%), Positives = 1184/1184 (100%)

Query: 1    MSKVIKPPSNARTAHFRTLERENRFKNPPKDKSAYPLLQEAVQPHVGSFNALTEGPDGGL 60
            MSKVIKPPSNARTAHFRTLERENRFKNPPKDKSAYPLLQEAVQPHVGSFNALTEGPDGGL
Sbjct: 1    MSKVIKPPSNARTAHFRTLERENRFKNPPKDKSAYPLLQEAVQPHVGSFNALTEGPDGGL 60

Query: 61   LQRAVEDIGEKVIFDGKSDGSDEISDYLGNKLSISVEQVSIAKPTANDGVMGAAERPVYP 120
            LQRAVEDIGEKVIFDGKSDGSDEISDYLGNKLSISVEQVSIAKPTANDGVMGAAERPVYP
Sbjct: 61   LQRAVEDIGEKVIFDGKSDGSDEISDYLGNKLSISVEQVSIAKPTANDGVMGAAERPVYP 120

Query: 121  SEARQRLTSYRGKILLKLKWSVNDGENVFSEVRDCGGLPIMLQSNRCHLNKMSPHELVQH 180
            SEARQRLTSYRGKILLKLKWSVNDGENVFSEVRDCGGLPIMLQSNRCHLNKMSPHELVQH
Sbjct: 121  SEARQRLTSYRGKILLKLKWSVNDGENVFSEVRDCGGLPIMLQSNRCHLNKMSPHELVQH 180

Query: 181  KEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRSVRPDQ 240
            KEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRSVRPDQ
Sbjct: 181  KEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRSVRPDQ 240

Query: 241  TSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMIMKALVDTSDREIFDGIIGSNTNNSFLT 300
            TSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMIMKALVDTSDREIFDGIIGSNTNNSFLT
Sbjct: 241  TSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMIMKALVDTSDREIFDGIIGSNTNNSFLT 300

Query: 301  DRLELLLRGFKKRYPQLKNRTQVLQYLGDKFRLVFQASPDKSDYEVGQEVLNRIVLVHLG 360
            DRLELLLRGFKKRYPQLKNRTQVLQYLGDKFRLVFQASPDKSDYEVGQEVLNRIVLVHLG
Sbjct: 301  DRLELLLRGFKKRYPQLKNRTQVLQYLGDKFRLVFQASPDKSDYEVGQEVLNRIVLVHLG 360

Query: 361  SNGNMDKFRMLLFMVRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMILKEKIDEYLQG 420
            SNGNMDKFRMLLFMVRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMILKEKIDEYLQG
Sbjct: 361  SNGNMDKFRMLLFMVRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMILKEKIDEYLQG 420

Query: 421  IVAQVRTDINRGVAINFNEKKYMSRVLMRVNDNIGSKMQYFLSTGNLVSQSGLDLQQVSG 480
            IVAQVRTDINRGVAINFNEKKYMSRVLMRVNDNIGSKMQYFLSTGNLVSQSGLDLQQVSG
Sbjct: 421  IVAQVRTDINRGVAINFNEKKYMSRVLMRVNDNIGSKMQYFLSTGNLVSQSGLDLQQVSG 480

Query: 481  YTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLN 540
            YTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLN
Sbjct: 481  YTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLN 540

Query: 541  HFAHKCRISTTQSDVSKVPELLYSLGVTPASHTFAAGPSLCCVQLDGKIIGWTSHEQGRV 600
            HFAHKCRISTTQSDVSKVPELLYSLGVTPASHTFAAGPSLCCVQLDGKIIGWTSHEQGRV
Sbjct: 541  HFAHKCRISTTQSDVSKVPELLYSLGVTPASHTFAAGPSLCCVQLDGKIIGWTSHEQGRV 600

Query: 601  IADTLRFWKVEGETPGLPKDLEIGYVPPSSKGQYPGLYIFGGHSRMMRPVRYLPLDKEDI 660
            IADTLRFWKVEGETPGLPKDLEIGYVPPSSKGQYPGLYIFGGHSRMMRPVRYLPLDKEDI
Sbjct: 601  IADTLRFWKVEGETPGLPKDLEIGYVPPSSKGQYPGLYIFGGHSRMMRPVRYLPLDKEDI 660

Query: 661  VGPFEQVYMNIAVTPQEIQNNIHTHVEFSPTNILSILANLTPFSDFNQSPRNMYQCQMGK 720
            VGPFEQVYMNIAVTPQEIQNNIHTHVEFSPTNILSILANLTPFSDFNQSPRNMYQCQMGK
Sbjct: 661  VGPFEQVYMNIAVTPQEIQNNIHTHVEFSPTNILSILANLTPFSDFNQSPRNMYQCQMGK 720

Query: 721  QTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYDM 780
            QTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYDM
Sbjct: 721  QTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYDM 780

Query: 781  DDAMIINKSADERGFGYGTMYKVEKVDLSLNRSRGDPVTQHFGFGTDEWPKEWLDKLDED 840
            DDAMIINKSADERGFGYGTMYKVEKVDLSLNRSRGDPVTQHFGFGTDEWPKEWLDKLDED
Sbjct: 781  DDAMIINKSADERGFGYGTMYKVEKVDLSLNRSRGDPVTQHFGFGTDEWPKEWLDKLDED 840

Query: 841  GLPYIGTYVEEGDPICAYFDDTIGKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQTVSI 900
            GLPYIGTYVEEGDPICAYFDDTIGKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQTVSI
Sbjct: 841  GLPYIGTYVEEGDPICAYFDDTIGKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQTVSI 900

Query: 901  KYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRMTIGMF 960
            KYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRMTIGMF
Sbjct: 901  KYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRMTIGMF 960

Query: 961  VESLAGKAGALHGIAQDSTPWIFNEQDTPADYFGEQLLKAGYNYHGNEPMYSGATGEELR 1020
            VESLAGKAGALHGIAQDSTPWIFNEQDTPADYFGEQLLKAGYNYHGNEPMYSGATGEELR
Sbjct: 961  VESLAGKAGALHGIAQDSTPWIFNEQDTPADYFGEQLLKAGYNYHGNEPMYSGATGEELR 1020

Query: 1021 CDIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHG 1080
            CDIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHG
Sbjct: 1021 CDIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHG 1080

Query: 1081 TSFLLQDRLLNSSDYTQAAICRECGSILTTQQTVPRIGAVSSVCCRRCAVKFEDAKKTLF 1140
            TSFLLQDRLLNSSDYTQAAICRECGSILTTQQTVPRIGAVSSVCCRRCAVKFEDAKKTLF
Sbjct: 1081 TSFLLQDRLLNSSDYTQAAICRECGSILTTQQTVPRIGAVSSVCCRRCAVKFEDAKKTLF 1140

Query: 1141 EHEEKTEEKIFIDDSQIWEDGQGQKFVGGNDTTTVAIPFVLKYL 1184
            EHEEKTEEKIFIDDSQIWEDGQGQKFVGGNDTTTVAIPFVLKYL
Sbjct: 1141 EHEEKTEEKIFIDDSQIWEDGQGQKFVGGNDTTTVAIPFVLKYL 1184

>YPR010C (RPA135) [5446] chr16 complement(577580..581191) RNA
            polymerase I second largest subunit [3612 bp, 1203 aa]
          Length = 1203

 Score = 2262 bits (5862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1068/1187 (89%), Positives = 1133/1187 (95%), Gaps = 5/1187 (0%)

Query: 1    MSKVIKPPSNARTAHFRTLERENRFKNPPKDKSAYPLLQEAVQPHVGSFNALTEGPDGGL 60
            MSKVIKPP  ARTA FRTLERE+RF NPPKDKSA+PLLQEAVQPH+GSFNALTEGPDGGL
Sbjct: 1    MSKVIKPPGQARTADFRTLERESRFINPPKDKSAFPLLQEAVQPHIGSFNALTEGPDGGL 60

Query: 61   LQRAVEDIGEKVIFDGKS-DGSDEISD--YLGNKLSISVEQVSIAKPTANDGVMGAAERP 117
            L   V+DIGEKVIFDGK  +  DEIS+  YLGNKLS+SVEQVSIAKP +NDGV  A ER 
Sbjct: 61   LNLGVKDIGEKVIFDGKPLNSEDEISNSGYLGNKLSVSVEQVSIAKPMSNDGVSSAVERK 120

Query: 118  VYPSEARQRLTSYRGKILLKLKWSVNDGENVFSEVRDCGGLPIMLQSNRCHLNKMSPHEL 177
            VYPSE+RQRLTSYRGK+LLKLKWSVN+GE    EVRDCGGLP+MLQSNRCHLNKMSP+EL
Sbjct: 121  VYPSESRQRLTSYRGKLLLKLKWSVNNGEENLFEVRDCGGLPVMLQSNRCHLNKMSPYEL 180

Query: 178  VQHKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRSVR 237
            VQHKEESDE+GGYFI+NGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYS YGIQIRSVR
Sbjct: 181  VQHKEESDEIGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSHYGIQIRSVR 240

Query: 238  PDQTSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMIMKALVDTSDREIFDGIIGSNTNNS 297
            PDQTSQTNVLHYLNDGQVTFRFSWRKNEYL+PVVMI+KAL  TSDREIFDGIIG++  +S
Sbjct: 241  PDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCHTSDREIFDGIIGNDVKDS 300

Query: 298  FLTDRLELLLRGFKKRYPQLKNRTQVLQYLGDKFRLVFQASPDKSDYEVGQEVLNRIVLV 357
            FLTDRLELLLRGFKKRYP L+NRTQVLQYLGDKFR+VFQASPD+SD EVGQEVL+RIVLV
Sbjct: 301  FLTDRLELLLRGFKKRYPHLQNRTQVLQYLGDKFRVVFQASPDQSDLEVGQEVLDRIVLV 360

Query: 358  HLGSNGNMDKFRMLLFMVRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMILKEKIDEY 417
            HLG +G+ DKFRMLLFM+RKLYSLVAGEC PDNPDATQHQEVLLGGFLYGMILKEKIDEY
Sbjct: 361  HLGKDGSQDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMILKEKIDEY 420

Query: 418  LQGIVAQVRTDINRGVAINFNEKKYMSRVLMRVNDNIGSKMQYFLSTGNLVSQSGLDLQQ 477
            LQ I+AQVR DINRG+AINF +K+YMSRVLMRVN+NIGSKMQYFLSTGNLVSQSGLDLQQ
Sbjct: 421  LQNIIAQVRMDINRGMAINFKDKRYMSRVLMRVNENIGSKMQYFLSTGNLVSQSGLDLQQ 480

Query: 478  VSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCG 537
            VSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCG
Sbjct: 481  VSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCG 540

Query: 538  LLNHFAHKCRISTTQSDVSKVPELLYSLGVTPASHTFAAGPSLCCVQLDGKIIGWTSHEQ 597
            LLNHFAHKCRIST QSDVS++P +LYSLGV PASHTFAAGPSLCCVQ+DGKIIGW SHEQ
Sbjct: 541  LLNHFAHKCRISTQQSDVSRIPSILYSLGVAPASHTFAAGPSLCCVQIDGKIIGWVSHEQ 600

Query: 598  GRVIADTLRFWKVEGETPGLPKDLEIGYVPPSSKGQYPGLYIFGGHSRMMRPVRYLPLDK 657
            G++IADTLR+WKVEG+TPGLP DLEIGYVPPS++GQYPGLY+FGGHSRM+RPVRYLPLDK
Sbjct: 601  GKIIADTLRYWKVEGKTPGLPIDLEIGYVPPSTRGQYPGLYLFGGHSRMLRPVRYLPLDK 660

Query: 658  EDIVGPFEQVYMNIAVTPQEIQNNIHTHVEFSPTNILSILANLTPFSDFNQSPRNMYQCQ 717
            EDIVGPFEQVYMNIAVTPQEIQNN+HTHVEF+PTNILSILANLTPFSDFNQSPRNMYQCQ
Sbjct: 661  EDIVGPFEQVYMNIAVTPQEIQNNVHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQ 720

Query: 718  MGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTG 777
            MGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNG NAVVAVISYTG
Sbjct: 721  MGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGFNAVVAVISYTG 780

Query: 778  YDMDDAMIINKSADERGFGYGTMYKVEKVDLSLNRSRGDPVTQHFGFGTDEWPKEWLDKL 837
            YDMDDAMIINKSADERGFGYGTMYK EKVDL+LNR+RGDP+TQHFGFG DEWPKEWL+KL
Sbjct: 781  YDMDDAMIINKSADERGFGYGTMYKTEKVDLALNRNRGDPITQHFGFGNDEWPKEWLEKL 840

Query: 838  DEDGLPYIGTYVEEGDPICAYFDDTIGKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQT 897
            DEDGLPYIGTYVEEGDPICAYFDDT+ KTKIKTYHSSEPAYIEEVNLIGDESNKFQELQT
Sbjct: 841  DEDGLPYIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQT 900

Query: 898  VSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRMTI 957
            VSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPD+IINPHAFPSRMTI
Sbjct: 901  VSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDIIINPHAFPSRMTI 960

Query: 958  GMFVESLAGKAGALHGIAQDSTPWIFNEQDTPADYFGEQLLKAGYNYHGNEPMYSGATGE 1017
            GMFVESLAGKAGALHGIAQDSTPWIFNE DTPADYFGEQL KAGYNYHGNEPMYSGATGE
Sbjct: 961  GMFVESLAGKAGALHGIAQDSTPWIFNEDDTPADYFGEQLAKAGYNYHGNEPMYSGATGE 1020

Query: 1018 ELRCDIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALI 1077
            ELR DIY+GVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALI
Sbjct: 1021 ELRADIYVGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALI 1080

Query: 1078 GHGTSFLLQDRLLNSSDYTQAAICRECGSILTTQQTVPRIGAVSSVCCRRCAVKFEDAKK 1137
            GHGTSFLLQDRLLNSSDYTQA++CRECGSILTTQQ+VPRIG++S+VCCRRC+++FEDAKK
Sbjct: 1081 GHGTSFLLQDRLLNSSDYTQASVCRECGSILTTQQSVPRIGSISTVCCRRCSMRFEDAKK 1140

Query: 1138 TLFEHEEKTEEKIFIDDSQIWEDGQGQKFVGGNDTTTVAIPFVLKYL 1184
             L + E+   EKIFIDDSQIWEDGQG KFVGGN+TTTVAIPFVLKYL
Sbjct: 1141 LLTKSEDG--EKIFIDDSQIWEDGQGNKFVGGNETTTVAIPFVLKYL 1185

>Scas_707.47
          Length = 1200

 Score = 2254 bits (5841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1057/1185 (89%), Positives = 1131/1185 (95%), Gaps = 3/1185 (0%)

Query: 1    MSKVIKPPSNARTAHFRTLERENRFKNPPKDKSAYPLLQEAVQPHVGSFNALTEGPDGGL 60
            MSKVIKPPSNARTAHFRTLERE+RF NPPKDKSAYPLLQEAV+PHVGSFNALTEGPDGGL
Sbjct: 1    MSKVIKPPSNARTAHFRTLERESRFINPPKDKSAYPLLQEAVEPHVGSFNALTEGPDGGL 60

Query: 61   LQRAVEDIGEKVIFDGKSDGSDEISD-YLGNKLSISVEQVSIAKPTANDGVMGAAERPVY 119
            L + V+DIGEKVIFDGK+       D YLGNKLSISVEQVSIAKPT+NDGV  A ER V+
Sbjct: 61   LNQGVKDIGEKVIFDGKTGAVQTGKDSYLGNKLSISVEQVSIAKPTSNDGVSSAVERKVF 120

Query: 120  PSEARQRLTSYRGKILLKLKWSVNDGENVFSEVRDCGGLPIMLQSNRCHLNKMSPHELVQ 179
            PSE+RQRL SY+GK++LKLKWSVNDGE  F+EVRDCGGLP+MLQSNRCHLNK+SP+ELVQ
Sbjct: 121  PSESRQRLVSYKGKLMLKLKWSVNDGEETFTEVRDCGGLPVMLQSNRCHLNKLSPYELVQ 180

Query: 180  HKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRSVRPD 239
            HKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSF NRGA+Y+Q+GIQ+RSVRPD
Sbjct: 181  HKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFTNRGAAYTQFGIQLRSVRPD 240

Query: 240  QTSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMIMKALVDTSDREIFDGIIGSNTNNSFL 299
            QTSQTNVLHYLNDGQVTFRFSWRKNEYL+PVVMI+KAL DTSDREIFDGIIGS+ ++SFL
Sbjct: 241  QTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCDTSDREIFDGIIGSDLHDSFL 300

Query: 300  TDRLELLLRGFKKRYPQLKNRTQVLQYLGDKFRLVFQASPDKSDYEVGQEVLNRIVLVHL 359
            TDRLELLLRGFKKRYP L+NRTQVLQ+LGDKFR+VFQASPDKSDYEVGQEVL+RIVLVHL
Sbjct: 301  TDRLELLLRGFKKRYPTLQNRTQVLQFLGDKFRVVFQASPDKSDYEVGQEVLDRIVLVHL 360

Query: 360  GSNGNMDKFRMLLFMVRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMILKEKIDEYLQ 419
            G   N DKFRMLLFM+RKLYSLVAGEC PDNPDATQHQEVLLGGFLYGMI+KEKIDEYLQ
Sbjct: 361  GKGNNEDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMIIKEKIDEYLQ 420

Query: 420  GIVAQVRTDINRGVAINFNEKKYMSRVLMRVNDNIGSKMQYFLSTGNLVSQSGLDLQQVS 479
             I+ Q+RTD NRG+AINF ++KYMSRVLMRVN+NIGSK+QYFLSTGNLVSQSGLDLQQVS
Sbjct: 421  NIIQQIRTDSNRGLAINFKDRKYMSRVLMRVNENIGSKLQYFLSTGNLVSQSGLDLQQVS 480

Query: 480  GYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLL 539
            GYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLL
Sbjct: 481  GYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLL 540

Query: 540  NHFAHKCRISTTQSDVSKVPELLYSLGVTPASHTFAAGPSLCCVQLDGKIIGWTSHEQGR 599
            NHFAHKC+IST QSDVS++P LLY LGV+PASHT AAGPS CCVQ+DGKIIGW SHEQG+
Sbjct: 541  NHFAHKCKISTQQSDVSQIPGLLYQLGVSPASHTIAAGPSQCCVQIDGKIIGWVSHEQGK 600

Query: 600  VIADTLRFWKVEGETPGLPKDLEIGYVPPSSKGQYPGLYIFGGHSRMMRPVRYLPLDKED 659
            +IADTLRFWKVEG+ PGLP DLEIGYVPPS++GQYPGLYIFGGHSRMMRPVRYLPLDKED
Sbjct: 601  IIADTLRFWKVEGKIPGLPLDLEIGYVPPSTRGQYPGLYIFGGHSRMMRPVRYLPLDKED 660

Query: 660  IVGPFEQVYMNIAVTPQEIQNNIHTHVEFSPTNILSILANLTPFSDFNQSPRNMYQCQMG 719
            IVGPFEQVYMN+AVTPQEI+NN+HTHVEF+PTNILSILANLTPFSDFNQSPRNMYQCQMG
Sbjct: 661  IVGPFEQVYMNVAVTPQEIENNVHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQMG 720

Query: 720  KQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYD 779
            KQTMGTPGVALCHRSDNKLYRLQ+GQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYD
Sbjct: 721  KQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYD 780

Query: 780  MDDAMIINKSADERGFGYGTMYKVEKVDLSLNRSRGDPVTQHFGFGTDEWPKEWLDKLDE 839
            MDDAMIINKSADERGFGYGTMYKVEKVDLSLNRSRGDP+TQHFGFG DEWPKEWLDKLD+
Sbjct: 781  MDDAMIINKSADERGFGYGTMYKVEKVDLSLNRSRGDPITQHFGFGNDEWPKEWLDKLDD 840

Query: 840  DGLPYIGTYVEEGDPICAYFDDTIGKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQTVS 899
            DGLPYIGTYVEEGDPICAYFDDT+ KTKIKTYHSSEPAYIEEVNLIGDESNKFQELQTVS
Sbjct: 841  DGLPYIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQTVS 900

Query: 900  IKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRMTIGM 959
            IKYRIRRTPQIGDKFSSRHGQKGVCSRKWPT+DMPFSETGIQPDVIINPHAFPSRMTIGM
Sbjct: 901  IKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTVDMPFSETGIQPDVIINPHAFPSRMTIGM 960

Query: 960  FVESLAGKAGALHGIAQDSTPWIFNEQDTPADYFGEQLLKAGYNYHGNEPMYSGATGEEL 1019
            FVESLAGK+GALHG+AQD+TPWIFNE DTPADYFG+QL+KAGYNYHGNEPMYSGATGEEL
Sbjct: 961  FVESLAGKSGALHGVAQDATPWIFNEDDTPADYFGDQLVKAGYNYHGNEPMYSGATGEEL 1020

Query: 1020 RCDIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGH 1079
            R DIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGH
Sbjct: 1021 RADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGH 1080

Query: 1080 GTSFLLQDRLLNSSDYTQAAICRECGSILTTQQTVPRIGAVSSVCCRRCAVKFEDAKKTL 1139
            GTSFLLQDRLLN SDYTQ ++CRECGSILTTQQ+VPRIG++S+VCCRRCAV+F++AK  L
Sbjct: 1081 GTSFLLQDRLLNCSDYTQTSVCRECGSILTTQQSVPRIGSLSTVCCRRCAVRFDEAKSML 1140

Query: 1140 FEHEEKTEEKIFIDDSQIWEDGQGQKFVGGNDTTTVAIPFVLKYL 1184
             + EE +   +FIDDS+IWEDGQG KFVGGNDTTTVAIPFVLKYL
Sbjct: 1141 AKDEETS--NVFIDDSEIWEDGQGNKFVGGNDTTTVAIPFVLKYL 1183

>Kwal_14.1492
          Length = 1197

 Score = 2180 bits (5649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1015/1184 (85%), Positives = 1123/1184 (94%), Gaps = 5/1184 (0%)

Query: 1    MSKVIKPPSNARTAHFRTLERENRFKNPPKDKSAYPLLQEAVQPHVGSFNALTEGPDGGL 60
            MSKV+K P+NARTAHFRT+ERENRF NPPKDKSA+PLL+EAV+PH+GSFNALTEGP+GGL
Sbjct: 1    MSKVVKLPANARTAHFRTVERENRFVNPPKDKSAFPLLREAVEPHIGSFNALTEGPEGGL 60

Query: 61   LQRAVEDIGEKVIFDGKSDGSDEISDYLGNKLSISVEQVSIAKPTANDGVMGAAERPVYP 120
            L +AV+DIG K++FDG+S  S+E S+YLGNKL++SVEQVSI+KP +NDGV  A ER +YP
Sbjct: 61   LNQAVKDIGGKIVFDGRS--SEENSNYLGNKLTLSVEQVSISKPVSNDGVTSAVERKIYP 118

Query: 121  SEARQRLTSYRGKILLKLKWSVNDGENVFSEVRDCGGLPIMLQSNRCHLNKMSPHELVQH 180
            +E+RQRL+SYRGK+LLKLKWSVNDGE  F+E++DCGGLP+MLQSNRCHLN +SP+ELV++
Sbjct: 119  AESRQRLSSYRGKLLLKLKWSVNDGEESFTEIKDCGGLPVMLQSNRCHLNNLSPNELVKN 178

Query: 181  KEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRSVRPDQ 240
            KEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSF+NRGASYSQYGIQIRSVRPDQ
Sbjct: 179  KEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFSNRGASYSQYGIQIRSVRPDQ 238

Query: 241  TSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMIMKALVDTSDREIFDGIIGSNTNNSFLT 300
            TSQTNVLHYLNDG+VTFRFSWRKNEYLIPVVMI+KAL + +DREIFDGI+GS+T+NSFLT
Sbjct: 239  TSQTNVLHYLNDGEVTFRFSWRKNEYLIPVVMILKALCELNDREIFDGIVGSDTSNSFLT 298

Query: 301  DRLELLLRGFKKRYPQLKNRTQVLQYLGDKFRLVFQASPDKSDYEVGQEVLNRIVLVHLG 360
            DRLELLLRG KK+Y QL+NR QVLQYLGDKFR+V QASPD +D++VG+E+L+RIVLVHLG
Sbjct: 299  DRLELLLRGHKKKYGQLQNRRQVLQYLGDKFRVVLQASPDATDFQVGEELLSRIVLVHLG 358

Query: 361  SNGNMDKFRMLLFMVRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMILKEKIDEYLQG 420
             N N DK RMLLFM+RKLYSLVAGEC PDNPDATQHQEVLLGGFLYGMI+KEKI+EYLQ 
Sbjct: 359  GN-NEDKSRMLLFMIRKLYSLVAGECAPDNPDATQHQEVLLGGFLYGMIIKEKIEEYLQN 417

Query: 421  IVAQVRTDINRGVAINFNEKKYMSRVLMRVNDNIGSKMQYFLSTGNLVSQSGLDLQQVSG 480
            I  Q+++D+NRG+A+NF E+KYM+RVLMRVN+NIGSK+QYFLSTGNLVSQSGLDLQQVSG
Sbjct: 418  IRLQIQSDVNRGLAVNFKERKYMNRVLMRVNENIGSKLQYFLSTGNLVSQSGLDLQQVSG 477

Query: 481  YTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLN 540
            YTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLN
Sbjct: 478  YTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLN 537

Query: 541  HFAHKCRISTTQSDVSKVPELLYSLGVTPASHTFAAGPSLCCVQLDGKIIGWTSHEQGRV 600
            HFAHKC+ISTTQSDVS++P LLYSLGV PASHT AAGP+ CCVQLDGKI+GW SHEQG++
Sbjct: 538  HFAHKCKISTTQSDVSRIPALLYSLGVAPASHTVAAGPTACCVQLDGKIVGWCSHEQGKI 597

Query: 601  IADTLRFWKVEGETPGLPKDLEIGYVPPSSKGQYPGLYIFGGHSRMMRPVRYLPLDKEDI 660
            IADTLRFWKVEGET GLP DLEIGYVPPSS+GQYPGLY+FGGHSRMMRPV+YLPL KEDI
Sbjct: 598  IADTLRFWKVEGETAGLPLDLEIGYVPPSSRGQYPGLYLFGGHSRMMRPVKYLPLGKEDI 657

Query: 661  VGPFEQVYMNIAVTPQEIQNNIHTHVEFSPTNILSILANLTPFSDFNQSPRNMYQCQMGK 720
            VGPFEQVYMNIAVTPQEIQNNIHTHVEF+PTNILSILANLTPFSDFNQSPRNMYQCQMGK
Sbjct: 658  VGPFEQVYMNIAVTPQEIQNNIHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQMGK 717

Query: 721  QTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYDM 780
            QTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNG NAVVAVISYTGYDM
Sbjct: 718  QTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGMNAVVAVISYTGYDM 777

Query: 781  DDAMIINKSADERGFGYGTMYKVEKVDLSLNRSRGDPVTQHFGFGTDEWPKEWLDKLDED 840
            DDAMIINKSADERGFGYGTMYKVEK+DLS+NRSRGDP+TQHFGFG DEWPK WL+KLD+D
Sbjct: 778  DDAMIINKSADERGFGYGTMYKVEKIDLSMNRSRGDPITQHFGFGDDEWPKGWLEKLDDD 837

Query: 841  GLPYIGTYVEEGDPICAYFDDTIGKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQTVSI 900
            GLP IGTYVEEGDPICA+FDDT+ KTKIKTYHSSEPAYIEEVNLIGDES+KFQELQT+SI
Sbjct: 838  GLPIIGTYVEEGDPICAFFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESSKFQELQTISI 897

Query: 901  KYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRMTIGMF 960
            KYRIRRTPQIGDKFSSRHGQKGVCSRKWPT+DMPFSE+G+QPD+IINPHAFPSRMTIGMF
Sbjct: 898  KYRIRRTPQIGDKFSSRHGQKGVCSRKWPTVDMPFSESGMQPDIIINPHAFPSRMTIGMF 957

Query: 961  VESLAGKAGALHGIAQDSTPWIFNEQDTPADYFGEQLLKAGYNYHGNEPMYSGATGEELR 1020
            VESLAGKAGALHG+A D+TPW F+E+DTPA+YFG+QLL AGYNYHGNEPMYSGATGEELR
Sbjct: 958  VESLAGKAGALHGMAHDATPWTFSEKDTPANYFGDQLLSAGYNYHGNEPMYSGATGEELR 1017

Query: 1021 CDIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHG 1080
             DIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHG
Sbjct: 1018 ADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHG 1077

Query: 1081 TSFLLQDRLLNSSDYTQAAICRECGSILTTQQTVPRIGAVSSVCCRRCAVKFEDAKKTLF 1140
            TSFLLQDRLLN SDYTQ+A+CRECGS+LTT  +VPRIG++++V CRRCAVKF++AKK + 
Sbjct: 1078 TSFLLQDRLLNCSDYTQSAVCRECGSLLTTHYSVPRIGSLATVRCRRCAVKFDEAKKIVA 1137

Query: 1141 EHEEKTEEKIFIDDSQIWEDGQGQKFVGGNDTTTVAIPFVLKYL 1184
            +++   E++IFIDDS IWEDGQG KFVGG  TTTVAIPFVLKYL
Sbjct: 1138 KYQ--GEDQIFIDDSHIWEDGQGNKFVGGGQTTTVAIPFVLKYL 1179

>KLLA0B06303g complement(555780..559391) highly similar to sp|P22138
            Saccharomyces cerevisiae YPR010c RPA135 DNA-directed RNA
            polymerase I, 135 KD subunit, start by similarity
          Length = 1203

 Score = 2176 bits (5639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1021/1189 (85%), Positives = 1109/1189 (93%), Gaps = 9/1189 (0%)

Query: 1    MSKVIKPPSNA-----RTAHFRTLERENRFKNPPKDKSAYPLLQEAVQPHVGSFNALTEG 55
            MS VI PP        RTA FRTLERE+RF NPPKDKSAYP L +AVQPH+GSFNALTEG
Sbjct: 1    MSSVILPPQAPVERLNRTASFRTLERESRFINPPKDKSAYPFLADAVQPHIGSFNALTEG 60

Query: 56   PDGGLLQRAVEDIGEKVIFDGKSDGSDEISDYLGNKLSISVEQVSIAKPTANDGVMGAAE 115
            PDGGLL    +DIG KVIFDGK  GSD   +YLGNKLS+S+EQVSI+KPT+NDGV  A E
Sbjct: 61   PDGGLLNLGAKDIGSKVIFDGK--GSDTNPNYLGNKLSLSIEQVSISKPTSNDGVSSAVE 118

Query: 116  RPVYPSEARQRLTSYRGKILLKLKWSVNDGENVFSEVRDCGGLPIMLQSNRCHLNKMSPH 175
            R V+PSE+RQRLTSYRGKILLKLKWSVNDGE  F+EVRDCGGLPIMLQSNRCHLNKMSP+
Sbjct: 119  RKVFPSESRQRLTSYRGKILLKLKWSVNDGEETFTEVRDCGGLPIMLQSNRCHLNKMSPY 178

Query: 176  ELVQHKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRS 235
            ELV+H+EESDE GGYFI+NGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRS
Sbjct: 179  ELVEHREESDEFGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRS 238

Query: 236  VRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMIMKALVDTSDREIFDGIIGSNTN 295
            VRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMI++AL DT+DREIFD ++G +T+
Sbjct: 239  VRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMILRALCDTNDREIFDHVVGGDTS 298

Query: 296  NSFLTDRLELLLRGFKKRYPQLKNRTQVLQYLGDKFRLVFQASPDKSDYEVGQEVLNRIV 355
            NSFLTDRLELLLRGFKKRYP L+NR Q LQYLGDKFR+VFQASPD +D +VGQE+LNRIV
Sbjct: 299  NSFLTDRLELLLRGFKKRYPTLQNRKQTLQYLGDKFRVVFQASPDMTDLQVGQELLNRIV 358

Query: 356  LVHLGSNGNMDKFRMLLFMVRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMILKEKID 415
            LVHLG N N DKF MLLFM+RKLYSLVAGEC PDNPDA QHQE+LLGGFLYGMI+KEKI+
Sbjct: 359  LVHLGEN-NKDKFNMLLFMIRKLYSLVAGECSPDNPDAAQHQEILLGGFLYGMIVKEKIE 417

Query: 416  EYLQGIVAQVRTDINRGVAINFNEKKYMSRVLMRVNDNIGSKMQYFLSTGNLVSQSGLDL 475
            EYLQ I  Q++TDINRG+AINF ++KYM++VLMRVN+NIGSK+QYFLSTGNLVSQSGLDL
Sbjct: 418  EYLQNIRLQIQTDINRGLAINFKDQKYMNKVLMRVNENIGSKLQYFLSTGNLVSQSGLDL 477

Query: 476  QQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSP 535
            QQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGF CPVHTPDGSP
Sbjct: 478  QQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFFCPVHTPDGSP 537

Query: 536  CGLLNHFAHKCRISTTQSDVSKVPELLYSLGVTPASHTFAAGPSLCCVQLDGKIIGWTSH 595
            CGLLNH +HKC+IST QSDVSK+P +LYSLGVTPA+H  AAGPS+CCVQLDGKIIGW SH
Sbjct: 538  CGLLNHLSHKCKISTEQSDVSKIPSILYSLGVTPAAHVIAAGPSMCCVQLDGKIIGWCSH 597

Query: 596  EQGRVIADTLRFWKVEGETPGLPKDLEIGYVPPSSKGQYPGLYIFGGHSRMMRPVRYLPL 655
            EQG+V+ADTLRFWKVEG+TPGLP DLE+GYVPP++ GQYPGL++FGGHSRMMRPVRYLPL
Sbjct: 598  EQGKVVADTLRFWKVEGKTPGLPVDLEVGYVPPTTSGQYPGLFLFGGHSRMMRPVRYLPL 657

Query: 656  DKEDIVGPFEQVYMNIAVTPQEIQNNIHTHVEFSPTNILSILANLTPFSDFNQSPRNMYQ 715
            DKEDIVGPFEQVYMNIAVTP+EI+NN+H+HVEFSPTNILSILANLTPFSDFNQSPRNMYQ
Sbjct: 658  DKEDIVGPFEQVYMNIAVTPEEIENNVHSHVEFSPTNILSILANLTPFSDFNQSPRNMYQ 717

Query: 716  CQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGTNAVVAVISY 775
            CQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGTNAVVAVISY
Sbjct: 718  CQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGTNAVVAVISY 777

Query: 776  TGYDMDDAMIINKSADERGFGYGTMYKVEKVDLSLNRSRGDPVTQHFGFGTDEWPKEWLD 835
            TGYDMDDAMIINKSADERGFGYGTMYKVEKV+LS+NRSRGDP+TQHFGFGTDEWPKEWL+
Sbjct: 778  TGYDMDDAMIINKSADERGFGYGTMYKVEKVNLSMNRSRGDPITQHFGFGTDEWPKEWLE 837

Query: 836  KLDEDGLPYIGTYVEEGDPICAYFDDTIGKTKIKTYHSSEPAYIEEVNLIGDESNKFQEL 895
            KLD+DGLP IGTYVEEGDPICAYFDDT+ KTKIKTYHSSEPAYIEEV LIGDES+KFQEL
Sbjct: 838  KLDDDGLPLIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVKLIGDESSKFQEL 897

Query: 896  QTVSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRM 955
            Q ++IKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRM
Sbjct: 898  QAITIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRM 957

Query: 956  TIGMFVESLAGKAGALHGIAQDSTPWIFNEQDTPADYFGEQLLKAGYNYHGNEPMYSGAT 1015
            TIGMFVESLAGKAGALHGIAQDSTPW FNE DTPADYFG+QL KAGYNYHGNEPMYSGAT
Sbjct: 958  TIGMFVESLAGKAGALHGIAQDSTPWTFNESDTPADYFGDQLAKAGYNYHGNEPMYSGAT 1017

Query: 1016 GEELRCDIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDA 1075
            GEELR DIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDA
Sbjct: 1018 GEELRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDA 1077

Query: 1076 LIGHGTSFLLQDRLLNSSDYTQAAICRECGSILTTQQTVPRIGAVSSVCCRRCAVKFEDA 1135
            LIGHGTSFLLQDRLLN SDYTQ A+CR+CG+ILTTQ +VP+IG++S+V CRRCA+KF++A
Sbjct: 1078 LIGHGTSFLLQDRLLNCSDYTQTAVCRDCGAILTTQSSVPKIGSISTVRCRRCALKFDEA 1137

Query: 1136 KKTLFEHEEKTEEKIFIDDSQIWEDGQGQKFVGGNDTTTVAIPFVLKYL 1184
            K+ + ++E  + E + I DS+IWEDGQG KFVGG +TTTVAIPFVLKYL
Sbjct: 1138 KRLITKYESGS-EPVHIADSEIWEDGQGNKFVGGGNTTTVAIPFVLKYL 1185

>ABR029W [620] [Homologous to ScYPR010C (RPA135) - SH]
            complement(450645..454241) [3597 bp, 1198 aa]
          Length = 1198

 Score = 2059 bits (5334), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 981/1185 (82%), Positives = 1076/1185 (90%), Gaps = 11/1185 (0%)

Query: 4    VIKPPSNARTAHFRTLERENRFKNPPKDKSAYPLLQEAVQPHVGSFNALTEGPDGGLLQR 63
            V++P S  RTA FRTLERE RF +PPKDKSAYPLL EAV+PHVGSFNALTEGP GGLL  
Sbjct: 3    VMEPLSANRTAQFRTLEREARFVSPPKDKSAYPLLYEAVEPHVGSFNALTEGPGGGLLNL 62

Query: 64   AVEDIGEKVIFDGKSDGSDEISDYLGNKLSISVEQVSIAKPTANDGVMGAAERPVYPSEA 123
               DIG KV+FDGK+  SDE  +YLGNKL++SV QVS+ KP +NDGV  AAER V+P+EA
Sbjct: 63   GARDIGAKVVFDGKA--SDENPNYLGNKLALSVTQVSLTKPMSNDGVTAAAERNVFPAEA 120

Query: 124  RQRLTSYRGKILLKLKWSVNDGENVFSEVRDCGGLPIMLQSNRCHLNKMSPHELVQHKEE 183
            R+RLT+YRGK+LLKL WSVNDGE  FSEVRDCG LP+MLQSNRCHL+KMSP ELV+HKEE
Sbjct: 121  RKRLTTYRGKLLLKLNWSVNDGEETFSEVRDCGPLPVMLQSNRCHLHKMSPQELVEHKEE 180

Query: 184  SDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRSVRPDQTSQ 243
            SDELGGYFI+NGIEKLIRMLIVQRRNHPMAIIRPSFANRG SYS YG+QIR VRPDQTSQ
Sbjct: 181  SDELGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGTSYSHYGVQIRCVRPDQTSQ 240

Query: 244  TNVLHYLNDGQVTFRFSWRKNEYLIPVVMIMKALVDTSDREIFDGIIGSNTNNSFLTDRL 303
            TNVLHYLNDGQVTFRFSWRKNEYL+PVV+I+KAL D SDREIFDGI+G++T+NSFLTDRL
Sbjct: 241  TNVLHYLNDGQVTFRFSWRKNEYLVPVVLILKALTDASDREIFDGIVGADTSNSFLTDRL 300

Query: 304  ELLLRGFKKRYPQLKNRTQVLQYLGDKFRLVFQASPDKSDYEVGQEVLNRIVLVHLGSNG 363
            ELLLRGFKKR+PQL NR QVLQYLGDKFR+V QASPD SDY VGQE+L RIVLVHLG   
Sbjct: 301  ELLLRGFKKRFPQLLNRRQVLQYLGDKFRVVLQASPDMSDYLVGQELLRRIVLVHLGDE- 359

Query: 364  NMDKFRMLLFMVRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMILKEKIDEYLQGIVA 423
            N DK  ML+FM+RKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMI+KEKI+EYLQ I  
Sbjct: 360  NTDKSNMLMFMIRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMIVKEKIEEYLQNIKL 419

Query: 424  QVRTDINRGVAINFNEKKYMSRVLMRVNDNIGSKMQYFLSTGNLVSQSGLDLQQVSGYTV 483
            Q++ D+NRG+ ++F ++KYM+RVL R+N+NIGSK+QYFLSTGNLVSQSGLDLQQVSGYTV
Sbjct: 420  QIQADVNRGMPVDFKDRKYMTRVLTRINENIGSKLQYFLSTGNLVSQSGLDLQQVSGYTV 479

Query: 484  VAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNHFA 543
            VAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNHFA
Sbjct: 480  VAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNHFA 539

Query: 544  HKCRISTTQSDVSKVPELLYSLGVTPASHTFAAGPSLCCVQLDGKIIGWTSHEQGRVIAD 603
            HKC+ISTTQSDVSK+P LLYSLGV+PA+H  AAGPSLCCVQLDGKI+GW SHEQGR++AD
Sbjct: 540  HKCKISTTQSDVSKIPTLLYSLGVSPAAHVTAAGPSLCCVQLDGKIVGWCSHEQGRIVAD 599

Query: 604  TLRFWKVEGETPGLPKDLEIGYVPPSSKGQYPGLYIFGGHSRMMRPVRYLPLDKEDIVGP 663
            TLR+WKVEG+T GLP DLEIGYVP S +GQYPGLY+FGGHSRMMRPVRYLPLDK+DIVGP
Sbjct: 600  TLRYWKVEGKTDGLPLDLEIGYVPASKRGQYPGLYLFGGHSRMMRPVRYLPLDKQDIVGP 659

Query: 664  FEQVYMNIAVTPQEIQNNIHTHV---EFSPTNILSILANLTPFS-DFNQSPRNMYQCQMG 719
            FEQVYM+IAVTP+E  N + T +    F    ILSILANLTPF       P+     QMG
Sbjct: 660  FEQVYMDIAVTPEE--NPLITSILMLNFHQQIILSILANLTPFLLTLTNLPKICTNYQMG 717

Query: 720  KQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYD 779
            KQTMGTPGVALCHRSDNKLYRLQ+GQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYD
Sbjct: 718  KQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYD 777

Query: 780  MDDAMIINKSADERGFGYGTMYKVEKVDLSLNRSRGDPVTQHFGFGTDEWPKEWLDKLDE 839
            MDDAMIINKSADERGF YGT+YK EK+DLSL+R RGDPVTQHFGFGTDEWPKEWL+KLDE
Sbjct: 778  MDDAMIINKSADERGFSYGTVYKTEKIDLSLSRGRGDPVTQHFGFGTDEWPKEWLEKLDE 837

Query: 840  DGLPYIGTYVEEGDPICAYFDDTIGKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQTVS 899
            DGLP IG+YVEEGDPICAYFDDT+ KTKIKTYHSSEPAYIEEV LIGDESNKFQELQ ++
Sbjct: 838  DGLPIIGSYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVTLIGDESNKFQELQYIT 897

Query: 900  IKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRMTIGM 959
            IKYRIRR PQIGDKFSSRHGQKGVCSRKWPT+DMPFSETGIQPDVIINPHAFPSRMTIGM
Sbjct: 898  IKYRIRRVPQIGDKFSSRHGQKGVCSRKWPTVDMPFSETGIQPDVIINPHAFPSRMTIGM 957

Query: 960  FVESLAGKAGALHGIAQDSTPWIFNEQDTPADYFGEQLLKAGYNYHGNEPMYSGATGEEL 1019
            FVESLAGKAGALHGIAQD+TPW F+E+DTPADYFG+QLLKAGYNYHGNEPMYSGATGEEL
Sbjct: 958  FVESLAGKAGALHGIAQDATPWTFSEEDTPADYFGDQLLKAGYNYHGNEPMYSGATGEEL 1017

Query: 1020 RCDIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGH 1079
            R DIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGH
Sbjct: 1018 RADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGH 1077

Query: 1080 GTSFLLQDRLLNSSDYTQAAICRECGSILTTQQTVPRIGAVSSVCCRRCAVKFEDAKKTL 1139
            GTSFLLQDRLLNSSDYTQ+A+CRECGSILTTQ +VP+IG++ ++ CRRCA+ F++AKK +
Sbjct: 1078 GTSFLLQDRLLNSSDYTQSAVCRECGSILTTQSSVPKIGSMVTIRCRRCAISFDEAKKII 1137

Query: 1140 FEHEEKTEEKIFIDDSQIWEDGQGQKFVGGNDTTTVAIPFVLKYL 1184
             + +  +E+ IFIDDS IWEDGQG KFVGG +TTTVAIPFVLKYL
Sbjct: 1138 TQQD--SEDSIFIDDSHIWEDGQGNKFVGGGNTTTVAIPFVLKYL 1180

>Scas_70.1
          Length = 259

 Score =  404 bits (1039), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 195/235 (82%), Positives = 217/235 (92%), Gaps = 1/235 (0%)

Query: 293 NTNNSFLTDRLELLLRGFKKRYPQLKNRTQVLQYLGDKFRLVFQASPDKSDYEVGQEVLN 352
           +T+NSFLTDRLELLLRGFKK+YPQL+NR QVLQYLGDKFR+VFQASPD +DY+VG+EVL 
Sbjct: 12  DTSNSFLTDRLELLLRGFKKKYPQLQNRRQVLQYLGDKFRVVFQASPDMTDYQVGEEVLR 71

Query: 353 RIVLVHLGSNGNMDKFRMLLFMVRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMILKE 412
           RIVLVHLG +G  DKF MLLFM+RKLYSLVAGEC PDNPDATQHQEVLLGGFLYGMI+KE
Sbjct: 72  RIVLVHLGEDGK-DKFHMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMIVKE 130

Query: 413 KIDEYLQGIVAQVRTDINRGVAINFNEKKYMSRVLMRVNDNIGSKMQYFLSTGNLVSQSG 472
           KI+EYLQ I  Q++ D+NRG+A+NF ++KYM+RVLMRVN+NIGSK+QYFLSTGNLVSQSG
Sbjct: 131 KIEEYLQNIRLQIQADVNRGLAVNFKDRKYMTRVLMRVNENIGSKLQYFLSTGNLVSQSG 190

Query: 473 LDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCP 527
           LDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPE  G   P
Sbjct: 191 LDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPEILGVPMP 245

>Kwal_26.8553
          Length = 1171

 Score =  397 bits (1020), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 319/1046 (30%), Positives = 508/1046 (48%), Gaps = 120/1046 (11%)

Query: 118  VYPSEARQRLTSYRGKILLKLKWSVNDGENVFSEVRDC--GGLPIMLQSNRCHLNKMSPH 175
            V P E R R  +Y   I + ++++   G N+    RD   G +PIML+SN+C LN  S  
Sbjct: 138  VPPHECRLRDMTYSAPIYVDIEYT--RGRNIIMH-RDVEIGRMPIMLRSNKCILNGASEK 194

Query: 176  ELVQHKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRS 235
            ++ +  E   + GGYFI+NG EK+I   +VQ +     II  +   +    +     + S
Sbjct: 195  DMARINECPLDPGGYFIVNGTEKVI---LVQEQLSKNRIIVEADEKKAIVQAS----VTS 247

Query: 236  VRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMIMKALVDTSDREIFDGIIGSNTN 295
               ++ S+T V+    +G++  + +    E  +P+V+++KA    SD EI   + G   N
Sbjct: 248  STHERKSKTYVI--TKNGKIYLKHNSIAEE--VPIVLVLKASGIVSDLEIMQLVCG---N 300

Query: 296  NSFLTDRLELLLRGFKKRYPQLKNRTQVLQYLGDKFRLVFQASPDKSDYEVGQEVLNRIV 355
            +S   D   +      K   ++  + Q L+Y+G K + V +     +  + G E +   V
Sbjct: 301  DSSYQDIFAVNFEEVAKM--KIYTQQQALEYIGSKVKTVRRQK--LTTLQEGIEAIATTV 356

Query: 356  LVHLGSNG--NMDKFRMLLFMVRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMILKE- 412
            + HL        +K   +  M R++   +      D+ D   ++ + L G L  ++ ++ 
Sbjct: 357  IAHLTVEALDFREKALYIAVMTRRVVMAIHNPKMVDDRDYVGNKRLELAGQLMSLLFEDL 416

Query: 413  --KIDEYLQGIVAQVRTDINRGVAINFNEKKYMSRVLMRVN---DNIGSKMQYFLSTGNL 467
              K +   +  + +V    NR +  +          L+ +N   +NI S +   +STGN 
Sbjct: 417  FKKFNNDFKANIDKVLKKPNRAMEYD---------ALLSINVHSNNITSGLNRAISTGNW 467

Query: 468  VSQSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGS--FFAQLKTTTVRKLLPESWGFL 525
             S     +++ +G T V  ++++   IS   M+ R S  F    K +  R L P  +G L
Sbjct: 468  -SLKRFKMER-AGVTHVLSRLSY---ISALGMMTRISSQFEKSRKVSGPRALQPSQFGML 522

Query: 526  CPVHTPDGSPCGLLNHFAHKCRISTTQSDVSKVPELLYSLGVTPASHTFAAGPSL---CC 582
            C   TP+G  CGL+ + A    I TT  +   + +L Y LGV     T     SL    C
Sbjct: 523  CTSDTPEGEACGLVKNLALMTHI-TTDDEEEPIKKLCYLLGVEDI--TVVDSDSLHFNYC 579

Query: 583  VQLDGKIIGWTSHEQGRVIADTLRF-WKVEGETPGLPKDLEIG-YVPPSSKGQYPGLYIF 640
            V L+G I+G             +RF  K   +   L +  ++  ++   +      ++I 
Sbjct: 580  VYLNGTIVG------------VVRFPTKFVSQFRNLRRSGKVSEFISIYTNSHQKAVHIA 627

Query: 641  GGHSRMMRPVRY--------------------LPLDKEDIVGPFEQVYMN------IAVT 674
                R+ RP+                      L  D    +G  E + +N      IA+ 
Sbjct: 628  TDGGRICRPLIIVTDGKSLVTAQHLRQLLDGQLQFDDFLKLGLVEYLDVNEENDSFIALY 687

Query: 675  PQEIQNNIHTHVEFSPTNILSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRS 734
             ++++ +I TH+E  P  +L  +A L P+   NQSPRN YQC MGKQ +G        R 
Sbjct: 688  ERDLEPSI-THMEIEPFTVLGAVAGLIPYPHHNQSPRNTYQCAMGKQAIGAIAYNQFKRI 746

Query: 735  DNKLYRLQTGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYDMDDAMIINKSADERG 794
            D  LY +   Q P+VK    +    D  P G NA VAV+SY+GYD++DA+++NK++ +RG
Sbjct: 747  DTLLYLMIYPQQPMVKTKTIELIDYDKIPAGQNATVAVMSYSGYDIEDALVLNKASIDRG 806

Query: 795  FGYGTMYKVEKVDLSLNRSRGDPVTQHFGFGTDEWPKE-WLDK-LDEDGLPYIGTYVEEG 852
            FG     +  K+   L R          G   DE  +  W  K L  DGL  +G  VE G
Sbjct: 807  FGRCETRR--KLTTVLKRYPNHTQDMVGGMRVDENGEPIWQHKALGPDGLGEVGMKVESG 864

Query: 853  D-------PICAYFDDTIGKTKIK------TYHSSEPAYIEEVNLIGDESNKFQELQTVS 899
                    P  A  D  + +T+ +       Y + EP++I++V +   E+++      + 
Sbjct: 865  QIYVNKSVPTNAS-DSVLTQTQAQYRETPVVYRAPEPSHIDQVMMSVSENDQ----ALIK 919

Query: 900  IKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRMTIGM 959
            +  R  R P++GDKFSSRHGQKGVC       D+PF++ G+ PD+I+NPH FPSRMT+G 
Sbjct: 920  VLLRQNRRPELGDKFSSRHGQKGVCGIIVNQEDLPFNDQGVVPDIIMNPHGFPSRMTVGK 979

Query: 960  FVESLAGKAGALHGIAQDSTPWIFNEQDTPADYFGEQLLKAGYNYHGNEPMYSGATGEEL 1019
             +E ++GKAG L+G  +  T +      +  +   + L+  G+NY G + +YSG TGE L
Sbjct: 980  MIELISGKAGVLNGTLEYGTCF----GGSKLEDMSQILMNNGFNYSGKDMLYSGITGECL 1035

Query: 1020 RCDIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGH 1079
            +  I+ G +YYQ+L+HMV DK   R+ GP   LT QP +GR R GG+R+GEMERD +I +
Sbjct: 1036 QAYIFFGPIYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCVIAY 1095

Query: 1080 GTSFLLQDRLLNSSDYTQAAICRECG 1105
            G S LL +RL+ SSD  +  +C +CG
Sbjct: 1096 GASQLLLERLMISSDAFEVDVCDKCG 1121

>Scas_605.14
          Length = 1150

 Score =  392 bits (1007), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 313/1052 (29%), Positives = 497/1052 (47%), Gaps = 135/1052 (12%)

Query: 120  PSEARQRLTSYRGKILLKLKWSVNDGENVFSEVR-DCGGLPIMLQSNRCHLNKMSPHELV 178
            P E R R  +Y   I + ++++   G N+      + G +PIML+SN+C L  +   E+ 
Sbjct: 117  PHECRLRDMTYSAPIYVDIEYT--RGRNIIMHKDVELGRMPIMLRSNKCTLYGIDEKEMA 174

Query: 179  QHKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRSVRP 238
            +  E   + GGYFI+NG EK+I   +VQ +     II  +   +G   +     + S   
Sbjct: 175  KLNECPLDPGGYFIVNGTEKVI---LVQEQLSKNRIIVEADEKKGIVQAS----VTSSTH 227

Query: 239  DQTSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMIMKALVDTSDREIFDGIIGSNTNNSF 298
            ++ S+T V+    + ++  + +    E  IP+V+++KA    SD EI   + G   N+S 
Sbjct: 228  ERRSKTYVI--TKNDKIYLKHNSITEE--IPIVIVLKACGVVSDLEIMQLVCG---NDSS 280

Query: 299  LTDRLELLLRGFKKRYPQLKNRTQVLQYLGDKFRLVFQASPDKSDYEVGQEVLNRIVLVH 358
              D   + L    +    +  + Q L+++G K + + +     S  + G E +   V+ H
Sbjct: 281  YQDIFAVNLEEASRL--NIYTQQQALEFIGTKVKTMRRQKL--SVLQEGIEAIATTVVAH 336

Query: 359  LGSNG--NMDKFRMLLFMVRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMILKE---K 413
            L        +K   +  M R++   +      D+ D   ++ + L G L  ++ ++   K
Sbjct: 337  LTVEALDFREKALYMAMMTRRVVMAIQNPKMVDDRDYVGNKRLELAGQLISLLFEDLFKK 396

Query: 414  IDEYLQGIVAQVRTDINRGVAINFNEKKYMSRVLMRVN---DNIGSKMQYFLSTGNLVSQ 470
             +   +  + +V    NR +  +          L+ +N   +NI S +   +STGN  S 
Sbjct: 397  FNSDFKATIDKVLKKPNRAMEYD---------ALLSINVHSNNITSGLNRAISTGNW-SL 446

Query: 471  SGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGS--FFAQLKTTTVRKLLPESWGFLCPV 528
                +++ +G T V  ++++   IS   M+ R S  F    K +  R L P  +G LC  
Sbjct: 447  KRFKMER-AGVTHVLSRLSY---ISALGMMTRISSQFEKSRKVSGPRALQPSQFGMLCTA 502

Query: 529  HTPDGSPCGLLNHFAHKCRISTTQSDVSKVPELLYSLGVTPASHTFAAGPSL-CCVQLDG 587
             TP+G  CGL+ + A    I TT  +   +  L Y LGV   S   +A   L   V L+G
Sbjct: 503  DTPEGEACGLVKNLALMTHI-TTDDEEEPIKRLCYILGVEDVSLIDSASLHLNFGVYLNG 561

Query: 588  KIIGWTSHEQGRVIADTLRFWKVEGETPGLPKDLEIGYVPPSSKGQYPGLYIFGGHSRMM 647
             +IG T      V     R  +  G+           ++   +      ++I     R+ 
Sbjct: 562  TLIGTTRFPIKFV--SQFRHLRRTGKISE--------FISIYANSHQKAVHIATDGGRIC 611

Query: 648  RPVRYLPLDKEDI--------------------VGPFEQVYMN------IAVTPQEIQNN 681
            RP+  +   K  +                    +G  E + +N      IA+  ++I++ 
Sbjct: 612  RPLIIVTKGKSHVTADHLRRLLNGELVFDDFLKLGLVEYLDVNEENDSFIALYEKDIESA 671

Query: 682  IHTHVEFSPTNILSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRL 741
              TH+E  P  IL  +A L P+   NQSPRN YQC MGKQ +G        R D  LY +
Sbjct: 672  -STHLEIEPFTILGAVAGLIPYPHHNQSPRNTYQCAMGKQAIGAIAYNQFKRIDTLLYLM 730

Query: 742  QTGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYDMDDAMIINKSADERGFGYGTMY 801
               Q P+VK    +    D  P G NA VAV+SY+GYD++DA+++NK++ +RGFG     
Sbjct: 731  IYPQQPMVKTKTIELIDYDKLPAGQNATVAVMSYSGYDIEDALVLNKASIDRGFGRCETR 790

Query: 802  KVEKVDLSLNR---------------SRGDPVTQHFGFGTDEWPKEWLDKLDEDGLPYIG 846
            +  K    L R                 G+P+ QH   G D             GL  +G
Sbjct: 791  R--KTTTVLKRYPNHTQDIIGGMRVDENGEPIWQHKALGAD-------------GLGEVG 835

Query: 847  TYVEEGD-------PICAYFDDTIGKTKIK------TYHSSEPAYIEEVNLIGDESNKFQ 893
              VE G        P     D T    + +       Y + EP++I++V +   ++++  
Sbjct: 836  MKVESGQIYINKSVPTNQSNDMTTQAQQAQYRETPVIYRAPEPSHIDQVMMSVSDNDQ-- 893

Query: 894  ELQTVSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPS 953
                + +  R  R P++GDKFSSRHGQKGVC       DMPF++ GI PD+I+NPH FPS
Sbjct: 894  --ALIKVLLRQNRRPELGDKFSSRHGQKGVCGIIVKQEDMPFNDQGIVPDIIMNPHGFPS 951

Query: 954  RMTIGMFVESLAGKAGALHGIAQDSTPWIFNEQDTPADYFGEQLLKAGYNYHGNEPMYSG 1013
            RMT+G  +E ++GKAG L+G  +  T +      +  +   + L+  G+NY G + +YSG
Sbjct: 952  RMTVGKMIELISGKAGVLNGSLEYGTCF----GGSKLEDMSKILVDQGFNYSGKDMLYSG 1007

Query: 1014 ATGEELRCDIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMER 1073
             TGE L+  I+ G +YYQ+L+HMV DK   R+ GP   LT QP +GR R GG+R+GEMER
Sbjct: 1008 ITGECLQAYIFFGPIYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMER 1067

Query: 1074 DALIGHGTSFLLQDRLLNSSDYTQAAICRECG 1105
            D +I +G S LL +RL+ SSD  +  +C +CG
Sbjct: 1068 DCVIAYGASQLLLERLMISSDAFEVDVCDKCG 1099

>YOR207C (RET1) [5000] chr15 complement(730008..733457) RNA polymerase
            III, second-largest subunit (C128) [3450 bp, 1149 aa]
          Length = 1149

 Score =  390 bits (1002), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 312/1037 (30%), Positives = 499/1037 (48%), Gaps = 103/1037 (9%)

Query: 120  PSEARQRLTSYRGKILLKLKWSVNDGENVFSEVR-DCGGLPIMLQSNRCHLNKMSPHELV 178
            P E R R  +Y   I + ++++   G N+      + G +PIML+SN+C L      ++ 
Sbjct: 115  PHECRLRDMTYSAPIYVDIEYT--RGRNIIMHKDVEIGRMPIMLRSNKCILYDADESKMA 172

Query: 179  QHKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRSVRP 238
            +  E   + GGYFI+NG EK+I   +VQ +     II  +   +G   +     + S   
Sbjct: 173  KLNECPLDPGGYFIVNGTEKVI---LVQEQLSKNRIIVEADEKKGIVQAS----VTSSTH 225

Query: 239  DQTSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMIMKALVDTSDREIFDGIIGSNTNNSF 298
            ++ S+T V+    +G++  + +    E  IP+ +++KA    SD EI   + G   N+S 
Sbjct: 226  ERKSKTYVI--TKNGKIYLKHNSIAEE--IPIAIVLKACGILSDLEIMQLVCG---NDSS 278

Query: 299  LTDRLELLLRGFKKRYPQLKNRTQVLQYLGDKFRLVFQASPDKSDYEVGQEVLNRIVLVH 358
              D   + L    K    +  + Q L+Y+G K + + +     +  + G E +   V+ H
Sbjct: 279  YQDIFAVNLEESSKL--DIYTQQQALEYIGAKVKTMRRQKL--TILQEGIEAIATTVIAH 334

Query: 359  LGSNG--NMDKFRMLLFMVRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMILKE---K 413
            L        +K   +  M R++   +      D+ D   ++ + L G L  ++ ++   K
Sbjct: 335  LTVEALDFREKALYIAMMTRRVVMAMYNPKMIDDRDYVGNKRLELAGQLISLLFEDLFKK 394

Query: 414  IDEYLQGIVAQVRTDINRGVAINFNEKKYMSRVLMRVN---DNIGSKMQYFLSTGNLVSQ 470
             +   +  + +V    NR +  +          L+ +N   +NI S +   +STGN  S 
Sbjct: 395  FNNDFKLSIDKVLKKPNRAMEYD---------ALLSINVHSNNITSGLNRAISTGNW-SL 444

Query: 471  SGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGS--FFAQLKTTTVRKLLPESWGFLCPV 528
                +++ +G T V  ++++   IS   M+ R S  F    K +  R L P  +G LC  
Sbjct: 445  KRFKMER-AGVTHVLSRLSY---ISALGMMTRISSQFEKSRKVSGPRALQPSQFGMLCTA 500

Query: 529  HTPDGSPCGLLNHFAHKCRISTTQSDVSKVPELLYSLGVTPASHTFAAGPSL-CCVQLDG 587
             TP+G  CGL+ + A    I TT  +   + +L Y LGV   +   +A   L   V L+G
Sbjct: 501  DTPEGEACGLVKNLALMTHI-TTDDEEEPIKKLCYVLGVEDITLIDSASLHLNYGVYLNG 559

Query: 588  KIIG--------WTSHEQGRVIADTLRFWKVEGETPGLPKDLEIGYVPPSSKGQYPGLYI 639
             +IG         T     R       F  +   +      + +       +   P + +
Sbjct: 560  TLIGSIRFPTKFVTQFRHLRRTGKVSEFISIYSNS----HQMAVHIATDGGRICRPLIIV 615

Query: 640  FGGHSRM----MRPVRYLPLDKEDIV--GPFEQVYMN------IAVTPQEIQNNIHTHVE 687
              G SR+    +R +    LD +D +  G  E + +N      IA+  ++I  ++ TH+E
Sbjct: 616  SDGQSRVKDIHLRKLLDGELDFDDFLKLGLVEYLDVNEENDSYIALYEKDIVPSM-THLE 674

Query: 688  FSPTNILSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTP 747
              P  IL  +A L P+   NQSPRN YQC MGKQ +G        R D  LY +   Q P
Sbjct: 675  IEPFTILGAVAGLIPYPHHNQSPRNTYQCAMGKQAIGAIAYNQFKRIDTLLYLMTYPQQP 734

Query: 748  IVKANLYDDYGMDNFPNGTNAVVAVISYTGYDMDDAMIINKSADERGFGYGTMYKVEKVD 807
            +VK    +    D  P G NA VAV+SY+GYD++DA+++NKS+ +RGFG     +  K  
Sbjct: 735  MVKTKTIELIDYDKLPAGQNATVAVMSYSGYDIEDALVLNKSSIDRGFGRCETRR--KTT 792

Query: 808  LSLNR---------------SRGDPVTQHFGFGTDEWPKEWLDKLDEDGLPYIGTYVEEG 852
              L R                 GDP+ QH   G D   +  +    + G  YI   V   
Sbjct: 793  TVLKRYANHTQDIIGGMRVDENGDPIWQHQSLGPDGLGEVGMKV--QSGQIYINKSVPTN 850

Query: 853  DPICAYFDDTIGKTKIK----TYHSSEPAYIEEVNLIGDESNKFQELQTVSIKYRIRRTP 908
                   ++   +T+ +     Y   EP++I++V +   ++++      + +  R  R P
Sbjct: 851  SADAPNPNNVNVQTQYREAPVIYRGPEPSHIDQVMMSVSDNDQ----ALIKVLLRQNRRP 906

Query: 909  QIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLAGKA 968
            ++GDKFSSRHGQKGVC       DMPF++ GI PD+I+NPH FPSRMT+G  +E ++GKA
Sbjct: 907  ELGDKFSSRHGQKGVCGIIVKQEDMPFNDQGIVPDIIMNPHGFPSRMTVGKMIELISGKA 966

Query: 969  GALHGIAQDSTPWIFNEQDTPADYFGEQLLKAGYNYHGNEPMYSGATGEELRCDIYIGVV 1028
            G L+G  +  T +      +  +   + L+  G+NY G + +YSG TGE L+  I+ G +
Sbjct: 967  GVLNGTLEYGTCF----GGSKLEDMSKILVDQGFNYSGKDMLYSGITGECLQAYIFFGPI 1022

Query: 1029 YYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDR 1088
            YYQ+L+HMV DK   R+ GP   LT QP +GR R GG+R+GEMERD +I +G S LL +R
Sbjct: 1023 YYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCVIAYGASQLLLER 1082

Query: 1089 LLNSSDYTQAAICRECG 1105
            L+ SSD  +  +C +CG
Sbjct: 1083 LMISSDAFEVDVCDKCG 1099

>ADL275C [1466] [Homologous to ScYOR207C (RET1) - SH] (219105..222530)
            [3426 bp, 1141 aa]
          Length = 1141

 Score =  389 bits (1000), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 311/1043 (29%), Positives = 496/1043 (47%), Gaps = 118/1043 (11%)

Query: 120  PSEARQRLTSYRGKILLKLKWSVNDGENVFSEVRDCGGLPIMLQSNRCHLNKMSPHELVQ 179
            P E R R  +Y   I + ++++      +  +V + G +PIML+SN+C LN  S   + +
Sbjct: 110  PHECRLRDMTYSAPIFVDIEYTRGRSIVLHKDV-EIGKMPIMLRSNKCILNGASEEVMAK 168

Query: 180  HKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRSVRPD 239
              E   + GGYFI+NG EK+I   +VQ +     II  +   +    +     + S   +
Sbjct: 169  LNECPLDPGGYFIVNGTEKVI---LVQEQLSKNRIIVEADEKKAIVQAS----VTSSTHE 221

Query: 240  QTSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMIMKALVDTSDREIFDGIIGSNTNNSFL 299
            + S+T V+    + ++  + +    E  +P+V+++KA    SD EI   + G   N+S  
Sbjct: 222  RKSKTYVV--TKNDKIYLKHNSIAEE--VPIVIVLKACGIVSDLEIMQLVCG---NDSSY 274

Query: 300  TDRLELLLRGFKKRYPQLKNRTQVLQYLGDKFRLVFQASPDKSDYEVGQEVLNRIVLVHL 359
             D   +      K    +  + Q L+Y+G K + + +     +  + G E +   V+ HL
Sbjct: 275  QDIFAINFEEASKM--NIYTQQQALEYIGTKVKTIRRQKL--TVLQEGIEAIATTVIAHL 330

Query: 360  GSNG--NMDKFRMLLFMVRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMILKEKIDEY 417
                    +K   +  M R++   +      D+ D   ++ + L G L  ++ ++   ++
Sbjct: 331  TVEALDFREKALYVAMMTRRVIMAIHNPKMVDDRDYVGNKRLELAGQLMSLLFEDLFKKF 390

Query: 418  LQGIVAQVRTDINRGVAINFNEKKYMSRVLMRVN---DNIGSKMQYFLSTGNLVSQSGLD 474
                 A +   + +        +  M   L+ +N   +NI S +   +STGN  S     
Sbjct: 391  NNDFKASIDKVLKKP------NRAEMYDALLSINVHSNNITSGLNRAISTGNW-SLKRFK 443

Query: 475  LQQVSGYTVVAEKINFYRFISHFRMVHRGS--FFAQLKTTTVRKLLPESWGFLCPVHTPD 532
            +++ +G T V  ++++   IS   M+ R S  F    K +  R L P  +G LC   TP+
Sbjct: 444  MER-AGVTHVLSRLSY---ISALGMMTRISSQFEKSRKVSGPRALQPSQFGMLCTSDTPE 499

Query: 533  GSPCGLLNHFAHKCRISTTQSDVSKVPELLYSLGVTPASHTFAAGPSL-CCVQLDGKIIG 591
            G  CGL+ + A    I TT  +   +  L Y LGV   +   +A   L   V L+G IIG
Sbjct: 500  GEACGLVKNLALMTHI-TTDDEEEPIKNLCYLLGVEDITLLDSASIHLNYGVYLNGTIIG 558

Query: 592  WTSHEQGRVIADTLRFWKVEGETPGLPKDLEIGYVPPSSKGQYPGLYIFGGHSRMMRPVR 651
             T      V  +  R  +  G+           ++   +      ++I     R+ RP+ 
Sbjct: 559  TTRFPARFV--NQFRLLRRTGKVSE--------FISIYTNSHQKAVHIATDGGRICRPLI 608

Query: 652  Y--------------------LPLDKEDIVGPFEQVYMN------IAVTPQEIQNNIHTH 685
                                 L  D    +G  E + +N      IA+  ++I+    TH
Sbjct: 609  IVRNGKSMVTAGHLRRLLEGELQFDDFLKLGLVEYLDVNEENDSYIALYEKDIEEGT-TH 667

Query: 686  VEFSPTNILSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQ 745
            +E  P  +L  +A L P+   NQSPRN YQC MGKQ +G        R D  LY +   Q
Sbjct: 668  LEIEPFTVLGAVAGLIPYPHHNQSPRNTYQCAMGKQAIGAIAYNQFKRIDTLLYLMIYPQ 727

Query: 746  TPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYDMDDAMIINKSADERGFGYGTMYKVEK 805
             P+VK+   +    D  P G NA VAV+SY+GYD++DA++INKS+ +RGFG     K  K
Sbjct: 728  QPMVKSKTIELIDYDKLPAGQNATVAVMSYSGYDIEDALVINKSSIDRGFGRCETRK--K 785

Query: 806  VDLSLNR---------------SRGDPVTQHFGFGTDEWPKEWLDKLDEDGLPYIG--TY 848
                L R                 G+P+ QH   G D         L E G+       Y
Sbjct: 786  TTTILKRYPNHTQDIIGGMRVDENGEPIWQHQSLGPD--------GLGEVGMKVTSGQIY 837

Query: 849  VEEGDPICAYFDDTIGKTKIK------TYHSSEPAYIEEVNLIGDESNKFQELQTVSIKY 902
            + +  P  A  D  + + + +       Y + EP++I++V +   ++++      + +  
Sbjct: 838  INKSIPTNAS-DSVLNQVQSQYREAPIIYRAPEPSHIDQVMMSVSDNDQ----ALIKVLL 892

Query: 903  RIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRMTIGMFVE 962
            R  R P++GDKFSSRHGQKGVC       DMPF++ GI PD+I+NPH FPSRMT+G  +E
Sbjct: 893  RQNRRPELGDKFSSRHGQKGVCGIIVQQEDMPFNDQGICPDIIMNPHGFPSRMTVGKMLE 952

Query: 963  SLAGKAGALHGIAQDSTPWIFNEQDTPADYFGEQLLKAGYNYHGNEPMYSGATGEELRCD 1022
             ++GKAG L+G  +  T +  ++    AD   E L+  G+NY G + +Y G TGE L+  
Sbjct: 953  LVSGKAGVLNGTLEYGTCFGGSQL---AD-MSEILVNNGFNYSGKDMLYFGITGECLQAY 1008

Query: 1023 IYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTS 1082
            ++ G +YYQ+L+HMV DK   R+ GP   LT QP +GR R GG+R+GEMERD +I +G S
Sbjct: 1009 VFFGPIYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCVIAYGAS 1068

Query: 1083 FLLQDRLLNSSDYTQAAICRECG 1105
             LL +RL+ SSD  +  +C +CG
Sbjct: 1069 QLLLERLMLSSDAFEVDVCNKCG 1091

>CAGL0L02849g 332195..335596 highly similar to sp|P22276 Saccharomyces
            cerevisiae YOR207c RPC128 DNA-directed RNA polymerase
            III, hypothetical start
          Length = 1133

 Score =  389 bits (999), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 314/1039 (30%), Positives = 501/1039 (48%), Gaps = 107/1039 (10%)

Query: 118  VYPSEARQRLTSYRGKILLKLKWSVNDGENVFSEVR-DCGGLPIMLQSNRCHLNKMSPHE 176
            V P E R R  +Y   I + ++++   G N+      + G +PIML+SN+C L+      
Sbjct: 101  VPPHECRLRDMTYSAPIYVDIEYT--RGRNIIMHKNVEIGRMPIMLRSNKCILHGADEKM 158

Query: 177  LVQHKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRSV 236
            + +  E   + GGYFI+NG EK+I   +VQ +     II  +   +    +     + S 
Sbjct: 159  MARLSECPLDPGGYFIVNGTEKVI---LVQEQLSKNRIIVEADEKKDIVQAS----VTSS 211

Query: 237  RPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMIMKALVDTSDREIFDGIIGSNTNN 296
              ++ S+T V+    +G++  + +    E  +P+V+++KA    SD EI   + G   N+
Sbjct: 212  THERKSKTYVV--TKNGKIYLKHNSIAEE--VPIVIVLKAAGIISDLEIMQLVCG---ND 264

Query: 297  SFLTDRLELLLRGFKKRYPQLKNRTQVLQYLGDKFRLVFQASPDKSDYEVGQEVLNRIVL 356
            S   D   + L    K    +  + Q L+Y+G K + + +     +  + G E +   ++
Sbjct: 265  SSYQDIFSVNLEEAAKL--NICTQQQALEYIGAKVKTMRRQKL--TILQEGIEAIATTII 320

Query: 357  VHLGSNG--NMDKFRMLLFMVRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMILKE-- 412
             HL        +K   +  M R++   +      D+ D   ++ + L G L  ++ ++  
Sbjct: 321  AHLTVEALDFREKALYIATMTRRVVMAMHNPKMVDDRDYVGNKRLELAGQLISLLFEDLF 380

Query: 413  -KIDEYLQGIVAQVRTDINRGVAINFNEKKYMSRVLMRVN---DNIGSKMQYFLSTGNLV 468
             K +   +  + +V    NR +  +          L+ +N   +NI S +   +STGN  
Sbjct: 381  KKFNNDFKLSIDKVLKKPNRAMEYD---------ALLSINVHSNNITSGLNRAISTGNW- 430

Query: 469  SQSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGS--FFAQLKTTTVRKLLPESWGFLC 526
            S     +++ +G T V  ++++   IS   M+ R S  F    K +  R L P  +G LC
Sbjct: 431  SLKRFKMER-AGVTHVLSRLSY---ISALGMMTRISSQFEKSRKVSGPRALQPSQFGMLC 486

Query: 527  PVHTPDGSPCGLLNHFAHKCRISTTQSDVSKVPELLYSLGVTPASHTFAAGPSL-CCVQL 585
               TP+G  CGL+ + A    I TT  +   + +L Y LGV P S   +A   L   V L
Sbjct: 487  TADTPEGEACGLVKNLALMTHI-TTDDEEEPIRKLCYVLGVEPISLLDSASLHLNYGVYL 545

Query: 586  DGKIIGWTSHEQGRVIADTLRFWKVEGETPGLPKDLEIGYVPPSSKGQYPGLYIFGGHSR 645
            +G +IG T      V     RF +  G+           ++   +   +  ++I     R
Sbjct: 546  NGTLIGTTKFPSNFV--SRFRFLRRTGKVSE--------FISIYTNDHHNAVHIATDGGR 595

Query: 646  MMRPVRYLPLDKEDI--------------------VGPFEQVYMN------IAVTPQEIQ 679
            + RP+  +   K  +                    +G  E + +N      IA+  ++I 
Sbjct: 596  ICRPLIIVKDGKSMVEAEHLKRLLSGELVFDDFLKLGLVEYLDVNEENDSYIALYEKDIT 655

Query: 680  NNIHTHVEFSPTNILSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLY 739
            ++I TH+E  P  +L  +A L P+   NQSPRN YQC MGKQ +G        R D  LY
Sbjct: 656  HDI-THLEIEPFTVLGAVAGLIPYPHHNQSPRNTYQCAMGKQAIGAIAYNQFKRIDTLLY 714

Query: 740  RLQTGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYDMDDAMIINKSADERGFGYGT 799
             +   Q P+VK    +    D  P G NA VAV+SY+GYD++DA+++NKS+ +RGFG   
Sbjct: 715  LMIYPQQPMVKTKTIELIDYDKLPAGQNATVAVMSYSGYDIEDALVLNKSSIDRGFGRCE 774

Query: 800  MYKVEKVDLSLNRSRGDPVTQHFGFGTDE-----WPKEWL--DKLDEDGLPYIG--TYVE 850
              +  K    L +          G   DE     W  E L  D L E GL       Y+ 
Sbjct: 775  TRR--KTTTVLKKYPNHTKDALCGMRVDENGEAIWQHESLGPDGLGEVGLKIRSGQIYIN 832

Query: 851  EGDPICAYFDDTIGKTKIK----TYHSSEPAYIEEVNLIGDESNKFQELQTVSIKYRIRR 906
            +  P+ +     + + + +     Y + E + I++V +    S+  Q+L  + +  R  R
Sbjct: 833  KSVPVQSSDAMAVNQAQYRETPVIYRAPELSIIDQVMM--STSDNDQDL--IKVLLRQNR 888

Query: 907  TPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLAG 966
             P++GDKFSSRHGQKGVC       DMPF++ GI PD+I+NPH FPSRMT+G  +E ++G
Sbjct: 889  RPELGDKFSSRHGQKGVCGIIVQQEDMPFNDQGICPDIIMNPHGFPSRMTVGKMIELISG 948

Query: 967  KAGALHGIAQDSTPWIFNEQDTPADYFGEQLLKAGYNYHGNEPMYSGATGEELRCDIYIG 1026
            KAG L+G  +  T +      +  +   + L+  G+NY G + +YSG TGE L+  I+ G
Sbjct: 949  KAGVLNGSLEYGTCF----GGSKLEDMSKILVDQGFNYSGKDMLYSGITGECLQAYIFFG 1004

Query: 1027 VVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQ 1086
             +YYQ+L+HMV DK   R+ GP   LT QP +GR R GG+R+GEMERD +I +G S LL 
Sbjct: 1005 PIYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCVIAYGASQLLL 1064

Query: 1087 DRLLNSSDYTQAAICRECG 1105
            +RL+ SSD  +  +C  CG
Sbjct: 1065 ERLMISSDAFEVDVCSNCG 1083

>KLLA0F01078g 98331..101759 highly similar to sp|P22276 Saccharomyces
            cerevisiae YOR207c RPC128 DNA-directed RNA polymerase
            III, 130 KD subunit, hypothetical start
          Length = 1142

 Score =  386 bits (992), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 311/1040 (29%), Positives = 504/1040 (48%), Gaps = 112/1040 (10%)

Query: 120  PSEARQRLTSYRGKILLKLKWSVNDGENVFSEVRDCGGLPIMLQSNRCHLNKMSPHELVQ 179
            P E R R  +Y   I + ++++      +  +V + G +PIML+SN+C L+  + +++ +
Sbjct: 111  PHECRLRDMTYSTPIFVDIEYTRGRSIVLHRDV-EIGRMPIMLRSNKCILDGAAENDMAK 169

Query: 180  HKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRSVRPD 239
              E   + GGYFI+NG EK+I   +VQ +     II  +   +    +     + S   +
Sbjct: 170  LNECPLDPGGYFIVNGTEKVI---LVQEQLSKNRIIVEADEKKNIVQAS----VTSSTHE 222

Query: 240  QTSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMIMKALVDTSDREIFDGIIGSNTNNSFL 299
            + S+T V+    + ++  + +    E  +P+V+++KA    SD EI   + G   N+S  
Sbjct: 223  RKSKTYVV--TKNDKIYLKHNSIAEE--VPIVVVLKACGVVSDLEIMQLVCG---NDSSY 275

Query: 300  TDRLELLLRGFKKRYPQLKNRTQVLQYLGDKFRLVFQASPDKSDYEVGQEVLNRIVLVHL 359
             D   + L    +   ++  + Q L+++G K + V +     S  + G E +   V+ HL
Sbjct: 276  QDIFAVNLEEAAEL--KIYTQQQALEFIGTKVKTVRRQKL--SILQEGIEAIATTVIAHL 331

Query: 360  GSNG--NMDKFRMLLFMVRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMILKEKIDEY 417
                    +K   +  M R++   +      D+ D   ++ + L G L  ++ ++   ++
Sbjct: 332  TVEALDFREKALYIAMMTRRVVMAIDNPKMVDDRDYVGNKRLELAGQLMSLLFEDLFKKF 391

Query: 418  LQGIVAQVRTDINRGVAINFNEKKYMSRVLMRVN---DNIGSKMQYFLSTGNLVSQSGLD 474
                 A +   + +        +  M   L+ +N   +NI + M   +STGN  S     
Sbjct: 392  NNDFKANIDKVLKKP------NRAEMYDALLTINVHSNNITTGMNRAISTGNW-SLKRFK 444

Query: 475  LQQVSGYTVVAEKINFYRFISHFRMVHRGS--FFAQLKTTTVRKLLPESWGFLCPVHTPD 532
            +++ +G T V  ++++   IS   M+ R S  F    K +  R L P  +G LC   TP+
Sbjct: 445  MER-AGVTHVLSRLSY---ISALGMMTRISSQFEKSRKVSGPRALQPSQFGMLCTSDTPE 500

Query: 533  GSPCGLLNHFAHKCRISTTQSDVSKVPELLYSLGVTPASHTFAAGPSLCC-VQLDGKIIG 591
            G  CGL+ + A    I TT  +   +  + Y LGV   S   +A   L   V L+G IIG
Sbjct: 501  GEACGLVKNLALMTHI-TTDDEEEPIKRICYLLGVEDISLIDSASIHLNYGVYLNGTIIG 559

Query: 592  WTSH-----EQGRVIADTLRFWK-VEGETPGLPKDLEIGYVPPSSKGQYPGLYIFGGHSR 645
             T        Q R +  T R  + +   T    K + I       +   P + +  G S 
Sbjct: 560  TTRFPTKFVSQFRCLRRTGRASEFISIYTNTHQKAVHIA--TDGGRICRPLIIVSNGQSS 617

Query: 646  M----MRPVRYLPLDKEDIV--GPFEQVYMN------IAVTPQEIQNNIHTHVEFSPTNI 693
            +    +R +    L  +D +  G  E + +N      IA+  +++  NI TH+E     +
Sbjct: 618  VTADHLRSLLAGKLQFDDFLKLGLVEYLDVNEENDSFIALYEKDLSENI-THLEIESFTV 676

Query: 694  LSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANL 753
            L  +A L P+   NQSPRN YQC MGKQ +G        R D  LY +   Q P+VK   
Sbjct: 677  LGAVAGLIPYPHHNQSPRNTYQCAMGKQAIGAIAYNQFKRIDTLLYLMIYPQQPMVKTKT 736

Query: 754  YDDYGMDNFPNGTNAVVAVISYTGYDMDDAMIINKSADERGFGYGTMYKVEKVDLSLNR- 812
             +    D  P G NA VAV+SY+GYD++DA+++NK++ +RGFG     +  K    L R 
Sbjct: 737  IELIDYDKLPAGQNATVAVMSYSGYDIEDALVLNKASIDRGFGRCETRR--KNTTVLKRY 794

Query: 813  --------------SRGDPVTQHFGFGTDEWPKEWLDKLDEDGLPYIGTYVEEGD----- 853
                            G+P+ QH   G D             GL  +G  VE G      
Sbjct: 795  PNHTQDIIGGMRVDENGEPIWQHQALGPD-------------GLGEVGMKVESGQIYVNK 841

Query: 854  --PICAYFDDTIGKTKIK------TYHSSEPAYIEEVNLIGDESNKFQELQTVSIKYRIR 905
              P  A  D  + +T+ +       Y + EP++I++V +   ++++      + +  R  
Sbjct: 842  SVPTNAS-DSILTQTQAQYKETPVVYRAPEPSHIDQVMMSVSDNDQ----ALIKVLLRQN 896

Query: 906  RTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLA 965
            R P++GDKFSSRHGQKGVC       D+PF++ G+ PD+I+NPH FPSRMT+G  +E ++
Sbjct: 897  RRPELGDKFSSRHGQKGVCGIIVKQEDLPFNDQGVVPDIIMNPHGFPSRMTVGKMIELIS 956

Query: 966  GKAGALHGIAQDSTPWIFNEQDTPADYFGEQLLKAGYNYHGNEPMYSGATGEELRCDIYI 1025
            GKAG L+G  +  T +      +  +   + L+  G+NY G + +YSG TGE L+  I+ 
Sbjct: 957  GKAGVLNGTLEYGTCF----GGSKLEDMSKILVDNGFNYSGKDMLYSGITGECLQAYIFF 1012

Query: 1026 GVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLL 1085
            G +YYQ+L+HMV DK   R+ GP   LT QP +GR R GG+R+GEMERD +I +G S LL
Sbjct: 1013 GPIYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCVIAYGASQLL 1072

Query: 1086 QDRLLNSSDYTQAAICRECG 1105
             +RL+ SSD  +  +C +CG
Sbjct: 1073 LERLMLSSDAFEVDVCEKCG 1092

>Kwal_47.18783
          Length = 1220

 Score =  374 bits (960), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 334/1147 (29%), Positives = 502/1147 (43%), Gaps = 186/1147 (16%)

Query: 85   SDYLGNKLSISVEQVSIAKP--TANDGVMGAAERPVYPSEARQRLTSYRGKILLK----- 137
            +D +  K  IS  ++ +AKP  T +DGV  A    +YP EAR R  +Y   + ++     
Sbjct: 77   TDNISRKYEISFGKIYLAKPSMTESDGVSHA----MYPQEARLRNLTYASGLFVEIRKRT 132

Query: 138  ----------LKWSVNDGENVFSEVRDC--GGLPIMLQSNRCHLNKMSPHELVQHKEESD 185
                      LK+ V D E+  S+      G +PIML+S  C L++++  +L + KE   
Sbjct: 133  YEAVDIPGRDLKYEVIDEESEMSDENKIFIGRVPIMLRSKYCLLDELTESDLYKLKECPF 192

Query: 186  ELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRSV-----RPDQ 240
            ++GGYFIING EK+   LI Q R+     I   F     S   +  +IRS      R   
Sbjct: 193  DMGGYFIINGSEKV---LIAQERS--AGNIVQVFKKSAPSPISHIAEIRSALEKGSRFIS 247

Query: 241  TSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMIMKALVDTSDREIFDGIIGSNTNNSFLT 300
            T Q  +     +   T + +    +  IP+V+I +AL    D EI + I     +   L 
Sbjct: 248  TLQVKLYGREGNTNRTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLE 307

Query: 301  DRLELLLRGFKKRYPQLKNRTQVLQYLGDKFRLVFQASPDKSDYEVGQEVLNRIVLVHLG 360
                 +  GF      +++R   L ++G +   +      +  Y   +++L +  L H+ 
Sbjct: 308  LLKPCVEEGF-----VIQDRETALDFIGRRGTALGIKKEKRIQY--AKDILQKEFLPHIT 360

Query: 361  SNGNMD--KFRMLLFMVRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMILKEKIDEYL 418
                 +  K   L +M+ +L          D+ D    + + L G L   + K       
Sbjct: 361  QLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFKT------ 414

Query: 419  QGIVAQVRTDINRGVAINFNEKKYMSRVLMRVNDNIGSKMQYFLSTGNLVSQSGLDLQQV 478
              +  ++  DI R +  +  E K  +  L      I + ++Y L+TGN   Q    +   
Sbjct: 415  --LFRKLTRDILRFMQRSVEEAKDFNLKLAVKATTITAGLKYALATGNWGEQKKA-MTSR 471

Query: 479  SGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGL 538
            +G + V  +  +   +SH R  +        K    R+L    WG +CP  TP+G  CGL
Sbjct: 472  AGVSQVLNRYTYSSTLSHLRRTN-TPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGL 530

Query: 539  LNHFAHKCRISTTQSDVSKVPELLYSLGVTP-ASHTFAAGPSLCCVQLDGKIIGWTSHEQ 597
            + + +    IS   +D   +   L   G+ P   +     P    V ++G   G   H  
Sbjct: 531  VKNLSLMSCISVG-TDPLPIITFLNEWGMEPLEDYVPHQSPDATRVFVNGVWHGI--HRN 587

Query: 598  GRVIADTLRFWKVEGE-TPGLPKDLEIGYVPPSSKGQYPGLYIFGGHSRMMRP------- 649
               + DT+R  + +G+ TP      E+  V    + +   L IF    R+ RP       
Sbjct: 588  PAKLVDTIRKLRRKGDVTP------EVSIVRDIREKE---LKIFTDAGRVYRPLFIVDEN 638

Query: 650  ----VRYLPLDK-----------EDIVGPFEQVYMN------------------------ 670
                V+ L L K           +DI G FE+  +N                        
Sbjct: 639  ESTGVKELKLRKGHVRKLMMTEYQDIEGGFEEEDINYTWTSLLNEGLVEYIDAEEEETIL 698

Query: 671  IAVTPQEI-----------------------QNNIHTHVEFSPTNILSILANLTPFSDFN 707
            IA+  +++                        +N  TH E  P+ IL + A++ PF D N
Sbjct: 699  IAMQHEDLDPSFEADDPEGELDPAKRIKAIHHSNTFTHCEIHPSMILGVAASIIPFPDHN 758

Query: 708  QSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGTN 767
            QSPRN YQ  MGKQ MG        R D     L   Q P+      +       P G N
Sbjct: 759  QSPRNTYQSAMGKQAMGVFLTNYSVRMDTMANILYYPQKPLGTTRSMEYLKFRELPAGQN 818

Query: 768  AVVAVISYTGYDMDDAMIINKSADERG-----FGYGTMYKVEKVDLSLNRSRGDPV---T 819
            A+VA+  Y+GY+ +D+MI+N+S+ +RG     F    M + +++ +S+  S   P    T
Sbjct: 819  AIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKRIGMSITESFEKPQRTNT 878

Query: 820  QHFGFGTDEWPKEWLDKLDEDGLPYIGTYVEEGDPICAYFDDTIGKT-----------KI 868
                 GT        DKLD+DGL   G  V   D I       IGKT           + 
Sbjct: 879  LRMKHGT-------YDKLDDDGLIAPGVRVSGDDMI-------IGKTTPIPPDAEELGQR 924

Query: 869  KTYHS----------SEPAYIEEVNLIGDESNKFQELQTVSIKYRIRRTPQIGDKFSSRH 918
              +HS          +E   +++V +  ++      L+ V ++ R  + PQIGDKF+SRH
Sbjct: 925  TAFHSKRDASTPLRSTENGIVDQVLITTNQEG----LKFVKVRVRTTKVPQIGDKFASRH 980

Query: 919  GQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLAGKAGALHGIAQDS 978
            GQKG     +   DMPF+  GI PD+IINPHA PSRMT+   +E L  K  AL G   D+
Sbjct: 981  GQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGNEGDA 1040

Query: 979  TPWIFNEQDTPADYFGEQLLKAGYNYHGNEPMYSGATGEELRCDIYIGVVYYQRLRHMVN 1038
            +P+     D   D     L + GY   G E MY+G TG++L   I+ G  YYQRLRHMV+
Sbjct: 1041 SPFT----DITVDGISRLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVD 1096

Query: 1039 DKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNSSDYTQA 1098
            DK   R+ GPV  LT QPV+GR R GG+R GEMERD +I HG +  L++RL+ +SD  + 
Sbjct: 1097 DKIHARARGPVQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAAAFLKERLMEASDAFRV 1156

Query: 1099 AICRECG 1105
             IC  CG
Sbjct: 1157 HICGVCG 1163

>YOR151C (RPB2) [4950] chr15 complement(612997..616671) RNA polymerase
            II, second-largest subunit [3675 bp, 1224 aa]
          Length = 1224

 Score =  368 bits (945), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 331/1153 (28%), Positives = 499/1153 (43%), Gaps = 198/1153 (17%)

Query: 85   SDYLGNKLSISVEQVSIAKPTAN--DGVMGAAERPVYPSEARQRLTSYRGKILLKLKWSV 142
            SD +  K  IS  ++ + KP  N  DGV  A    +YP EAR R  +Y   + + +K   
Sbjct: 81   SDNISRKYEISFGKIYVTKPMVNESDGVTHA----LYPQEARLRNLTYSSGLFVDVKKRT 136

Query: 143  NDG----------ENVFSEVRD--------CGGLPIMLQSNRCHLNKMSPHELVQHKEES 184
             +           E +  E  D         G LPIML+S  C+L++ +  +L + KE  
Sbjct: 137  YEAIDVPGRELKYELIAEESEDDSESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECP 196

Query: 185  DELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRSV-----RPD 239
             ++GGYFIING EK+   LI Q R+     I   F     S   +  +IRS      R  
Sbjct: 197  FDMGGYFIINGSEKV---LIAQERS--AGNIVQVFKKAAPSPISHVAEIRSALEKGSRFI 251

Query: 240  QTSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMIMKALVDTSDREIFDGIIGSNTNNSFL 299
             T Q  +         T + +    +  IP+V+I +AL    D EI + I     +   L
Sbjct: 252  STLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQML 311

Query: 300  TDRLELLLRGFKKRYPQLKNRTQVLQYLGDKFRLVFQASPDKSDYEVGQEVLNRIVLVHL 359
                  +  GF      +++R   L ++G +   +      +  Y   +++L +  L H+
Sbjct: 312  EMLKPCVEDGF-----VIQDRETALDFIGRRGTALGIKKEKRIQY--AKDILQKEFLPHI 364

Query: 360  GSNGNMD--KFRMLLFMVRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMILK------ 411
                  +  K   L +M+ +L          D+ D    + + L G L   + K      
Sbjct: 365  TQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFKTLFKKL 424

Query: 412  -EKIDEYLQGIVAQVRTDINRGVAINFNEKKYMSRVLMRVNDNIGSKMQYFLSTGNLVSQ 470
             + I  Y+Q  V +   D N  +AIN                 I S ++Y L+TGN   Q
Sbjct: 425  TKDIFRYMQRTVEEAH-DFNMKLAINAK--------------TITSGLKYALATGNWGEQ 469

Query: 471  SGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHT 530
                +   +G + V  +  +   +SH R  +        K    R+L    WG +CP  T
Sbjct: 470  KKA-MSSRAGVSQVLNRYTYSSTLSHLRRTN-TPIGRDGKLAKPRQLHNTHWGLVCPAET 527

Query: 531  PDGSPCGLLNHFAHKCRISTTQSDVSKVPELLYSLGVTP-ASHTFAAGPSLCCVQLDGKI 589
            P+G  CGL+ + +    IS   +D   +   L   G+ P   +     P    V ++G  
Sbjct: 528  PEGQACGLVKNLSLMSCISVG-TDPMPIITFLSEWGMEPLEDYVPHQSPDATRVFVNGVW 586

Query: 590  IGWTSHEQGRVIADTLRFWKVEGETPGLPKDLEIGYVPPSSKGQYPGLYIFGGHSRMMRP 649
             G   H     + +TLR  + +G+      + E+  +    + +   L IF    R+ RP
Sbjct: 587  HG--VHRNPARLMETLRTLRRKGDI-----NPEVSMIRDIREKE---LKIFTDAGRVYRP 636

Query: 650  V----------------------RYLPLDKEDIVGPFEQV---------------YMN-- 670
            +                      + +  + +DI G FE V               Y++  
Sbjct: 637  LFIVEDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAE 696

Query: 671  ------IAVTPQEIQ-------NNIH----------------THVEFSPTNILSILANLT 701
                  IA+ P++++       N++                 TH E  P+ IL + A++ 
Sbjct: 697  EEESILIAMQPEDLEPAEANEENDLDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASII 756

Query: 702  PFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDN 761
            PF D NQSPRN YQ  MGKQ MG        R D     L   Q P+      +      
Sbjct: 757  PFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQKPLGTTRAMEYLKFRE 816

Query: 762  FPNGTNAVVAVISYTGYDMDDAMIINKSADERG-----FGYGTMYKVEKVDLSLNRSRGD 816
             P G NA+VA+  Y+GY+ +D+MI+N+S+ +RG     F    M + +K  +S+  +   
Sbjct: 817  LPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEK 876

Query: 817  PV---TQHFGFGTDEWPKEWLDKLDEDGLPYIGTYVEEGDPICAYFDDTIGKT------- 866
            P    T     GT        DKLD+DGL   G  V   D I       IGKT       
Sbjct: 877  PQRTNTLRMKHGT-------YDKLDDDGLIAPGVRVSGEDVI-------IGKTTPISPDE 922

Query: 867  ----KIKTYHS----------SEPAYIEEVNLIGDESNKFQELQTVSIKYRIRRTPQIGD 912
                +   YHS          +E   +++V +  ++      L+ V ++ R  + PQIGD
Sbjct: 923  EELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG----LKFVKVRVRTTKIPQIGD 978

Query: 913  KFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLAGKAGALH 972
            KF+SRHGQKG     +   DMPF+  GI PD+IINPHA PSRMT+   +E L  K  AL 
Sbjct: 979  KFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALS 1038

Query: 973  GIAQDSTPWIFNEQDTPADYFGEQLLKAGYNYHGNEPMYSGATGEELRCDIYIGVVYYQR 1032
            G   D++P+     D   +   + L + GY   G E MY+G TG++L   I+ G  YYQR
Sbjct: 1039 GNEGDASPFT----DITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQR 1094

Query: 1033 LRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNS 1092
            LRHMV+DK   R+ GP+  LT QPV+GR R GG+R GEMERD +I HG +  L++RL+ +
Sbjct: 1095 LRHMVDDKIHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAASFLKERLMEA 1154

Query: 1093 SDYTQAAICRECG 1105
            SD  +  IC  CG
Sbjct: 1155 SDAFRVHICGICG 1167

>AFR404C [3596] [Homologous to ScYOR151C (RPB2) - SH]
            (1162949..1166617) [3669 bp, 1222 aa]
          Length = 1222

 Score =  364 bits (934), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 331/1144 (28%), Positives = 493/1144 (43%), Gaps = 178/1144 (15%)

Query: 85   SDYLGNKLSISVEQVSIAKP--TANDGVMGAAERPVYPSEARQRLTSYRGKILLKLKWSV 142
            +D +  K  IS  ++ +AKP  T +DGV  A    +YP EAR R  +Y   + +++K   
Sbjct: 77   ADNISRKYEISFGKIYLAKPSMTESDGVSHA----MYPQEARLRNLTYASGLFVEIKKRT 132

Query: 143  NDG----------ENVFSEVRDC-------GGLPIMLQSNRCHLNKMSPHELVQHKEESD 185
             +           E +  E  D        G +PIML+S  C L+ +S  +L + KE   
Sbjct: 133  YEAVDIPGRDLKYEIIQEESEDTEEGKIFIGRVPIMLRSKYCLLDDLSESDLYRLKECPF 192

Query: 186  ELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRSVRPDQT---S 242
            ++GGYFIING EK+   LI Q R+     I   F     S   +  +IRS     +   S
Sbjct: 193  DMGGYFIINGSEKV---LIAQERS--AGNIVQVFKKSAPSPISHIAEIRSALEKGSRFIS 247

Query: 243  QTNVLHYLNDGQV--TFRFSWRKNEYLIPVVMIMKALVDTSDREIFDGIIGSNTNNSFLT 300
               V  Y  +G    T + +    +  IP+V+I +AL    D EI + I     +   L 
Sbjct: 248  TLQVKLYGREGSTSRTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDQNDWQMLE 307

Query: 301  DRLELLLRGFKKRYPQLKNRTQVLQYLGDKFRLVFQASPDKSDYEVGQEVLNRIVLVHLG 360
                 +  GF      +++R   L ++G +   +      +  Y   +++L +  L H+ 
Sbjct: 308  MLKPCVEEGFV-----IQDRETALDFIGRRGTALGIKKEKRIQY--AKDILQKEFLPHIT 360

Query: 361  SNGNMD--KFRMLLFMVRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMILKEKIDEYL 418
                 +  K   L +M+ +L          D+ D    + + L G L   + K       
Sbjct: 361  QLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFKT------ 414

Query: 419  QGIVAQVRTDINRGVAINFNEKKYMSRVLMRVNDNIGSKMQYFLSTGNLVSQSGLDLQQV 478
              +  ++  DI R +  +  E K  +  L      I + ++Y L+TGN   Q    +   
Sbjct: 415  --LFRKLTRDILRFMQRSVEEAKDFNLKLAVKATTITAGLKYALATGNWGEQKKA-MSSR 471

Query: 479  SGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGL 538
            +G + V  +  +   +SH R  +        K    R+L    WG +CP  TP+G  CGL
Sbjct: 472  AGVSQVLNRYTYSSTLSHLRRTN-TPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGL 530

Query: 539  LNHFAHKCRISTTQSDVSKVPELLYSLGVTP-ASHTFAAGPSLCCVQLDGKIIGWTSHEQ 597
            + + +    IS   +D   +   L   G+ P   +     P    V ++G   G   H  
Sbjct: 531  VKNLSLMSCISVG-TDPVPIITFLNEWGMEPLEDYVPHQSPDATRVFVNGVWHGI--HRN 587

Query: 598  GRVIADTLRFWKVEGETPGLPKDLEIGYVPPSSKGQYPGLYIFGGHSRMMRP-------- 649
               + DT+R  + +G+        E+  V    + +   L IF    R+ RP        
Sbjct: 588  PARLVDTIRKLRRKGDITA-----EVSIVRDIREKE---LKIFTDAGRVYRPLFVVADTQ 639

Query: 650  --------------VRYLPLDK-EDIVGPFEQVYMNIAVT-------------------- 674
                          +R L L + +DI G FE   +N   T                    
Sbjct: 640  HADGHKDLKVRKGHIRKLMLTEYQDIEGGFEDEDINYTWTSLLNDGIVEYIDAEEEETIL 699

Query: 675  ------------PQEI----------------QNNIHTHVEFSPTNILSILANLTPFSDF 706
                        PQ +                 +N  TH E  P+ IL + A++ PF D 
Sbjct: 700  IAMQQEDLDPSVPQTVDPSDELDPARRIKAIHHSNTFTHCEIHPSMILGVAASVIPFPDH 759

Query: 707  NQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGT 766
            NQSPRN YQ  MGKQ MG        R D     L   Q P+      +       P G 
Sbjct: 760  NQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQKPLGTTRAMEYLKFRELPAGQ 819

Query: 767  NAVVAVISYTGYDMDDAMIINKSADERG-----FGYGTMYKVEKVDLSLNRSRGDP---V 818
            NA+VA+  Y+GY+ +D+MI+N+S+ + G     F    M + +++ +S+  S   P    
Sbjct: 820  NAIVAIACYSGYNQEDSMIMNQSSIDSGLFRSLFFRSYMDQEKRIGMSITESFEKPHRTN 879

Query: 819  TQHFGFGTDEWPKEWLDKLDEDGLPYIGTYVEEGDPICAYFDDTIGKT-----------K 867
            T     GT E       KLD+DGL   G  V   D I       IGKT           +
Sbjct: 880  TLRMKHGTYE-------KLDDDGLIAPGVRVSGDDII-------IGKTTPIPPDAEELGQ 925

Query: 868  IKTYHSSEPAYI---EEVNLIGDE---SNKFQELQTVSIKYRIRRTPQIGDKFSSRHGQK 921
               +HS   A        N I D+   +   + L+ V ++ R  + PQIGDKF+SRHGQK
Sbjct: 926  RTAFHSKRDASTPLRSTENGIVDQVLITTNQEGLKFVKVRVRTTKVPQIGDKFASRHGQK 985

Query: 922  GVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLAGKAGALHGIAQDSTPW 981
            G     +   DMPF+  G+ PD+IINPHA PSRMT+   +E L  K  AL G   D++P+
Sbjct: 986  GTIGITYRREDMPFTAEGVVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGNEGDASPF 1045

Query: 982  IFNEQDTPADYFGEQLLKAGYNYHGNEPMYSGATGEELRCDIYIGVVYYQRLRHMVNDKF 1041
                 D   D   + L + GY   G E MY+G TG++L   I+ G  YYQRLRHMV+DK 
Sbjct: 1046 T----DITVDGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKI 1101

Query: 1042 QVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNSSDYTQAAIC 1101
              R+ GP+  LT QPV+GR R GG+R GEMERD +I HG +  L++RL+ +SD  +  IC
Sbjct: 1102 HARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAAAFLKERLMEASDAFRVHIC 1161

Query: 1102 RECG 1105
              CG
Sbjct: 1162 GICG 1165

>CAGL0L04246g complement(493026..496697) highly similar to sp|P08518
            Saccharomyces cerevisiae YOR151c RPB2 DNA-directed RNA
            polymerase II, hypothetical start
          Length = 1223

 Score =  363 bits (931), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 330/1155 (28%), Positives = 493/1155 (42%), Gaps = 203/1155 (17%)

Query: 86   DYLGNKLSISVEQVSIAKPTAN--DGVMGAAERPVYPSEARQRLTSYRGKILLKLKWSVN 143
            D +  K  IS  ++ + KP  N  DGV  A    +YP EAR R  +Y   + + +     
Sbjct: 80   DNISRKYEISFGKIYVTKPMVNESDGVTHA----LYPQEARLRNLTYSSGLFVDVTKRTY 135

Query: 144  DGENVFSEVRDC--------------------GGLPIMLQSNRCHLNKMSPHELVQHKEE 183
            +  +V    RD                     G LPIML+S  C+L+  +  +L + KE 
Sbjct: 136  EAVDVPG--RDLNYQLIAEESEEDSESGKVFIGRLPIMLRSKNCYLSDATESDLYKLKEC 193

Query: 184  SDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRSV-----RP 238
              ++GGYFIING EK+   LI Q R+     I   F     S   +  +IRS      R 
Sbjct: 194  PFDMGGYFIINGSEKV---LIAQERS--AGNIVQVFKKAAPSPISHVAEIRSALEKGSRF 248

Query: 239  DQTSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMIMKALVDTSDREIFDGIIGSNTNNSF 298
              T Q  +    +    T + +    +  IP+V+I +AL    D EI + I     +   
Sbjct: 249  ISTLQVKLYGRESSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQM 308

Query: 299  LTDRLELLLRGFKKRYPQLKNRTQVLQYLGDKFRLVFQASPDKSDYEVGQEVLNRIVLVH 358
            L      +  GF      +++R   L ++G +   +      +  Y   +++L +  L H
Sbjct: 309  LEMLKPCVEDGFV-----IQDRETALDFIGRRGTALGIKKEKRIQY--AKDILQKEFLPH 361

Query: 359  LGSNGNMD--KFRMLLFMVRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMILK----- 411
            +      +  K   L +M+ +L          D+ D    + + L G L   + K     
Sbjct: 362  ITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFKTLFRK 421

Query: 412  --EKIDEYLQGIVAQVRTDINRGVAINFNEKKYMSRVLMRVNDNIGSKMQYFLSTGNLVS 469
              + I  Y+Q  V +   D N  +AIN                 I S ++Y L+TGN   
Sbjct: 422  LTKDIFRYMQRTVEEA-NDFNMKLAINAK--------------TITSGLKYALATGNWGE 466

Query: 470  QSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVH 529
            Q    +   +G + V  +  +   +SH R  +        K    R+L    WG +CP  
Sbjct: 467  QKKA-MSSRAGVSQVLNRYTYSSTLSHLRRTN-TPIGRDGKLAKPRQLHNTHWGLVCPAE 524

Query: 530  TPDGSPCGLLNHFAHKCRISTTQSDVSKVPELLYSLGVTP-ASHTFAAGPSLCCVQLDGK 588
            TP+G  CGL+ + +    IS   +D   +   L   G+ P   +     P    V ++G 
Sbjct: 525  TPEGQACGLVKNLSLMSCISVG-ADPMPIITFLSEWGMEPLEDYVPHQSPDATRVFVNGV 583

Query: 589  IIGWTSHEQGRVIADTLRFWKVEGETPGLPKDLEIGYVPPSSKGQYPGLYIFGGHSRMMR 648
              G   H     + +TLR  + +G+      + E+  +    + +   L IF    R+ R
Sbjct: 584  WHG--VHRNPARLMETLRTLRRKGDI-----NPEVSMIRDIREQE---LKIFTDAGRVYR 633

Query: 649  PVRYLPLDKE----------------------DIVGPFEQV---------------YMN- 670
            P+  +  D+E                      DI G FE                 Y++ 
Sbjct: 634  PLFIVEDDEELGRKELKVRKGHVAKLMATEYQDIEGGFEDAEDYTWSSLLNEGLVEYIDA 693

Query: 671  -------IAVTPQEIQ------------------------NNIHTHVEFSPTNILSILAN 699
                   IA+ P++++                            TH E  P+ IL + A+
Sbjct: 694  EEEESILIAMQPEDLEPTAVEQDIPKENVDLAKRIKVTHHATTFTHCEIHPSMILGVAAS 753

Query: 700  LTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGM 759
            + PF D NQSPRN YQ  MGKQ MG        R D     L   Q P+      +    
Sbjct: 754  IIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNFRMDTMANILYYPQKPLGTTRAMEYLKF 813

Query: 760  DNFPNGTNAVVAVISYTGYDMDDAMIINKSADERG-----FGYGTMYKVEKVDLSLNRSR 814
               P G NA+VA+  Y+GY+ +D+MI+N+S+ +RG     F    M + +K  +S+  + 
Sbjct: 814  RELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETF 873

Query: 815  GDPV---TQHFGFGTDEWPKEWLDKLDEDGLPYIGTYVEEGDPICAYFDDTIGKT----- 866
              P    T     GT        DKLDEDGL   G  V   D I       IGKT     
Sbjct: 874  EKPQRTNTLRMKHGT-------YDKLDEDGLIAPGVRVSGEDII-------IGKTTPIAP 919

Query: 867  ------KIKTYHS----------SEPAYIEEVNLIGDESNKFQELQTVSIKYRIRRTPQI 910
                  +   YHS          +E   +++V +  ++      L+ V ++ R  + PQI
Sbjct: 920  DEEELGQRTAYHSKRDASTPLRSTENGIVDQVLITTNQDG----LKFVKVRVRTTKVPQI 975

Query: 911  GDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLAGKAGA 970
            GDKF+SRHGQKG     +   DMPF+  GI PD+IINPHA PSRMT+   +E L  K  A
Sbjct: 976  GDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAA 1035

Query: 971  LHGIAQDSTPWIFNEQDTPADYFGEQLLKAGYNYHGNEPMYSGATGEELRCDIYIGVVYY 1030
            L G   D++P+     D   +   + L + GY   G E MY+G TG++L   I+ G  YY
Sbjct: 1036 LSGNEGDASPFT----DITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYY 1091

Query: 1031 QRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLL 1090
            QRLRHMV+DK   R+ GP+  LT QPV+GR R GG+R GEMERD +I HG +  L++RL+
Sbjct: 1092 QRLRHMVDDKIHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAAAFLKERLM 1151

Query: 1091 NSSDYTQAAICRECG 1105
             +SD  +  IC  CG
Sbjct: 1152 EASDAFRVHICGICG 1166

>Scas_714.41
          Length = 1224

 Score =  360 bits (924), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 326/1155 (28%), Positives = 493/1155 (42%), Gaps = 202/1155 (17%)

Query: 85   SDYLGNKLSISVEQVSIAKPTAN--DGVMGAAERPVYPSEARQRLTSYRGKILLKLKWSV 142
            +D +  K  I   ++ + KP  N  DGV  A    +YP EAR R  +Y   + + +K   
Sbjct: 81   TDNVSRKYEIGFGKIYVTKPMVNESDGVTHA----LYPQEARLRNLTYSSGLFVDVKKRT 136

Query: 143  NDGENVFSEVRD------------------CGGLPIMLQSNRCHLNKMSPHELVQHKEES 184
             +  +V                         G LPIML+S  C+L+  +  +L + KE  
Sbjct: 137  YEAVDVPGRELKYELIAEESEEESESGKVFIGRLPIMLRSKNCYLSDATESDLYKLKECP 196

Query: 185  DELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRSVRPDQT--- 241
             ++GGYFIING EK+   LI Q R+     I   F     S   +  +IRS     +   
Sbjct: 197  FDMGGYFIINGSEKV---LIAQERS--AGNIVQVFKKAAPSPISHVAEIRSALEKGSRFI 251

Query: 242  SQTNVLHYLNDGQ----VTFRFSWRKNEYLIPVVMIMKALVDTSDREIFDGIIGSNTNNS 297
            S   V  Y  +G     +     + K +  IP+V+I +AL    D EI + I     +  
Sbjct: 252  STLQVKLYGREGSDARTINATLPYIKQD--IPIVIIFRALGIIPDGEILEHICYDVNDWQ 309

Query: 298  FLTDRLELLLRGFKKRYPQLKNRTQVLQYLGDKFRLVFQASPDKSDYEVGQEVLNRIVLV 357
             L      +  GF      +++R   L ++G +   +      +  Y   +++L +  L 
Sbjct: 310  MLEMLKPCVEDGF-----VIQDRETALDFIGRRGTALGIKKEKRIQY--AKDILQKEFLP 362

Query: 358  HLGSNGNMD--KFRMLLFMVRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMILK---- 411
            H+      +  K   L +M+ +L          D+ D    + + L G L   + K    
Sbjct: 363  HITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLASLFKTLFR 422

Query: 412  ---EKIDEYLQGIVAQVRTDINRGVAINFNEKKYMSRVLMRVNDNIGSKMQYFLSTGNLV 468
               + I  Y+Q  V +   D N  +AIN                 I S ++Y L+TGN  
Sbjct: 423  KLTKDIFRYMQRTVEEAH-DFNMKLAINAK--------------TITSGLKYALATGNWG 467

Query: 469  SQSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPV 528
             Q    +   +G + V  +  +   +SH R  +        K    R+L    WG +CP 
Sbjct: 468  EQKKA-MSSRAGVSQVLNRYTYSSTLSHLRRTNT-PIGRDGKLAKPRQLHNTHWGLVCPA 525

Query: 529  HTPDGSPCGLLNHFAHKCRISTTQSDVSKVPELLYSLGVTP-ASHTFAAGPSLCCVQLDG 587
             TP+G  CGL+ + +    IS   +D   +   L   G+ P   +     P    V ++G
Sbjct: 526  ETPEGQACGLVKNLSLMSCISVG-TDPMPIITFLSEWGMEPLEDYVPHQSPDATRVFVNG 584

Query: 588  KIIGWTSHEQGRVIADTLRFWKVEGETPGLPKDLEIGYVPPSSKGQYPGLYIFGGHSRMM 647
               G   H     + DTLR  + +G+      + E+  +    + +   L IF    R+ 
Sbjct: 585  VWHG--VHRNPARLMDTLRTLRRKGDI-----NPEVSMIRDIREKE---LKIFTDAGRVY 634

Query: 648  RPV----------------------RYLPLDKEDIVGPFEQV---------------YMN 670
            RP+                      + +  + +DI G FE                 Y++
Sbjct: 635  RPLFIVEDDETLGHKELKVRKGHIAKLMATEYQDIEGGFEDAEEYTWTSLLNEGLVEYID 694

Query: 671  --------IAVTPQEIQ-----------------------NNIHTHVEFSPTNILSILAN 699
                    I++ P++++                           TH E  P+ IL + A+
Sbjct: 695  AEEEETILISMQPEDLEPPMENEEVIDDMDPAKRIRATQHATTFTHCEIHPSMILGVAAS 754

Query: 700  LTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGM 759
            + PF D NQSPRN YQ  MGKQ MG        R D     L   Q P+      +    
Sbjct: 755  IIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQKPLGTTRSMEYLKF 814

Query: 760  DNFPNGTNAVVAVISYTGYDMDDAMIINKSADERG-----FGYGTMYKVEKVDLSLNRSR 814
               P G NA+VA+  Y+GY+ +D+MI+N+S+ +RG     F    M + +K  +S+  + 
Sbjct: 815  RELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETF 874

Query: 815  GDPV---TQHFGFGTDEWPKEWLDKLDEDGLPYIGTYVEEGDPICAYFDDTIGKT----- 866
              P    T     GT        DKLD+DGL   G  V   D I       IGKT     
Sbjct: 875  EKPQRTNTLRMKHGT-------YDKLDDDGLIAPGVRVSGEDII-------IGKTTPISP 920

Query: 867  ------KIKTYHS----------SEPAYIEEVNLIGDESNKFQELQTVSIKYRIRRTPQI 910
                  +   YHS          +E   +++V +  ++      L+ V ++ R  + PQI
Sbjct: 921  DEEELGQRTAYHSKRDASTPLRSTENGIVDQVLITTNQDG----LKFVKVRVRTTKVPQI 976

Query: 911  GDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLAGKAGA 970
            GDKF+SRHGQKG     +   DMPF+  GI PD+IINPHA PSRMT+   +E L  K  A
Sbjct: 977  GDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAA 1036

Query: 971  LHGIAQDSTPWIFNEQDTPADYFGEQLLKAGYNYHGNEPMYSGATGEELRCDIYIGVVYY 1030
            L G   D++P+     D   +   + L + GY   G E MY+G TG++L   I+ G  YY
Sbjct: 1037 LSGNEGDASPFT----DITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYY 1092

Query: 1031 QRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLL 1090
            QRLRHMV+DK   R+ GP+  LT QPV+GR R GG+R GEMERD +I HG +  L++RL+
Sbjct: 1093 QRLRHMVDDKIHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAAAFLKERLM 1152

Query: 1091 NSSDYTQAAICRECG 1105
             +SD  +  IC  CG
Sbjct: 1153 EASDAFRVHICGNCG 1167

>KLLA0B05577g complement(501690..505355) highly similar to sp|P08518
            Saccharomyces cerevisiae YOR151c RPB2 DNA-directed RNA
            polymerase II, 140 kDa chain, start by similarity
          Length = 1221

 Score =  296 bits (758), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 186/480 (38%), Positives = 250/480 (52%), Gaps = 53/480 (11%)

Query: 653  LPL-DKEDIVGPFEQVYMNIAVTPQEIQN-NIHTHVEFSPTNILSILANLTPFSDFNQSP 710
            LP+ D ED + P  ++        + I N NI TH E  P+ IL + A++ PF D NQSP
Sbjct: 711  LPVADSEDDLDPARRI--------RAIHNSNIFTHCEIHPSMILGVAASVIPFPDHNQSP 762

Query: 711  RNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGTNAVV 770
            RN YQ  MGKQ MG        R D     L   Q P+      +       P G NA+V
Sbjct: 763  RNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQKPLGTTRAMEYLKFRELPAGQNAIV 822

Query: 771  AVISYTGYDMDDAMIINKSADERG-----FGYGTMYKVEKVDLSLNRSRGDP---VTQHF 822
            A+  Y+GY+ +D+MI+N+S+ +RG     F    M + +++ +S+  S   P    T   
Sbjct: 823  AIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKRIGMSITESFEKPHRTNTLRM 882

Query: 823  GFGTDEWPKEWLDKLDEDGLPYIGTYVEEGDPICAYFDDTIGKT-----------KIKTY 871
              GT        DKLD+DGL   G  V   D I       IGKT           +   +
Sbjct: 883  KHGT-------YDKLDDDGLIAPGVRVSGDDMI-------IGKTTPIPPDAEELGQRTAF 928

Query: 872  HSSEPAYI---EEVNLIGDE---SNKFQELQTVSIKYRIRRTPQIGDKFSSRHGQKGVCS 925
            HS   A        N I D+   +   + L+ V ++ R  + PQIGDKF+SRHGQKG   
Sbjct: 929  HSKRDASTPLRSTENGIVDQVLITTNQEGLKFVKVRVRTTKIPQIGDKFASRHGQKGTIG 988

Query: 926  RKWPTIDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLAGKAGALHGIAQDSTPWIFNE 985
              + T DMPF+  G+ PD+IINPHA PSRMT+   +E L  K  AL G   D++P+    
Sbjct: 989  ITYRTEDMPFTAEGVVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGNEGDASPFT--- 1045

Query: 986  QDTPADYFGEQLLKAGYNYHGNEPMYSGATGEELRCDIYIGVVYYQRLRHMVNDKFQVRS 1045
             D   D     L + GY   G E MY+G TG++L   I+ G  YYQRLRHMV+DK   R+
Sbjct: 1046 -DITVDGISRLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARA 1104

Query: 1046 TGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNSSDYTQAAICRECG 1105
             GP+  LT QPV+GR R GG+R GEMERD +I HG +  L++RL+ +SD  +  IC  CG
Sbjct: 1105 RGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAAAFLKERLMEASDAFRVHICGICG 1164

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 143/597 (23%), Positives = 241/597 (40%), Gaps = 71/597 (11%)

Query: 85  SDYLGNKLSISVEQVSIAKP--TANDGVMGAAERPVYPSEARQRLTSYRGKILLKLKWSV 142
           +D +  K  IS  ++ +AKP  T +DGV  A    +YP EAR R  +Y   + ++++   
Sbjct: 75  TDNISRKYEISFGKIYLAKPSMTESDGVSHA----MYPQEARLRNLTYASGLFVEIQKRT 130

Query: 143 NDGENVFSEVRDC--------------------GGLPIMLQSNRCHLNKMSPHELVQHKE 182
               ++    RD                     G +PIML+S  C L+ ++  +L + KE
Sbjct: 131 YQAIDIPG--RDLKYEIITEESEENEENNKIFIGRVPIMLRSKYCLLDDLTESDLYRLKE 188

Query: 183 ESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRSVRPDQT- 241
              ++GGYFIING EK+   LI Q R+     I   F     S   +  +IRS     + 
Sbjct: 189 CPFDMGGYFIINGSEKV---LIAQERS--AGNIVQVFKKSAPSPISHIAEIRSALEKGSR 243

Query: 242 --SQTNVLHYLNDGQV--TFRFSWRKNEYLIPVVMIMKALVDTSDREIFDGIIGSNTNNS 297
             S   V  Y  +G    T + +    +  IP+V+I +AL    D EI + I     +  
Sbjct: 244 FISTLQVKLYGREGSTSRTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQ 303

Query: 298 FLTDRLELLLRGFKKRYPQLKNRTQVLQYLGDKFRLVFQASPDKSDYEVGQEVLNRIVLV 357
            L      +  GF      +++R   L ++G +   +      +  Y   +++L +  L 
Sbjct: 304 MLEMLKPCVEEGF-----VIQDRETALDFIGRRGTALGIKKEKRIQY--AKDILQKEFLP 356

Query: 358 HLGSNGNMD--KFRMLLFMVRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMILKEKID 415
           H+      +  K   L +M+ +L          D+ D    + + L G L   + K    
Sbjct: 357 HITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFKT--- 413

Query: 416 EYLQGIVAQVRTDINRGVAINFNEKKYMSRVLMRVNDNIGSKMQYFLSTGNLVSQSGLDL 475
                +  ++  DI R +  +  E K  +  L      I + ++Y L+TGN   Q    +
Sbjct: 414 -----LFRKLTRDILRFMQRSVEEAKDFNLKLAVKATTITAGLKYALATGNWGEQKK-SM 467

Query: 476 QQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSP 535
              +G + V  +  +   +SH R  +        K    R+L    WG +CP  TP+G  
Sbjct: 468 SSRAGVSQVLNRYTYSSTLSHLRRTN-TPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQA 526

Query: 536 CGLLNHFAHKCRISTTQSDVSKVPELLYSLGVTPASHTFA-AGPSLCCVQLDGKIIGWTS 594
           CGL+ + +    IS   +D   +   L   G+ P         P    V ++G   G   
Sbjct: 527 CGLVKNLSLMSCISVG-TDPLPIITFLNEWGMEPLEDYIPHQSPDATRVFVNGVWHGI-- 583

Query: 595 HEQGRVIADTLRFWKVEGE-TPGLPKDLEIGYVPPSSKGQYPGLYIFGGHSRMMRPV 650
           H     + DT+R  + +G+ TP      E+  V    + +   L IF    R+ RP+
Sbjct: 584 HRNPAKLVDTIRKLRRKGDITP------EVSIVRDIREKE---LKIFTDAGRVYRPL 631

>CAGL0J07942g 772758..776492 similar to sp|P38717 Saccharomyces
           cerevisiae YNL257c SIP3 SNF1P or sp|P38851 Saccharomyces
           cerevisiae YHR155w, hypothetical start
          Length = 1244

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 47/106 (44%), Gaps = 10/106 (9%)

Query: 685 HVEFSPTNILSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTG 744
           ++EF+ +    I   +T F D  +S    Y+C   +  + + G         K++  QT 
Sbjct: 444 YIEFASSTTTKIDQQITTFDDTTESLFQKYKCAFSEYEVLSVG-------SEKIFNFQTI 496

Query: 745 QTPIVKANLYDDYGMDNFPNG---TNAVVAVISYTGYDMDDAMIIN 787
            TPI        +  DN   G   TNAVVA I  T Y  D ++I++
Sbjct: 497 ITPISTKMTNLAFLADNSVYGSYCTNAVVANIWGTTYWSDYSLILS 542

>AFL133C [3062] [Homologous to ScYPL227C (ALG5) - SH]
           (182740..183696) [957 bp, 318 aa]
          Length = 318

 Score = 33.5 bits (75), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 37/81 (45%), Gaps = 12/81 (14%)

Query: 72  VIFDGKSDGSDEISDYLGNKLSISVEQVSIAKPTANDGVMGAAERPVYPSEARQRLTSYR 131
           ++ DG  DG+ E    L  KL +  EQ+ + K T N G  GA          R  +   R
Sbjct: 102 IVDDGSRDGTQEFCLELAQKLQLEREQMRVVKFTKNRGKGGA---------VRHGMLHIR 152

Query: 132 GKILLKLKWSVNDGENVFSEV 152
           GK  L   ++  DG + FS+V
Sbjct: 153 GKYGL---FADADGASRFSDV 170

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.137    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 40,617,780
Number of extensions: 1877711
Number of successful extensions: 4174
Number of sequences better than 10.0: 23
Number of HSP's gapped: 4206
Number of HSP's successfully gapped: 35
Length of query: 1184
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1071
Effective length of database: 12,684,275
Effective search space: 13584858525
Effective search space used: 13584858525
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)