Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0J01771g156733017650.0
CAGL0K13024g10753006602e-70
CAGL0I10098g16182146639e-70
CAGL0J01727g9793165005e-51
CAGL0J02530g7543134216e-42
CAGL0J02508g8702083577e-34
CAGL0J02552g8951942872e-25
CAGL0H10626g13261202632e-22
CAGL0G10219g9921272424e-20
CAGL0I11011g11791272381e-19
CAGL0I10362g12171252272e-18
CAGL0K00110g8321112022e-15
CAGL0L09911g13511211503e-09
CAGL0C00968g10341371306e-07
YIL169C9952651299e-07
CAGL0C01133g10361821299e-07
YOL155C9672691262e-06
Scas_678.2613771141172e-05
CAGL0E01661g1429811010.002
CAGL0L13332g1035130930.015
CAGL0H00110g366125890.027
KLLA0B14498g766207870.070
Scas_545.1*666130850.097
Scas_561.3953115830.22
Scas_698.41d30266780.49
Scas_714.21*673142742.0
Scas_674.20d537185732.9
Scas_538.4d53129733.0
Sklu_2155.31007138715.7
Kwal_55.222011524121707.3
Kwal_47.1679620986679.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J01771g
         (1558 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J01771g complement(164808..169469) some similarities with t...   684   0.0  
CAGL0K13024g 1296946..1300173 some similarities with sp|P08640 S...   258   2e-70
CAGL0I10098g complement(958948..963804) some similarities with s...   259   9e-70
CAGL0J01727g complement(157842..160781) some similarities with s...   197   5e-51
CAGL0J02530g complement(248026..250290) some similarities with t...   166   6e-42
CAGL0J02508g complement(243607..246219) some similarities with t...   142   7e-34
CAGL0J02552g complement(252259..254946) some similarities with t...   115   2e-25
CAGL0H10626g 1043943..1047923 some similarities with sp|P32768 S...   105   2e-22
CAGL0G10219g 988766..991744 some similarities with sp|P38894 Sac...    98   4e-20
CAGL0I11011g 1085865..>1089401 some similarities with sp|P32768 ...    96   1e-19
CAGL0I10362g 1011132..1014743 some similarities with sp|P32768 S...    92   2e-18
CAGL0K00110g complement(3332..5830) some similarities with tr|Q0...    82   2e-15
CAGL0L09911g 1062345..1066400 some similarities with sp|P08640 S...    62   3e-09
CAGL0C00968g 96914..100018 some similarities with tr|Q08294 Sacc...    55   6e-07
YIL169C (YIL169C) [2509] chr9 complement(23119..26106) Protein o...    54   9e-07
CAGL0C01133g 114805..117915 some similarities with tr|Q08294 Sac...    54   9e-07
YOL155C (YOL155C) [4670] chr15 complement(28702..31605) Protein ...    53   2e-06
Scas_678.26                                                            50   2e-05
CAGL0E01661g 160466..164713 some similarities with sp|P08640 Sac...    44   0.002
CAGL0L13332g 1432034..1435141 some similarities with sp|P39712 S...    40   0.015
CAGL0H00110g complement(2611..3711) some similarities with sp|P0...    39   0.027
KLLA0B14498g 1275022..1277322 some similarities with ca|CA2713|C...    38   0.070
Scas_545.1*                                                            37   0.097
Scas_561.3                                                             37   0.22 
Scas_698.41d                                                           35   0.49 
Scas_714.21*                                                           33   2.0  
Scas_674.20d                                                           33   2.9  
Scas_538.4d                                                            33   3.0  
Sklu_2155.3 , Contig c2155 4020-7043 reverse complement                32   5.7  
Kwal_55.22201                                                          32   7.3  
Kwal_47.16796                                                          30   9.5  

>CAGL0J01771g complement(164808..169469) some similarities with
           tr|Q08294 Saccharomyces cerevisiae YOL155c, hypothetical
           start
          Length = 1567

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/330 (100%), Positives = 330/330 (100%)

Query: 1   MLCYTPLFLSSFLYIQGVFAQAKNYEGNQDLKNELVIQNGDTISYVDGSEYNFGGGIVSS 60
           MLCYTPLFLSSFLYIQGVFAQAKNYEGNQDLKNELVIQNGDTISYVDGSEYNFGGGIVSS
Sbjct: 1   MLCYTPLFLSSFLYIQGVFAQAKNYEGNQDLKNELVIQNGDTISYVDGSEYNFGGGIVSS 60

Query: 61  QEGCTFRAVANDKSDFDFNVGKEFVNYCNFELINKNLDGFKQTINFSPAVFKNYYQVDIQ 120
           QEGCTFRAVANDKSDFDFNVGKEFVNYCNFELINKNLDGFKQTINFSPAVFKNYYQVDIQ
Sbjct: 61  QEGCTFRAVANDKSDFDFNVGKEFVNYCNFELINKNLDGFKQTINFSPAVFKNYYQVDIQ 120

Query: 121 LAHTRSDAVSKLILGSPEIINAGKLTVRPYSAVEQNDPSREGNILQISTPGGRLVNTGTI 180
           LAHTRSDAVSKLILGSPEIINAGKLTVRPYSAVEQNDPSREGNILQISTPGGRLVNTGTI
Sbjct: 121 LAHTRSDAVSKLILGSPEIINAGKLTVRPYSAVEQNDPSREGNILQISTPGGRLVNTGTI 180

Query: 181 ELSLGVKYYLYGDVSGTGNINIARGILHMETTSFVGNTINLGGISGISVKSTSSNIIKVR 240
           ELSLGVKYYLYGDVSGTGNINIARGILHMETTSFVGNTINLGGISGISVKSTSSNIIKVR
Sbjct: 181 ELSLGVKYYLYGDVSGTGNINIARGILHMETTSFVGNTINLGGISGISVKSTSSNIIKVR 240

Query: 241 GLISGNLISSIGDNGSFTYNNQTGIVTVNTDSGRYVYDIGCGYDETTLGSTTGYIVYHGE 300
           GLISGNLISSIGDNGSFTYNNQTGIVTVNTDSGRYVYDIGCGYDETTLGSTTGYIVYHGE
Sbjct: 241 GLISGNLISSIGDNGSFTYNNQTGIVTVNTDSGRYVYDIGCGYDETTLGSTTGYIVYHGE 300

Query: 301 SLKTFVIATSLETAPDYQKCYIPGQHENHD 330
           SLKTFVIATSLETAPDYQKCYIPGQHENHD
Sbjct: 301 SLKTFVIATSLETAPDYQKCYIPGQHENHD 330

 Score =  564 bits (1453), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 319/470 (67%), Positives = 319/470 (67%)

Query: 1089 GKPTVILTQYQSPTAAQDGTSKTITVDGEEIIEVVHITTYTDSDGHTITSTYTEMFKTLI 1148
            GKPTVILTQYQSPTAAQDGTSKTITVDGEEIIEVVHITTYTDSDGHTITSTYTEMFKTLI
Sbjct: 1089 GKPTVILTQYQSPTAAQDGTSKTITVDGEEIIEVVHITTYTDSDGHTITSTYTEMFKTLI 1148

Query: 1149 DAEPQYVSEXXXXXXXXXXXXXXXXXXXXYNIDNNGNAVPIVPXXXXXXXXXXXXXXXXX 1208
            DAEPQYVSE                    YNIDNNGNAVPIVP                 
Sbjct: 1149 DAEPQYVSETTQTITTTDAEGHTTTITTTYNIDNNGNAVPIVPSSSSMSSSSSSSMSSSS 1208

Query: 1209 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPSGQDYTITTTGSDG 1268
                                                        TPSGQDYTITTTGSDG
Sbjct: 1209 SSSMSSSSSSSMSSSSSSSMSSSSSSSMPSSSSIISSSIFSSVSTPSGQDYTITTTGSDG 1268

Query: 1269 KIETNVVSHITTTVNGKPTTITTTVPCDVSAEKDRTTTVTHSNGVIETNVVSHITTTVNG 1328
            KIETNVVSHITTTVNGKPTTITTTVPCDVSAEKDRTTTVTHSNGVIETNVVSHITTTVNG
Sbjct: 1269 KIETNVVSHITTTVNGKPTTITTTVPCDVSAEKDRTTTVTHSNGVIETNVVSHITTTVNG 1328

Query: 1329 KPTTIITTGSFDVGAGKDRITTITHSNGVIETNVVSHITTVDTKGNPXXXXXXXXXXXXX 1388
            KPTTIITTGSFDVGAGKDRITTITHSNGVIETNVVSHITTVDTKGNP             
Sbjct: 1329 KPTTIITTGSFDVGAGKDRITTITHSNGVIETNVVSHITTVDTKGNPTTIVTTTTKFNNA 1388

Query: 1389 XXXXXSNKNGSXXXXXXXXXXXXNQFGQQIITSLTFTGSEAHSNNNVHTSAGPNDAAGTS 1448
                 SNKNGS            NQFGQQIITSLTFTGSEAHSNNNVHTSAGPNDAAGTS
Sbjct: 1389 HTTTFSNKNGSVDTKTVVGVTTTNQFGQQIITSLTFTGSEAHSNNNVHTSAGPNDAAGTS 1448

Query: 1449 PAGTNNPQTKPTGNAGSTARLSDTTXXXXXXXXXXXXXXXXXXXXXXXXXXXXNSAAVPQ 1508
            PAGTNNPQTKPTGNAGSTARLSDTT                            NSAAVPQ
Sbjct: 1449 PAGTNNPQTKPTGNAGSTARLSDTTPAPNAGSNGSSPAAADAESAVAPKAPASNSAAVPQ 1508

Query: 1509 QXXXXXXXXXXXXPTIPQINKNAASSFKQNNFGVIILFALLFTMLMISCD 1558
            Q            PTIPQINKNAASSFKQNNFGVIILFALLFTMLMISCD
Sbjct: 1509 QSGASSTSHGSAAPTIPQINKNAASSFKQNNFGVIILFALLFTMLMISCD 1558

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 59/205 (28%), Positives = 81/205 (39%), Gaps = 85/205 (41%)

Query: 1256 GQDYTITTTGSDGKIETNVVSHITTT-VNGKPTTITTTV--PCDVSAE------------ 1300
            G+D T   T  DG + T+++SHITTT  +GKPT I T    P     E            
Sbjct: 887  GKDKTTVVTDKDGHVHTDIISHITTTDKDGKPTVILTQYQSPTPSPGEGGSGSNPGAGEG 946

Query: 1301 ---------------------------------KDRTTTVTHSNGVIETNVVSHITTT-V 1326
                                             KD+TT VT  +G + T+++SHITTT  
Sbjct: 947  GSGSEGGSGEGGSGSEGGSGEGGSGGSNPVDDGKDKTTVVTDKDGHVHTDIISHITTTDK 1006

Query: 1327 NGKPTTIIT-------------TGSFD-----------------------VGAGKDRITT 1350
            +GKPT I+T             +GS                         V  GKD+ T 
Sbjct: 1007 DGKPTVILTQYQSPTPSPGEGGSGSNPGAGEGGSGSEGGSGEGGSGGSNPVDDGKDKTTV 1066

Query: 1351 ITHSNGVIETNVVSHITTVDTKGNP 1375
            +T  +G + T+++SHITT D  G P
Sbjct: 1067 VTDKDGHVHTDIISHITTTDKDGKP 1091

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/118 (34%), Positives = 55/118 (46%), Gaps = 38/118 (32%)

Query: 1256 GQDYTITTTGSDGKIETNVVSHITTT-VNGKPTTITTTV--PCDVSAE------------ 1300
            G+D T   T  DG + T+++SHITTT  +GKPT I T    P     E            
Sbjct: 979  GKDKTTVVTDKDGHVHTDIISHITTTDKDGKPTVILTQYQSPTPSPGEGGSGSNPGAGEG 1038

Query: 1301 ----------------------KDRTTTVTHSNGVIETNVVSHITTT-VNGKPTTIIT 1335
                                  KD+TT VT  +G + T+++SHITTT  +GKPT I+T
Sbjct: 1039 GSGSEGGSGEGGSGGSNPVDDGKDKTTVVTDKDGHVHTDIISHITTTDKDGKPTVILT 1096

 Score = 40.4 bits (93), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 45/83 (54%), Gaps = 5/83 (6%)

Query: 1256 GQDYTITTTGSDGKIETNVVSHITTT-VNGKPTTITTTVPCDVSAEKDRTTTVT-HSNGV 1313
            G+D T   T  DG + T+++SHITTT  +GKPT I T      +A+   + T+T     +
Sbjct: 1060 GKDKTTVVTDKDGHVHTDIISHITTTDKDGKPTVILTQYQSPTAAQDGTSKTITVDGEEI 1119

Query: 1314 IETNVVSHITTTVNGKPTTIITT 1336
            IE   V HITT  +    TI +T
Sbjct: 1120 IE---VVHITTYTDSDGHTITST 1139

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 23/35 (65%)

Query: 1341 VGAGKDRITTITHSNGVIETNVVSHITTVDTKGNP 1375
            V  GKD+ T +T  +G + T+++SHITT D  G P
Sbjct: 884  VDDGKDKTTVVTDKDGHVHTDIISHITTTDKDGKP 918

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 14/16 (87%), Positives = 15/16 (93%)

Query: 1089 GKPTVILTQYQSPTAA 1104
            GKPTVILTQYQSPT +
Sbjct: 916  GKPTVILTQYQSPTPS 931

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 14/14 (100%), Positives = 14/14 (100%)

Query: 916 GKPTVILTQYQSPT 929
           GKPTVILTQYQSPT
Sbjct: 916 GKPTVILTQYQSPT 929

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 14/14 (100%), Positives = 14/14 (100%)

Query: 916  GKPTVILTQYQSPT 929
            GKPTVILTQYQSPT
Sbjct: 1008 GKPTVILTQYQSPT 1021

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 14/14 (100%), Positives = 14/14 (100%)

Query: 916  GKPTVILTQYQSPT 929
            GKPTVILTQYQSPT
Sbjct: 1089 GKPTVILTQYQSPT 1102

>CAGL0K13024g 1296946..1300173 some similarities with sp|P08640
            Saccharomyces cerevisiae YIR019c STA1, hypothetical start
          Length = 1075

 Score =  258 bits (660), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 161/300 (53%), Positives = 179/300 (59%), Gaps = 19/300 (6%)

Query: 1257 QDYTITTTGSDGKIETNVVSHITTTVNGKPTTITTTVPCDVSAEKDRTTTVTHSNGVIET 1316
            +D T T T S+G IETNVVSHITTTVNGKPTTITTTVPCDVSA+KDRTTTVTHSNGVIET
Sbjct: 792  KDRTTTVTHSNGVIETNVVSHITTTVNGKPTTITTTVPCDVSADKDRTTTVTHSNGVIET 851

Query: 1317 NVVSHITTTVNGKPTTIITTGSFDVGAGKDRITTITHSNGVIETNVVSHITTVDTKGNPX 1376
            NVVSHITTTVNGKPTTI TT   DV A KDR TT+THSNGVIETNVVSHITT    G P 
Sbjct: 852  NVVSHITTTVNGKPTTITTTVPCDVSADKDRTTTVTHSNGVIETNVVSHITTT-VNGKPT 910

Query: 1377 XXXXXXXXXXXXXXXXXSNKNGSXXXXXXXXXXXXNQFGQQIITSLTFT-GSEAHSNNNV 1435
                             +NK+GS            NQFGQ +ITS+T+T  +++HSNNNV
Sbjct: 911  TITTTTTKLNNAHTTTLTNKDGSVDTKIVVGVTTTNQFGQPVITSITYTPKADSHSNNNV 970

Query: 1436 HTSAGPNDAAGTSPAGTNNPQTKPTGNAGSTARLSDTTXXXXXXXXXXXXXXXXXXXXXX 1495
             T AG   AAG +P+GTN PQT PT NAGS                              
Sbjct: 971  GTVAGTKGAAGNNPSGTNKPQTNPTANAGSNGS----------------SPAANAGSAVV 1014

Query: 1496 XXXXXXNSAAVPQQXXXX-XXXXXXXXPTIPQINKNAASSFKQNNFGVIILFALLFTMLM 1554
                  NSAAV QQ             PTI QINKNAAS+ KQ  F V I+  +L    +
Sbjct: 1015 PKAPASNSAAVQQQSSASGTTPGASAAPTIQQINKNAASTLKQTKFCVTIVLTILMNYFL 1074

 Score =  196 bits (498), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 104/116 (89%), Positives = 108/116 (93%)

Query: 1253 TPSGQDYTITTTGSDGKIETNVVSHITTTVNGKPTTITTTVPCDVSAEKDRTTTVTHSNG 1312
            TPSGQDY ITTTGSDGKIET++VSHITTTVNGKPTTITTTVPCDVSA+KDRTTTVTHSNG
Sbjct: 656  TPSGQDYIITTTGSDGKIETDIVSHITTTVNGKPTTITTTVPCDVSADKDRTTTVTHSNG 715

Query: 1313 VIETNVVSHITTTVNGKPTTIITTGSFDVGAGKDRITTITHSNGVIETNVVSHITT 1368
            VIETNVVSHITTTVNGKPTTI TT   DV A KDR TT+THSNGVIETNVVSHITT
Sbjct: 716  VIETNVVSHITTTVNGKPTTITTTVPCDVSADKDRTTTVTHSNGVIETNVVSHITT 771

 Score =  144 bits (362), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 75/102 (73%), Positives = 76/102 (74%)

Query: 1089 GKPTVILTQYQSPTAAQDGTSKTITVDGEEIIEVVHITTYTDSDGHTITSTYTEMFKTLI 1148
            GKPTVILTQYQSPTA Q+G SKTITVDGEEIIE VHITTYTDSDGHTITSTYTEMFKTLI
Sbjct: 532  GKPTVILTQYQSPTAVQNGISKTITVDGEEIIEAVHITTYTDSDGHTITSTYTEMFKTLI 591

Query: 1149 DAEPQYVSEXXXXXXXXXXXXXXXXXXXXYNIDNNGNAVPIV 1190
            DAEPQYV E                    YNIDNN N VPIV
Sbjct: 592  DAEPQYVGETTQTITTTDTEGHTTTITTTYNIDNNVNTVPIV 633

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 57/75 (76%), Gaps = 1/75 (1%)

Query: 1301 KDRTTTVTHSNGVIETNVVSHITTTVNGKPTTIITTGSFDVGAGKDRITTITHSNGVIET 1360
            +D   T T S+G IET++VSHITTTVNGKPTTI TT   DV A KDR TT+THSNGVIET
Sbjct: 660  QDYIITTTGSDGKIETDIVSHITTTVNGKPTTITTTVPCDVSADKDRTTTVTHSNGVIET 719

Query: 1361 NVVSHITTVDTKGNP 1375
            NVVSHITT    G P
Sbjct: 720  NVVSHITTT-VNGKP 733

 Score = 38.5 bits (88), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 20/36 (55%), Positives = 28/36 (77%), Gaps = 1/36 (2%)

Query: 1301 KDRTTTVTHSNGVIETNVVSHITTT-VNGKPTTIIT 1335
            KD+TT VT  +G + T+++SHITTT  +GKPT I+T
Sbjct: 504  KDKTTVVTDKDGHVHTDIISHITTTDKDGKPTVILT 539

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 23/35 (65%)

Query: 1341 VGAGKDRITTITHSNGVIETNVVSHITTVDTKGNP 1375
            V  GKD+ T +T  +G + T+++SHITT D  G P
Sbjct: 500  VDDGKDKTTVVTDKDGHVHTDIISHITTTDKDGKP 534

 Score = 35.4 bits (80), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 1256 GQDYTITTTGSDGKIETNVVSHITTT-VNGKPTTITT 1291
            G+D T   T  DG + T+++SHITTT  +GKPT I T
Sbjct: 503  GKDKTTVVTDKDGHVHTDIISHITTTDKDGKPTVILT 539

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/14 (100%), Positives = 14/14 (100%)

Query: 916 GKPTVILTQYQSPT 929
           GKPTVILTQYQSPT
Sbjct: 532 GKPTVILTQYQSPT 545

>CAGL0I10098g complement(958948..963804) some similarities with
            sp|P08640 Saccharomyces cerevisiae YIR019c STA1,
            hypothetical start
          Length = 1618

 Score =  259 bits (663), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 162/214 (75%), Gaps = 1/214 (0%)

Query: 1253 TPSGQDYTITTTGSDGKIETNVVSHITTTVNGKPTTITTTVPCDVSAEKDRTTTVTHSNG 1312
            TPSGQDYTITTTGSDGKIET++VSHITTTVNGKPTTITTTVPCDVS  KDRTTTVTHSNG
Sbjct: 1254 TPSGQDYTITTTGSDGKIETDIVSHITTTVNGKPTTITTTVPCDVSTGKDRTTTVTHSNG 1313

Query: 1313 VIETNVVSHITTTVNGKPTTIITTGSFDVGAGKDRITTITHSNGVIETNVVSHITTVDTK 1372
            VIETNVVSHITTTVNGKPTTI TT   DV AGKDR TT+THSNGVIETNV+SHITT D+ 
Sbjct: 1314 VIETNVVSHITTTVNGKPTTITTTVPCDVSAGKDRTTTVTHSNGVIETNVISHITTTDSN 1373

Query: 1373 GNPXXXXXXXXXXXXXXXXXXSNKNGSXXXXXXXXXXXXNQFGQQIITSLTFT-GSEAHS 1431
            G P                  +NK+GS            NQFGQ +ITS+T+T  +++HS
Sbjct: 1374 GKPTTITTTTTKLNNAHTTTLTNKDGSVDTKTVVGVTTTNQFGQPVITSITYTPKADSHS 1433

Query: 1432 NNNVHTSAGPNDAAGTSPAGTNNPQTKPTGNAGS 1465
            N+NV T AG   AAG +P+GTN PQTKPT NAGS
Sbjct: 1434 NSNVGTVAGTKGAAGNNPSGTNKPQTKPTANAGS 1467

 Score =  155 bits (392), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 82/103 (79%), Positives = 82/103 (79%)

Query: 1089 GKPTVILTQYQSPTAAQDGTSKTITVDGEEIIEVVHITTYTDSDGHTITSTYTEMFKTLI 1148
            GKPTVILTQYQSPTAAQDGTSKTITVDGEEIIEVVHITTYTDSDGHTITSTYTEMFKTLI
Sbjct: 1113 GKPTVILTQYQSPTAAQDGTSKTITVDGEEIIEVVHITTYTDSDGHTITSTYTEMFKTLI 1172

Query: 1149 DAEPQYVSEXXXXXXXXXXXXXXXXXXXXYNIDNNGNAVPIVP 1191
            DAEPQYVSE                    Y IDNNGNAVPIVP
Sbjct: 1173 DAEPQYVSETTQTITTTDAEGHTTTITTTYTIDNNGNAVPIVP 1215

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/54 (51%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 1502 NSAAVPQQXXXXXXX-XXXXXPTIPQINKNAASSFKQNNFGV-IILFALLFTML 1553
            NSAAV QQ             PTI QINKNAASS KQ   GV  +L  LLFT+ 
Sbjct: 1565 NSAAVQQQSSASGRNPGASAAPTIQQINKNAASSMKQTKIGVTTVLTILLFTLF 1618

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 48/91 (52%), Gaps = 16/91 (17%)

Query: 1286 PTTITTTVPCDVSAEKDRTTTVTHSNGVIETNVVSHITTTVN-GKPTTIITTGSFDVGAG 1344
            PTTITTT   D                ++E +V+S  +TT + GKP T  TT + D   G
Sbjct: 279  PTTITTTKNVDGQQ-------------LVEQDVISFFSTTNSIGKPITGSTTITID--DG 323

Query: 1345 KDRITTITHSNGVIETNVVSHITTVDTKGNP 1375
            +D+ TT    +G I T+++SHIT +D  G P
Sbjct: 324  RDKTTTYKDKDGSIHTDIISHITKLDENGMP 354

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 51/81 (62%), Gaps = 7/81 (8%)

Query: 1260 TITTTGS-DGK--IETNVVSHITTTVN-GKPTTITTTVPCDVSAEKDRTTTVTHSNGVIE 1315
            TITTT + DG+  +E +V+S  +TT + GKP T +TT+  D    +D+TTT    +G I 
Sbjct: 281  TITTTKNVDGQQLVEQDVISFFSTTNSIGKPITGSTTITIDDG--RDKTTTYKDKDGSIH 338

Query: 1316 TNVVSHITT-TVNGKPTTIIT 1335
            T+++SHIT    NG P  I+T
Sbjct: 339  TDIISHITKLDENGMPVVILT 359

 Score = 38.9 bits (89), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 20/36 (55%), Positives = 28/36 (77%), Gaps = 1/36 (2%)

Query: 1301 KDRTTTVTHSNGVIETNVVSHITTT-VNGKPTTIIT 1335
            KD+TT VT  +G + T+++SHITTT  +GKPT I+T
Sbjct: 462  KDKTTVVTDKDGHVHTDIISHITTTDKDGKPTVILT 497

 Score = 38.9 bits (89), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 20/36 (55%), Positives = 28/36 (77%), Gaps = 1/36 (2%)

Query: 1301 KDRTTTVTHSNGVIETNVVSHITTT-VNGKPTTIIT 1335
            KD+TT VT  +G + T+++SHITTT  +GKPT I+T
Sbjct: 582  KDKTTVVTDKDGHVHTDIISHITTTDKDGKPTVILT 617

 Score = 38.9 bits (89), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 20/36 (55%), Positives = 28/36 (77%), Gaps = 1/36 (2%)

Query: 1301 KDRTTTVTHSNGVIETNVVSHITTT-VNGKPTTIIT 1335
            KD+TT VT  +G + T+++SHITTT  +GKPT I+T
Sbjct: 779  KDKTTVVTDKDGHVHTDIISHITTTDKDGKPTVILT 814

 Score = 38.9 bits (89), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 20/36 (55%), Positives = 28/36 (77%), Gaps = 1/36 (2%)

Query: 1301 KDRTTTVTHSNGVIETNVVSHITTT-VNGKPTTIIT 1335
            KD+TT VT  +G + T+++SHITTT  +GKPT I+T
Sbjct: 954  KDKTTVVTDKDGHVHTDIISHITTTDKDGKPTVILT 989

 Score = 38.9 bits (89), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 20/36 (55%), Positives = 28/36 (77%), Gaps = 1/36 (2%)

Query: 1301 KDRTTTVTHSNGVIETNVVSHITTT-VNGKPTTIIT 1335
            KD+TT VT  +G + T+++SHITTT  +GKPT I+T
Sbjct: 1085 KDKTTVVTDKDGHVHTDIISHITTTDKDGKPTVILT 1120

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 45/83 (54%), Gaps = 5/83 (6%)

Query: 1256 GQDYTITTTGSDGKIETNVVSHITTT-VNGKPTTITTTVPCDVSAEKDRTTTVT-HSNGV 1313
            G+D T   T  DG + T+++SHITTT  +GKPT I T      +A+   + T+T     +
Sbjct: 1084 GKDKTTVVTDKDGHVHTDIISHITTTDKDGKPTVILTQYQSPTAAQDGTSKTITVDGEEI 1143

Query: 1314 IETNVVSHITTTVNGKPTTIITT 1336
            IE   V HITT  +    TI +T
Sbjct: 1144 IE---VVHITTYTDSDGHTITST 1163

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 22/32 (68%)

Query: 1344 GKDRITTITHSNGVIETNVVSHITTVDTKGNP 1375
            GKD+ T +T  +G + T+++SHITT D  G P
Sbjct: 461  GKDKTTVVTDKDGHVHTDIISHITTTDKDGKP 492

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 22/32 (68%)

Query: 1344 GKDRITTITHSNGVIETNVVSHITTVDTKGNP 1375
            GKD+ T +T  +G + T+++SHITT D  G P
Sbjct: 581  GKDKTTVVTDKDGHVHTDIISHITTTDKDGKP 612

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 22/32 (68%)

Query: 1344 GKDRITTITHSNGVIETNVVSHITTVDTKGNP 1375
            GKD+ T +T  +G + T+++SHITT D  G P
Sbjct: 778  GKDKTTVVTDKDGHVHTDIISHITTTDKDGKP 809

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 22/32 (68%)

Query: 1344 GKDRITTITHSNGVIETNVVSHITTVDTKGNP 1375
            GKD+ T +T  +G + T+++SHITT D  G P
Sbjct: 953  GKDKTTVVTDKDGHVHTDIISHITTTDKDGKP 984

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 22/32 (68%)

Query: 1344 GKDRITTITHSNGVIETNVVSHITTVDTKGNP 1375
            GKD+ T +T  +G + T+++SHITT D  G P
Sbjct: 1084 GKDKTTVVTDKDGHVHTDIISHITTTDKDGKP 1115

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 1256 GQDYTITTTGSDGKIETNVVSHITTT-VNGKPTTITT 1291
            G+D T   T  DG + T+++SHITTT  +GKPT I T
Sbjct: 461  GKDKTTVVTDKDGHVHTDIISHITTTDKDGKPTVILT 497

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 1256 GQDYTITTTGSDGKIETNVVSHITTT-VNGKPTTITT 1291
            G+D T   T  DG + T+++SHITTT  +GKPT I T
Sbjct: 581  GKDKTTVVTDKDGHVHTDIISHITTTDKDGKPTVILT 617

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 1256 GQDYTITTTGSDGKIETNVVSHITTT-VNGKPTTITT 1291
            G+D T   T  DG + T+++SHITTT  +GKPT I T
Sbjct: 778  GKDKTTVVTDKDGHVHTDIISHITTTDKDGKPTVILT 814

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 1256 GQDYTITTTGSDGKIETNVVSHITTT-VNGKPTTITT 1291
            G+D T   T  DG + T+++SHITTT  +GKPT I T
Sbjct: 953  GKDKTTVVTDKDGHVHTDIISHITTTDKDGKPTVILT 989

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/14 (100%), Positives = 14/14 (100%)

Query: 916 GKPTVILTQYQSPT 929
           GKPTVILTQYQSPT
Sbjct: 490 GKPTVILTQYQSPT 503

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/14 (100%), Positives = 14/14 (100%)

Query: 1089 GKPTVILTQYQSPT 1102
            GKPTVILTQYQSPT
Sbjct: 490  GKPTVILTQYQSPT 503

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/14 (100%), Positives = 14/14 (100%)

Query: 916 GKPTVILTQYQSPT 929
           GKPTVILTQYQSPT
Sbjct: 610 GKPTVILTQYQSPT 623

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/14 (100%), Positives = 14/14 (100%)

Query: 1089 GKPTVILTQYQSPT 1102
            GKPTVILTQYQSPT
Sbjct: 610  GKPTVILTQYQSPT 623

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/14 (100%), Positives = 14/14 (100%)

Query: 916 GKPTVILTQYQSPT 929
           GKPTVILTQYQSPT
Sbjct: 807 GKPTVILTQYQSPT 820

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/14 (100%), Positives = 14/14 (100%)

Query: 1089 GKPTVILTQYQSPT 1102
            GKPTVILTQYQSPT
Sbjct: 807  GKPTVILTQYQSPT 820

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/14 (100%), Positives = 14/14 (100%)

Query: 916 GKPTVILTQYQSPT 929
           GKPTVILTQYQSPT
Sbjct: 982 GKPTVILTQYQSPT 995

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/14 (100%), Positives = 14/14 (100%)

Query: 1089 GKPTVILTQYQSPT 1102
            GKPTVILTQYQSPT
Sbjct: 982  GKPTVILTQYQSPT 995

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/14 (100%), Positives = 14/14 (100%)

Query: 916  GKPTVILTQYQSPT 929
            GKPTVILTQYQSPT
Sbjct: 1113 GKPTVILTQYQSPT 1126

>CAGL0J01727g complement(157842..160781) some similarities with
           sp|P08640 Saccharomyces cerevisiae YIR019c STA1,
           hypothetical start
          Length = 979

 Score =  197 bits (500), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 123/316 (38%), Positives = 174/316 (55%), Gaps = 10/316 (3%)

Query: 11  SFLYIQGVFAQAKNYEGNQDLKNELVIQNGDTISYVDGSEYNFGGGIVSSQEGCTFRAVA 70
           SF   Q V+       GNQ   +E+VI +G  ++  DGSEY F GG   +Q+ C     A
Sbjct: 13  SFANAQNVYNTPTVLTGNQKFSDEVVINDGSALTLNDGSEYIFDGGFRGAQQ-CFMDINA 71

Query: 71  NDKSDFDFNVG---KEFVNYCNFELINKNL-DGFKQTINFSPAVFKNYYQVDIQLAHTRS 126
           +  S F    G   KEF + C   + N N      QTIN SP VFKN  +  + LAHT S
Sbjct: 72  DKDSPFTLTFGSNAKEFDSSCAVTINNPNTGPDTVQTINISPPVFKNSNKFILNLAHTSS 131

Query: 127 DAVSKLILGSPEIINAGKLTVRPYSAVEQNDPSREGNILQISTPGGRLVNTGTIELSLGV 186
           DA SK+I+GSP+I N G++     +  E +DP+  GN+LQI TP G + N GTI L+   
Sbjct: 132 DANSKIIIGSPDITNTGEINYI-STGGEIHDPNELGNVLQIGTPSGSIQNVGTISLNAAN 190

Query: 187 KYYLYGDVSGTG-NINIARGILHMETTSFVGNTINLGGISGISVKSTSSNIIKVRGLISG 245
            YYL+G VSG G  IN+ +G+L +++ SF  N I+L     IS++   +  + V GL + 
Sbjct: 191 SYYLFGKVSGKGGKINVEKGVLQIDSASFTDNVIHLSPGGAISLRRPPAEEVNVSGLGTA 250

Query: 246 NLISSIGDNGSFTYNNQTGIVTVNTDSGRYVYDIGCGYDETTLGSTTGYIVYHGESL-KT 304
             ISSIG +G F Y+++TG++++ T  G Y Y+IGCGY+   L S     +Y  ++L  T
Sbjct: 251 TAISSIGKDGKFEYDSKTGLLSITTSEGVYKYNIGCGYNP-ELASAQEIKIYFQDTLYDT 309

Query: 305 FVIATSLETAPDYQKC 320
           F      +  P   KC
Sbjct: 310 FSFEIQ-QAPPTDSKC 324

>CAGL0J02530g complement(248026..250290) some similarities with
           tr|Q12218 Saccharomyces cerevisiae YOR009w, hypothetical
           start
          Length = 754

 Score =  166 bits (421), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 114/313 (36%), Positives = 165/313 (52%), Gaps = 8/313 (2%)

Query: 1   MLCYTPLFLSSFLYI--QGVFAQAKNYEGNQDLKNELVIQNGDTISYVDGSEYNFGGGIV 58
           M     LF +S++ +  Q          GNQ+   ++ +Q+  T++  DGSEY F   + 
Sbjct: 3   MFSRILLFFASYVLVKAQQTITTPTTLTGNQNFNEDIDVQSSLTLN--DGSEYIFNNLLD 60

Query: 59  SSQEGCTFRAVANDKSDFDFNVGKEFVNYCNFELINKNLDGF--KQTINFSPAVFKNYYQ 116
            S +  +  A A   S F F++           L   N  G   +Q IN +P+ F N   
Sbjct: 61  ISLDTASVEANAQSGSVFTFSMPPSSSFSNLGTLTINNNAGVVSEQHININPSTFSNSGT 120

Query: 117 VDIQLAHTRSDAVSKLILGSPEIINAGKLTVRPYSAVEQNDPSREGNILQISTPGGRLVN 176
           + I++ H +SD+ S +++ SP   N+G +     +  E NDP  EGNIL I + G  L N
Sbjct: 121 LTIRVVHYQSDSSSTMLIDSPSFANSGTINYE-RTGTEINDPGLEGNILHIGSAGHALDN 179

Query: 177 TGTIELSLGVKYYLYGDVSGTG-NINIARGILHMETTSFVGNTINLGGISGISVKSTSSN 235
           TG I L+ G  YYL G++ G G +IN+  G+LH+++TSF GNTINLG    +++      
Sbjct: 180 TGIINLAAGNNYYLQGNIQGEGGSINVNYGLLHIDSTSFAGNTINLGPEGALAMIRPVPE 239

Query: 236 IIKVRGLISGNLISSIGDNGSFTYNNQTGIVTVNTDSGRYVYDIGCGYDETTLGSTTGYI 295
            + VRG  + N I+S G NG+F YN QTGI+TV TD   Y YDIGCGYD   L  T   I
Sbjct: 240 TVVVRGFAAPNFIASAGTNGAFAYNEQTGILTVTTDGNTYTYDIGCGYDPALLIGTQSSI 299

Query: 296 VYHGESLKTFVIA 308
            Y G  +  + +A
Sbjct: 300 GYEGNLVDGYGVA 312

>CAGL0J02508g complement(243607..246219) some similarities with
           tr|Q12218 Saccharomyces cerevisiae YOR009w, hypothetical
           start
          Length = 870

 Score =  142 bits (357), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 81/208 (38%), Positives = 122/208 (58%), Gaps = 3/208 (1%)

Query: 101 KQTINFSPAVFKNYYQVDIQLAHTRSDAVSKLILGSPEIINAGKLTVRPYSAVEQNDPSR 160
           +Q I  +P V  N   + + LAHT +D+ S LI+      N G +      + E NDPS 
Sbjct: 105 EQHIVITPNVMANTGTITLSLAHTNTDSSSTLIIDPVTFYNTGTINYESIGS-ETNDPSL 163

Query: 161 EGNILQISTPGGRLVNTGTIELSLGVKYYLYGDVS-GTGNINIARGILHMETTSFVGNTI 219
            GNIL I + G  L N GTI L+    YYL G ++  +G+IN+ +G L++    F+GNTI
Sbjct: 164 TGNILSIGSSGRTLQNLGTINLNAANSYYLLGTITENSGSINVQKGFLYVNALDFIGNTI 223

Query: 220 NLGGISGISVKSTSSNIIKVRGLISGNLISSIGDNGSFTYNNQTGIVTVNTDSGRYVYDI 279
           NL   + ++  S  S +++VRG+  GN+I+S+G +G+F+YN QTGI+TV T+ G Y YDI
Sbjct: 224 NLSTTTALAFISPVSQVVRVRGVFFGNIIASVGSSGTFSYNTQTGILTVTTN-GVYSYDI 282

Query: 280 GCGYDETTLGSTTGYIVYHGESLKTFVI 307
           GCGY+   +      + + G    TF++
Sbjct: 283 GCGYNPALMSGQQETLSFQGNLYDTFLV 310

>CAGL0J02552g complement(252259..254946) some similarities with
           tr|Q12218 Saccharomyces cerevisiae YOR009w, hypothetical
           start
          Length = 895

 Score =  115 bits (287), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 75/194 (38%), Positives = 111/194 (57%), Gaps = 4/194 (2%)

Query: 94  NKNLDGF--KQTINFSPAVFKNYYQVDIQLAHTRSDAVSKLILGSPEIINAGKLTVRPYS 151
           N NL G    Q+IN  P+   N   + + LA T SDA S L++ +   +N+G ++     
Sbjct: 100 NGNLLGLGGSQSINIIPSSLTNTGTITLDLARTVSDATSLLVIDAGVFVNSGTISYIGGG 159

Query: 152 AVEQNDPSREGNILQISTPGGRLVNTGTIELSLGVKYYLYGDVSGTGN-INIARGILHME 210
           A    DP+  GNILQI + G  + NTGTI L+   +Y L G++ G G  I+I +G L + 
Sbjct: 160 A-GGTDPNLLGNILQIGSVGNTIDNTGTIHLNAAPRYNLLGNIIGDGGVIDIEQGTLVIS 218

Query: 211 TTSFVGNTINLGGISGISVKSTSSNIIKVRGLISGNLISSIGDNGSFTYNNQTGIVTVNT 270
           + +F GN+I L   +  +  +  +N I V GL+    I S+G +GSF Y+  TGI+TV T
Sbjct: 219 SQTFTGNSIALHPNTAAAFVNAQANAIVVTGLLDAAAIISLGVDGSFVYDPTTGILTVTT 278

Query: 271 DSGRYVYDIGCGYD 284
             G ++YDIGCG+D
Sbjct: 279 SLGVFLYDIGCGFD 292

>CAGL0H10626g 1043943..1047923 some similarities with sp|P32768
            Saccharomyces cerevisiae YAR050w FLO1, hypothetical start
          Length = 1326

 Score =  105 bits (263), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 78/120 (65%), Gaps = 2/120 (1%)

Query: 1258 DYTITTTGSDGKIETNVVSHITTT-VNGKPTTITTTVPCDVSAEKDRTTTVTHSNGVIET 1316
            DYT T    +G+ ET+VVSHITT   +GKPTTI TT+P   S E D TTT+   NG  ET
Sbjct: 386  DYTTTIDKGNGEFETDVVSHITTKDSDGKPTTIVTTIPWKPSEEADYTTTIDKGNGEFET 445

Query: 1317 NVVSHITTT-VNGKPTTIITTGSFDVGAGKDRITTITHSNGVIETNVVSHITTVDTKGNP 1375
            +VVSHITT   +GKPTTI+TT  +      D  TTI   NG  ET+VVSHITT D+ G P
Sbjct: 446  DVVSHITTKDSDGKPTTIVTTIPWKPSEEADYTTTIDKGNGEFETDVVSHITTKDSDGKP 505

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 77/120 (64%), Gaps = 3/120 (2%)

Query: 1258 DYTITTTGSDGKIETNVVSHITTT-VNGKPTTITTTVPCDVSAEKDRTTTVTHSNGVIET 1316
            DYT T    +G+ ET+VVSHITT   +GKPTTI TT+P   S E D TTT+   NG  ET
Sbjct: 431  DYTTTIDKGNGEFETDVVSHITTKDSDGKPTTIVTTIPWKPSEEADYTTTIDKGNGEFET 490

Query: 1317 NVVSHITTT-VNGKPTTIITTGSFDVG-AGKDRITTITHSNGVIETNVVSHITTVDTKGN 1374
            +VVSHITT   +GKPTTI+TT       AG+   TT   S+G   T VVSHITT D+ GN
Sbjct: 491  DVVSHITTKDSDGKPTTIVTTIPLKPSDAGEADYTTTITSDGHTITEVVSHITTTDSDGN 550

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 66/120 (55%), Gaps = 4/120 (3%)

Query: 1257 QDYTITTTGSDGKIETNVVSHITTTVNGKPTTITTTVPCDVSAEKDRTTTVTHSNGVIET 1316
             +Y ITT  SDGK   ++     + V   P  +   +    S E D TTT+   NG  ET
Sbjct: 344  HNYNITTKYSDGK---SIQQQGYSGVQSYPNELIVYLYAPPSEEPDYTTTIDKGNGEFET 400

Query: 1317 NVVSHITTT-VNGKPTTIITTGSFDVGAGKDRITTITHSNGVIETNVVSHITTVDTKGNP 1375
            +VVSHITT   +GKPTTI+TT  +      D  TTI   NG  ET+VVSHITT D+ G P
Sbjct: 401  DVVSHITTKDSDGKPTTIVTTIPWKPSEEADYTTTIDKGNGEFETDVVSHITTKDSDGKP 460

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 83/186 (44%), Gaps = 65/186 (34%)

Query: 1254 PSGQ-DYTITTTGSDGKIETNVVSHITTT-VNGKPTTITTTVPCDVS--AEKDRTTTVTH 1309
            PSG+ DYT T    +G  ET++VSHITTT  +GKPTTI TT+P   S   E D TTT+T 
Sbjct: 771  PSGEADYTTTIDKGNGDFETDLVSHITTTDSDGKPTTIVTTIPLKPSDAGEADYTTTIT- 829

Query: 1310 SNGVIETNVVSHITTTVN----------------------------GKPTTIITTGSFDV 1341
            S+G   T VVSHITTT +                             +P  + TT + D 
Sbjct: 830  SDGHTITEVVSHITTTDSDGNTVTYTTMMASFDQVGDGVYTSAPPYSQPPVVTTTVTEDD 889

Query: 1342 GAGK--------------------------------DRITTITHSNGVIETNVVSHITTV 1369
            G+ K                                D  TTI   NG  ET++VSHITT 
Sbjct: 890  GSSKTVVISYSPSEGEDGVTRTGTTTISTITPSGEADYTTTIDKGNGDFETDLVSHITTT 949

Query: 1370 DTKGNP 1375
            D+ G P
Sbjct: 950  DSDGKP 955

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 65/181 (35%), Positives = 80/181 (44%), Gaps = 64/181 (35%)

Query: 1258 DYTITTTGSDGKIETNVVSHITTT-VNGKPTTITTTVPCDVS--AEKDRTTTVTHSNGVI 1314
            DYT T    +G+ ET+VVSHITT   +GKPTTI TT+P   S   E D TTT+T S+G  
Sbjct: 476  DYTTTIDKGNGEFETDVVSHITTKDSDGKPTTIVTTIPLKPSDAGEADYTTTIT-SDGHT 534

Query: 1315 ETNVVSHITTTVN----------------------------GKPTTIITTGSFDVGAGK- 1345
             T VVSHITTT +                             +P  + TT + D G+ K 
Sbjct: 535  ITEVVSHITTTDSDGNTVTYTTMMASFDQVGDGVYTSAPPYSQPPVVTTTVTEDDGSSKT 594

Query: 1346 -------------------------------DRITTITHSNGVIETNVVSHITTVDTKGN 1374
                                           D  TTI   NG  ET++VSHITT D+ GN
Sbjct: 595  VVISYSPSEGEDGVTRTGTTTISTITPSGEADYTTTIDKGNGDFETDLVSHITTKDSNGN 654

Query: 1375 P 1375
            P
Sbjct: 655  P 655

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 81/186 (43%), Gaps = 65/186 (34%)

Query: 1254 PSGQ-DYTITTTGSDGKIETNVVSHITTT-VNGKPTTITTTVPCDVS--AEKDRTTTVTH 1309
            PSG+ DYT T    +G  ET++VSHITT   NG PTTI TT+P   S   E D TTT+T 
Sbjct: 621  PSGEADYTTTIDKGNGDFETDLVSHITTKDSNGNPTTIVTTIPLKPSDAGEADYTTTIT- 679

Query: 1310 SNGVIETNVVSHITTTVN----------------------------GKPTTIITTGSFDV 1341
            S+G   T VVSHITTT +                             +P  + TT + D 
Sbjct: 680  SDGHTITEVVSHITTTDSDGNTVTYTTTMASFDQVGDGVYTSAPPYSQPPVVTTTVTEDD 739

Query: 1342 GAGK--------------------------------DRITTITHSNGVIETNVVSHITTV 1369
            G+ K                                D  TTI   NG  ET++VSHITT 
Sbjct: 740  GSSKTVVISYSPSEGEDGVTRTGTTTISTITPSGEADYTTTIDKGNGDFETDLVSHITTT 799

Query: 1370 DTKGNP 1375
            D+ G P
Sbjct: 800  DSDGKP 805

 Score = 38.5 bits (88), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 48/77 (62%), Gaps = 4/77 (5%)

Query: 1298 SAEKDRTTTVTHSNGVIETNVVSHITTT-VNGKPTTIITTGSFDVGAGKDRITTITHSNG 1356
            S E D TTT+   NG  ET++VSHITTT  +GKPTTIITT +      +   T++  S+G
Sbjct: 922  SGEADYTTTIDKGNGDFETDLVSHITTTDSDGKPTTIITTVTL---IEEPDYTSVFVSDG 978

Query: 1357 VIETNVVSHITTVDTKG 1373
               T VVSH+TT +  G
Sbjct: 979  HTITAVVSHVTTTNDIG 995

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 37/62 (59%), Gaps = 6/62 (9%)

Query: 1089 GKPTVILT--QYQSPTAAQDGTSKTITVDGEEIIEVV-HITTYTDSDGHTITSTYTEMFK 1145
            GKPT I+T    +   A +   + TIT DG  I EVV HITT TDSDG+T+  TYT M  
Sbjct: 503  GKPTTIVTTIPLKPSDAGEADYTTTITSDGHTITEVVSHITT-TDSDGNTV--TYTTMMA 559

Query: 1146 TL 1147
            + 
Sbjct: 560  SF 561

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 37/62 (59%), Gaps = 6/62 (9%)

Query: 1089 GKPTVILT--QYQSPTAAQDGTSKTITVDGEEIIEVV-HITTYTDSDGHTITSTYTEMFK 1145
            GKPT I+T    +   A +   + TIT DG  I EVV HITT TDSDG+T+  TYT M  
Sbjct: 803  GKPTTIVTTIPLKPSDAGEADYTTTITSDGHTITEVVSHITT-TDSDGNTV--TYTTMMA 859

Query: 1146 TL 1147
            + 
Sbjct: 860  SF 861

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 21/30 (70%)

Query: 1346 DRITTITHSNGVIETNVVSHITTVDTKGNP 1375
            D  TT+   NG  ET+V+SHITT D+ GNP
Sbjct: 1071 DYTTTVDRGNGSTETDVISHITTTDSNGNP 1100

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/32 (62%), Positives = 22/32 (68%), Gaps = 1/32 (3%)

Query: 1300 EKDRTTTVTHSNGVIETNVVSHITTT-VNGKP 1330
            E D TTTV   NG  ET+V+SHITTT  NG P
Sbjct: 1069 EVDYTTTVDRGNGSTETDVISHITTTDSNGNP 1100

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 34/56 (60%), Gaps = 4/56 (7%)

Query: 1089 GKPTVILT--QYQSPTAAQDGTSKTITVDGEEIIEVV-HITTYTDSDGHTITSTYT 1141
            G PT I+T    +   A +   + TIT DG  I EVV HITT TDSDG+T+T T T
Sbjct: 653  GNPTTIVTTIPLKPSDAGEADYTTTITSDGHTITEVVSHITT-TDSDGNTVTYTTT 707

>CAGL0G10219g 988766..991744 some similarities with sp|P38894
            Saccharomyces cerevisiae YHR211w FLO5, hypothetical start
          Length = 992

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 68/127 (53%), Positives = 82/127 (64%), Gaps = 5/127 (3%)

Query: 1254 PSGQ-DYTITTTGSDGKIETNVVSHITTT-VNGKPTTITTTVPC-DVSAEKDRTTTVTHS 1310
            PSG+ DYT T    +G  ET++VSHITT   NG PTTI TT+P    S E D TTT+   
Sbjct: 422  PSGEADYTTTIDKGNGDFETDLVSHITTKDSNGNPTTIVTTIPLTKPSGEADYTTTIDKG 481

Query: 1311 NGVIETNVVSHITTT-VNGKPTTIITTGSFDVGAGK-DRITTITHSNGVIETNVVSHITT 1368
            NG  ET++VSHITT   NG PTTI+TT      +G+ D  TTI   NG  ET++VSHITT
Sbjct: 482  NGDFETDLVSHITTKDSNGNPTTIVTTIPLTKPSGEADYTTTIDKGNGDFETDLVSHITT 541

Query: 1369 VDTKGNP 1375
             D+ GNP
Sbjct: 542  KDSNGNP 548

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 65/123 (52%), Positives = 79/123 (64%), Gaps = 4/123 (3%)

Query: 1257 QDYTITTTGSDGKIETNVVSHITTT-VNGKPTTITTTVPC-DVSAEKDRTTTVTHSNGVI 1314
            +DYT T    +G  ET++VSHITT   NG PTTI TT+P    S E D TTT+   NG  
Sbjct: 380  EDYTTTIDKGNGDFETDLVSHITTKDSNGNPTTIVTTIPLTKPSGEADYTTTIDKGNGDF 439

Query: 1315 ETNVVSHITTT-VNGKPTTIITTGSFDVGAGK-DRITTITHSNGVIETNVVSHITTVDTK 1372
            ET++VSHITT   NG PTTI+TT      +G+ D  TTI   NG  ET++VSHITT D+ 
Sbjct: 440  ETDLVSHITTKDSNGNPTTIVTTIPLTKPSGEADYTTTIDKGNGDFETDLVSHITTKDSN 499

Query: 1373 GNP 1375
            GNP
Sbjct: 500  GNP 502

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 67/127 (52%), Positives = 81/127 (63%), Gaps = 5/127 (3%)

Query: 1254 PSGQ-DYTITTTGSDGKIETNVVSHITTT-VNGKPTTITTTVPC-DVSAEKDRTTTVTHS 1310
            PSG+ DYT T    +G  ET++VSHITT   NG PTTI TT+P    S E D TTT+   
Sbjct: 468  PSGEADYTTTIDKGNGDFETDLVSHITTKDSNGNPTTIVTTIPLTKPSGEADYTTTIDKG 527

Query: 1311 NGVIETNVVSHITTT-VNGKPTTIITTGSFDVGAGK-DRITTITHSNGVIETNVVSHITT 1368
            NG  ET++VSHITT   NG PTTI+TT      +G+ D  TTI   NG  ET++VSHITT
Sbjct: 528  NGDFETDLVSHITTKDSNGNPTTIVTTIPLTKPSGEADYTTTIDKGNGDFETDLVSHITT 587

Query: 1369 VDTKGNP 1375
             D+ G P
Sbjct: 588  KDSNGKP 594

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 41/81 (50%), Positives = 53/81 (65%), Gaps = 2/81 (2%)

Query: 1297 VSAEKDRTTTVTHSNGVIETNVVSHITTT-VNGKPTTIITTGSFDVGAGK-DRITTITHS 1354
            +  ++D TTT+   NG  ET++VSHITT   NG PTTI+TT      +G+ D  TTI   
Sbjct: 376  ICKKEDYTTTIDKGNGDFETDLVSHITTKDSNGNPTTIVTTIPLTKPSGEADYTTTIDKG 435

Query: 1355 NGVIETNVVSHITTVDTKGNP 1375
            NG  ET++VSHITT D+ GNP
Sbjct: 436  NGDFETDLVSHITTKDSNGNP 456

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 46/83 (55%), Gaps = 9/83 (10%)

Query: 1300 EKDRTTTVTHSNGVIETNVVSHITTT-VNGKPTTIITTGS-------FDVGAGKDRITTI 1351
            E D TTTV   NG IET+V+SHITTT  NG PTTI TT +            G D  TT+
Sbjct: 708  EADYTTTVDRGNGSIETDVISHITTTDSNGNPTTITTTITNAPAPSISKANIGSDYTTTV 767

Query: 1352 THSNGVIETNVVSHITTVDTKGN 1374
              SNG   T VVSH T  D  G+
Sbjct: 768  V-SNGHTFTEVVSHSTGTDEHGH 789

 Score = 38.9 bits (89), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 22/30 (73%)

Query: 1346 DRITTITHSNGVIETNVVSHITTVDTKGNP 1375
            D  TT+   NG IET+V+SHITT D+ GNP
Sbjct: 710  DYTTTVDRGNGSIETDVISHITTTDSNGNP 739

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 43/78 (55%), Gaps = 13/78 (16%)

Query: 1306 TVTHSNGVIETN-------VVSHI-TTTVNGKPTTIITTGSFDVGAGKDRITTITHSNGV 1357
            TVT    +I TN       V+S I TT+++    T+IT     +   +D  TTI   NG 
Sbjct: 338  TVTQEYNIIPTNCFVEDIWVISFIGTTSISYIEETMIT-----ICKKEDYTTTIDKGNGD 392

Query: 1358 IETNVVSHITTVDTKGNP 1375
             ET++VSHITT D+ GNP
Sbjct: 393  FETDLVSHITTKDSNGNP 410

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 41/76 (53%), Positives = 44/76 (57%), Gaps = 9/76 (11%)

Query: 1258 DYTITTTGSDGKIETNVVSHITTT-VNGKPTTITTT-----VPCDVSAE--KDRTTTVTH 1309
            DYT T    +G IET+V+SHITTT  NG PTTITTT      P    A    D TTTV  
Sbjct: 710  DYTTTVDRGNGSIETDVISHITTTDSNGNPTTITTTITNAPAPSISKANIGSDYTTTVV- 768

Query: 1310 SNGVIETNVVSHITTT 1325
            SNG   T VVSH T T
Sbjct: 769  SNGHTFTEVVSHSTGT 784

>CAGL0I11011g 1085865..>1089401 some similarities with sp|P32768
            Saccharomyces cerevisiae YAR050w FLO1, hypothetical start
          Length = 1179

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 87/127 (68%), Gaps = 5/127 (3%)

Query: 1254 PSGQ-DYTITTTGSDGKIETNVVSHITTT-VNGKPTTITTTVPC-DVSAEKDRTTTVTHS 1310
            PSG+ DYT   TGSD  + T++VSHITTT  NGKPT + TT+P    S+E D TT +T S
Sbjct: 980  PSGEADYTTVITGSDSMVHTDLVSHITTTGSNGKPTMMVTTIPLTKPSSEADYTTVITGS 1039

Query: 1311 NGVIETNVVSHITTT-VNGKPTTIITTGSFDVGAGK-DRITTITHSNGVIETNVVSHITT 1368
            + ++ T++VSHITTT  NGKPTT++TT      +G+ D  T IT S+ ++ T++VSHITT
Sbjct: 1040 DSMVHTDLVSHITTTGSNGKPTTMVTTIPLTKPSGEADYTTVITGSDSMVHTDLVSHITT 1099

Query: 1369 VDTKGNP 1375
              + G P
Sbjct: 1100 TGSNGKP 1106

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 86/127 (67%), Gaps = 5/127 (3%)

Query: 1254 PSGQ-DYTITTTGSDGKIETNVVSHITTT-VNGKPTTITTTVPC-DVSAEKDRTTTVTHS 1310
            PS + DYT   TGSD  + T++VSHITTT  NGKPTT+ TT+P    S E D TT +T S
Sbjct: 1026 PSSEADYTTVITGSDSMVHTDLVSHITTTGSNGKPTTMVTTIPLTKPSGEADYTTVITGS 1085

Query: 1311 NGVIETNVVSHITTT-VNGKPTTIITTGSFDVGAGK-DRITTITHSNGVIETNVVSHITT 1368
            + ++ T++VSHITTT  NGKPTT++TT      +G+ D  T IT S+ ++ T++VSHITT
Sbjct: 1086 DSMVHTDLVSHITTTGSNGKPTTMVTTIPLTKPSGEADYTTVITGSDSMVHTDLVSHITT 1145

Query: 1369 VDTKGNP 1375
              + G P
Sbjct: 1146 TGSNGKP 1152

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 53/102 (51%), Positives = 70/102 (68%), Gaps = 4/102 (3%)

Query: 1254 PSGQ-DYTITTTGSDGKIETNVVSHITTT-VNGKPTTITTTVPC-DVSAEKDRTTTVTHS 1310
            PSG+ DYT   TGSD  + T++VSHITTT  NGKPTT+ TT+P    S E D TT +T S
Sbjct: 1072 PSGEADYTTVITGSDSMVHTDLVSHITTTGSNGKPTTMVTTIPLTKPSGEADYTTVITGS 1131

Query: 1311 NGVIETNVVSHITTT-VNGKPTTIITTGSFDVGAGKDRITTI 1351
            + ++ T++VSHITTT  NGKPTT++TT      +G+   TT+
Sbjct: 1132 DSMVHTDLVSHITTTGSNGKPTTMVTTIPLTKPSGEADYTTV 1173

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 65/100 (65%), Gaps = 3/100 (3%)

Query: 1279 TTTVNGKPTTITTTVPC-DVSAEKDRTTTVTHSNGVIETNVVSHITTT-VNGKPTTIITT 1336
            +T  NGKPTT+ TT+P    S E D TT +T S+ ++ T++VSHITTT  NGKPT ++TT
Sbjct: 961  STVSNGKPTTMVTTIPLTKPSGEADYTTVITGSDSMVHTDLVSHITTTGSNGKPTMMVTT 1020

Query: 1337 GSFDVGAGK-DRITTITHSNGVIETNVVSHITTVDTKGNP 1375
                  + + D  T IT S+ ++ T++VSHITT  + G P
Sbjct: 1021 IPLTKPSSEADYTTVITGSDSMVHTDLVSHITTTGSNGKP 1060

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 69/156 (44%), Gaps = 47/156 (30%)

Query: 1260 TITTTGSDGKIETNVVS-HITTTVNGKPTTITTTVPCDVSAEKDRTTTVTHSNGVIETNV 1318
            T+T T S G + T  +S +ITT  +G  +   TT+   ++ ++       ++  +  ++ 
Sbjct: 866  TLTVTDSQGHLTTETISWYITTYKDGVVSIYETTLTPSMTTDE-------YTTAITSSDF 918

Query: 1319 VSHITTT--------------------------------------VNGKPTTIITTGSFD 1340
            VSHITTT                                       NGKPTT++TT    
Sbjct: 919  VSHITTTDSNGKLTTIVTTVITYTTVTTVINYPTQVETTTDYSTVSNGKPTTMVTTIPLT 978

Query: 1341 VGAGK-DRITTITHSNGVIETNVVSHITTVDTKGNP 1375
              +G+ D  T IT S+ ++ T++VSHITT  + G P
Sbjct: 979  KPSGEADYTTVITGSDSMVHTDLVSHITTTGSNGKP 1014

>CAGL0I10362g 1011132..1014743 some similarities with sp|P32768
            Saccharomyces cerevisiae YAR050w FLO1, hypothetical start
          Length = 1217

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 74/125 (59%), Gaps = 2/125 (1%)

Query: 1253 TPSGQDYTITTTGSDGKIETNVVSHITTT-VNGKPTTITTTVPCDVSAEKDRTTTVTHSN 1311
            T  G D T   T  DG + T+++SHITTT   G PT I TT P       D+TT VT  +
Sbjct: 562  TDDGLDKTTVVTDEDGTVHTDIISHITTTDAEGNPTIILTTYPSPTDDGLDKTTVVTDED 621

Query: 1312 GVIETNVVSHITTT-VNGKPTTIITTGSFDVGAGKDRITTITHSNGVIETNVVSHITTVD 1370
            G + T+++SHITTT   G PT I+TT       G D+ T +T  +G + T+++SHITT D
Sbjct: 622  GTVHTDIISHITTTDAEGNPTIILTTYPSPTDDGLDKTTVVTDEDGTVHTDIISHITTTD 681

Query: 1371 TKGNP 1375
             +GNP
Sbjct: 682  AEGNP 686

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 74/125 (59%), Gaps = 2/125 (1%)

Query: 1253 TPSGQDYTITTTGSDGKIETNVVSHITTT-VNGKPTTITTTVPCDVSAEKDRTTTVTHSN 1311
            T  G D T   T  DG + T+++SHITTT   G PT I TT P       D+TT VT  +
Sbjct: 607  TDDGLDKTTVVTDEDGTVHTDIISHITTTDAEGNPTIILTTYPSPTDDGLDKTTVVTDED 666

Query: 1312 GVIETNVVSHITTT-VNGKPTTIITTGSFDVGAGKDRITTITHSNGVIETNVVSHITTVD 1370
            G + T+++SHITTT   G PT I+TT       G D+ T +T  +G + T+++SHITT D
Sbjct: 667  GTVHTDIISHITTTDAEGNPTIILTTYPSPTDDGLDKTTVVTDEDGTVHTDIISHITTTD 726

Query: 1371 TKGNP 1375
             +GNP
Sbjct: 727  AEGNP 731

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 73/122 (59%), Gaps = 2/122 (1%)

Query: 1256 GQDYTITTTGSDGKIETNVVSHITTT-VNGKPTTITTTVPCDVSAEKDRTTTVTHSNGVI 1314
            G D T   T  DG + T+++SHITTT   G PT I TT P       D+TT VT  +G +
Sbjct: 520  GLDKTTVVTDEDGTVHTDIISHITTTDAEGNPTIILTTYPSPTDDGLDKTTVVTDEDGTV 579

Query: 1315 ETNVVSHITTT-VNGKPTTIITTGSFDVGAGKDRITTITHSNGVIETNVVSHITTVDTKG 1373
             T+++SHITTT   G PT I+TT       G D+ T +T  +G + T+++SHITT D +G
Sbjct: 580  HTDIISHITTTDAEGNPTIILTTYPSPTDDGLDKTTVVTDEDGTVHTDIISHITTTDAEG 639

Query: 1374 NP 1375
            NP
Sbjct: 640  NP 641

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 69/123 (56%), Gaps = 4/123 (3%)

Query: 1254 PSGQDYTITTTGSDGKIETNVVSHITTTVNGKPTTITTTVPCDVSAEKDRTTTVTHSNGV 1313
            PS    TIT  G +   ET+ VS+  TT        +++V   +    D+TT VT  +G 
Sbjct: 477  PSPTTITITKEGVE---ETDYVSYFITTDAEHNIITSSSVSKILDDGLDKTTVVTDEDGT 533

Query: 1314 IETNVVSHITTT-VNGKPTTIITTGSFDVGAGKDRITTITHSNGVIETNVVSHITTVDTK 1372
            + T+++SHITTT   G PT I+TT       G D+ T +T  +G + T+++SHITT D +
Sbjct: 534  VHTDIISHITTTDAEGNPTIILTTYPSPTDDGLDKTTVVTDEDGTVHTDIISHITTTDAE 593

Query: 1373 GNP 1375
            GNP
Sbjct: 594  GNP 596

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/86 (46%), Positives = 51/86 (59%), Gaps = 2/86 (2%)

Query: 1253 TPSGQDYTITTTGSDGKIETNVVSHITTT-VNGKPTTITTTVPCDVSAEKDRTTTVTHSN 1311
            T  G D T   T  DG + T+++SHITTT   G PT I TT P       D+TT VT  +
Sbjct: 652  TDDGLDKTTVVTDEDGTVHTDIISHITTTDAEGNPTIILTTYPSPTDDGLDKTTVVTDED 711

Query: 1312 GVIETNVVSHITTT-VNGKPTTIITT 1336
            G + T+++SHITTT   G PT I+TT
Sbjct: 712  GTVHTDIISHITTTDAEGNPTIILTT 737

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 55/108 (50%), Gaps = 7/108 (6%)

Query: 1089 GKPTVILTQYQSPTAAQD-------GTSKTITVDGEEIIEVVHITTYTDSDGHTITSTYT 1141
            G PT+ILT Y SPT   D        ++ + T DG  I+EVV++T YT S+G  + +T T
Sbjct: 729  GNPTIILTTYPSPTDNVDISTSLPQPSTTSYTEDGVVIVEVVYVTIYTASNGDVMLTTIT 788

Query: 1142 EMFKTLIDAEPQYVSEXXXXXXXXXXXXXXXXXXXXYNIDNNGNAVPI 1189
            E+ K +IDA P +VS                     Y IDNNGN  PI
Sbjct: 789  ELSKEMIDAGPIWVSPTTSTVTTVDSNGNTLTITTSYLIDNNGNTGPI 836

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 55/108 (50%), Gaps = 7/108 (6%)

Query: 1089 GKPTVILTQYQSPTAAQD-------GTSKTITVDGEEIIEVVHITTYTDSDGHTITSTYT 1141
            G PT+ILT Y SPT   D        ++ + T DG  I+EVV++T YT S+G  + +T T
Sbjct: 880  GNPTIILTTYPSPTDNVDISTSLPQPSTTSYTEDGVVIVEVVYVTIYTASNGDVMLTTIT 939

Query: 1142 EMFKTLIDAEPQYVSEXXXXXXXXXXXXXXXXXXXXYNIDNNGNAVPI 1189
            E+ K +IDA P +VS                     Y IDNNGN  PI
Sbjct: 940  ELSKEMIDAGPIWVSPTTSTVTTVDSNGNTLTITTSYLIDNNGNTGPI 987

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 43/75 (57%), Gaps = 1/75 (1%)

Query: 1302 DRTTTVTHSNGVIETNVVSHITTT-VNGKPTTIITTGSFDVGAGKDRITTITHSNGVIET 1360
            D+TT VT  +G + T+++SHITTT   G PT I+TT       GKDR T I+ S+  +  
Sbjct: 1004 DKTTVVTDEDGTVHTDIISHITTTDAEGNPTIILTTYPSTAEDGKDRPTVISSSDSTMPP 1063

Query: 1361 NVVSHITTVDTKGNP 1375
            + +S  +  D+   P
Sbjct: 1064 HKLSSSSRADSDIKP 1078

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 33/60 (55%), Gaps = 1/60 (1%)

Query: 1256 GQDYTITTTGSDGKIETNVVSHITTT-VNGKPTTITTTVPCDVSAEKDRTTTVTHSNGVI 1314
            G D T   T  DG + T+++SHITTT   G PT I TT P      KDR T ++ S+  +
Sbjct: 1002 GLDKTTVVTDEDGTVHTDIISHITTTDAEGNPTIILTTYPSTAEDGKDRPTVISSSDSTM 1061

 Score = 38.5 bits (88), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 29/46 (63%)

Query: 1330 PTTIITTGSFDVGAGKDRITTITHSNGVIETNVVSHITTVDTKGNP 1375
            P ++I++       G D+ T +T  +G + T+++SHITT D +GNP
Sbjct: 837  PNSVISSSVQPSDDGLDKTTVVTDEDGTVHTDIISHITTTDAEGNP 882

 Score = 38.5 bits (88), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 29/46 (63%)

Query: 1330 PTTIITTGSFDVGAGKDRITTITHSNGVIETNVVSHITTVDTKGNP 1375
            P ++I++       G D+ T +T  +G + T+++SHITT D +GNP
Sbjct: 988  PNSVISSSVQPSDDGLDKTTVVTDEDGTVHTDIISHITTTDAEGNP 1033

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 49/164 (29%), Positives = 70/164 (42%), Gaps = 49/164 (29%)

Query: 1259 YTITTTGSDGKIETNVVSHITTTVNGKPTTITT---------------TVPCDVSAE--- 1300
            +T T T +  ++E  V    T   +GKPT +TT               TV  DV  E   
Sbjct: 390  FTTTYTSNHEQVEAEVSYIPTVDADGKPTYVTTTKVIAISHLPPPPGYTVTVDVGNEVTH 449

Query: 1301 ---------KDR-------TTTVTHS-----------NGVIETNVVSHITTTVNGKPTTI 1333
                     +D        T+TVT +            GV ET+ VS+  TT       I
Sbjct: 450  YEVVSYFTTEDENGQFYTGTSTVTFTPPSPTTITITKEGVEETDYVSYFITT--DAEHNI 507

Query: 1334 ITTGSFD--VGAGKDRITTITHSNGVIETNVVSHITTVDTKGNP 1375
            IT+ S    +  G D+ T +T  +G + T+++SHITT D +GNP
Sbjct: 508  ITSSSVSKILDDGLDKTTVVTDEDGTVHTDIISHITTTDAEGNP 551

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 26/36 (72%), Gaps = 1/36 (2%)

Query: 1302 DRTTTVTHSNGVIETNVVSHITTT-VNGKPTTIITT 1336
            D+TT VT  +G + T+++SHITTT   G PT I+TT
Sbjct: 853  DKTTVVTDEDGTVHTDIISHITTTDAEGNPTIILTT 888

 Score = 34.7 bits (78), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 24/40 (60%), Gaps = 1/40 (2%)

Query: 1256 GQDYTITTTGSDGKIETNVVSHITTT-VNGKPTTITTTVP 1294
            G D T   T  DG + T+++SHITTT   G PT I TT P
Sbjct: 851  GLDKTTVVTDEDGTVHTDIISHITTTDAEGNPTIILTTYP 890

>CAGL0K00110g complement(3332..5830) some similarities with tr|Q08294
            Saccharomyces cerevisiae YOL155c, hypothetical start
          Length = 832

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/111 (54%), Positives = 78/111 (70%), Gaps = 4/111 (3%)

Query: 1261 ITTTGSDGKIETNVVSHITTT-VNGKPTTITTTVPCDVSAEKDRTTTVTHSNGVIETNVV 1319
            ITTT SDGK  T +VSHITTT  +GKPTTI TT P   ++  D TT VT+++G +ET++V
Sbjct: 599  ITTTDSDGK-PTTIVSHITTTDSDGKPTTIVTTFPAPAASGADYTTVVTNADGSVETDIV 657

Query: 1320 SHITTTVN-GKPTTIITTGSFDVGAG-KDRITTITHSNGVIETNVVSHITT 1368
            SHITT  + GKPTT++TT  + + A   D  T +T SN  +ET VVSHITT
Sbjct: 658  SHITTKDSIGKPTTVVTTVPYTLCASNADYTTVVTKSNVSVETEVVSHITT 708

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 70/123 (56%), Gaps = 31/123 (25%)

Query: 1255 SGQDYTITTTGSDGKIETNVVSHITTT-VNGKPTTITTTVPCDVSAEKDRTTTVTHSNGV 1313
            SG +YT   T ++G ++T++VSHITTT  +GKPTTI                        
Sbjct: 576  SGTNYTTVVTNAEGSVQTDIVSHITTTDSDGKPTTI------------------------ 611

Query: 1314 IETNVVSHITTT-VNGKPTTIITTGSFDVGAGKDRITTITHSNGVIETNVVSHITTVDTK 1372
                 VSHITTT  +GKPTTI+TT      +G D  T +T+++G +ET++VSHITT D+ 
Sbjct: 612  -----VSHITTTDSDGKPTTIVTTFPAPAASGADYTTVVTNADGSVETDIVSHITTKDSI 666

Query: 1373 GNP 1375
            G P
Sbjct: 667  GKP 669

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/73 (58%), Positives = 51/73 (69%), Gaps = 2/73 (2%)

Query: 1255 SGQDYTITTTGSDGKIETNVVSHITTTVN-GKPTTITTTVPCDVSAE-KDRTTTVTHSNG 1312
            SG DYT   T +DG +ET++VSHITT  + GKPTT+ TTVP  + A   D TT VT SN 
Sbjct: 637  SGADYTTVVTNADGSVETDIVSHITTKDSIGKPTTVVTTVPYTLCASNADYTTVVTKSNV 696

Query: 1313 VIETNVVSHITTT 1325
             +ET VVSHITTT
Sbjct: 697  SVETEVVSHITTT 709

>CAGL0L09911g 1062345..1066400 some similarities with sp|P08640
            Saccharomyces cerevisiae YIR019c STA1, hypothetical start
          Length = 1351

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 69/121 (57%), Gaps = 8/121 (6%)

Query: 1256 GQDYTITTTGSDGKIETNVVSHITTT-VNGKPTTITTTVPCDVSAEKDRTTTVTHSNGVI 1314
            G   T+ T+G  GK  T VVSHITTT  NG  T I TT+P   S   D TT +T S G  
Sbjct: 1130 GDHTTVITSG--GKPTTVVVSHITTTDSNGHSTVIETTLPVG-SGSNDHTTVIT-SGGKP 1185

Query: 1315 ETNVVSHITTT-VNGKPTTIITTGSFDVGAGKDRITTITHSNGVIETNVVSHITTVDTKG 1373
             T VVSHITTT  NG  T I TT    VG+G    TT+  S G   T VVSHITT D+ G
Sbjct: 1186 TTVVVSHITTTDSNGHSTVIETT--LPVGSGSIDHTTVITSGGKPTTVVVSHITTTDSNG 1243

Query: 1374 N 1374
            N
Sbjct: 1244 N 1244

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 42/81 (51%), Positives = 45/81 (55%), Gaps = 4/81 (4%)

Query: 1255 SGQDYTITTTGSDGKIETNVVSHITTT-VNGKPTTITTTVPCDVSAEKDRTTTVTHSNGV 1313
            SG +   T   S GK  T VVSHITTT  NG  T I TT+P   S   D TT +T S G 
Sbjct: 1170 SGSNDHTTVITSGGKPTTVVVSHITTTDSNGHSTVIETTLPVG-SGSIDHTTVIT-SGGK 1227

Query: 1314 IETNVVSHITTT-VNGKPTTI 1333
              T VVSHITTT  NG   TI
Sbjct: 1228 PTTVVVSHITTTDSNGNTVTI 1248

>CAGL0C00968g 96914..100018 some similarities with tr|Q08294
            Saccharomyces cerevisiae YOL155c, hypothetical start
          Length = 1034

 Score = 54.7 bits (130), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 72/137 (52%), Gaps = 16/137 (11%)

Query: 1254 PSGQDYTITTTGSDGKIETNVVSHITTT-VNGKPTTITTTV-------------PCDVSA 1299
            P+  DYT T T SDG   T VVSHITTT  +GK  TITTT+             P   S 
Sbjct: 504  PAEADYTTTIT-SDGHTITEVVSHITTTDSDGKTVTITTTMASFAQVDEGVFTSPEPYSQ 562

Query: 1300 EKDRTTTVTHSNGVIETNVVSHITTT-VNGKPTTIITTGSFDVGAGKDRITTITHSNGVI 1358
                T+TVT  +G  +T V+S+  +   +G   T  TT S    A  D  TTI   NG  
Sbjct: 563  PPVVTSTVTEDDGSSKTVVISYFPSEGEDGVTRTGTTTVSTITPAEVDYTTTIDKGNGDF 622

Query: 1359 ETNVVSHITTVDTKGNP 1375
            ET++VSHITT D+ GNP
Sbjct: 623  ETDLVSHITTKDSNGNP 639

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/75 (46%), Positives = 46/75 (61%), Gaps = 4/75 (5%)

Query: 1254 PSGQDYTITTTGSDGKIETNVVSHITTT-VNGKPTTITTTVPCDVS--AEKDRTTTVTHS 1310
            P+  DYT T    +G  ET++VSHITT   NG PTTI TT+P   S   E D T+ V  S
Sbjct: 606  PAEVDYTTTIDKGNGDFETDLVSHITTKDSNGNPTTIVTTIPLKPSDGGEADYTS-VFVS 664

Query: 1311 NGVIETNVVSHITTT 1325
            +G   T +V+H+TT+
Sbjct: 665  DGHTITKIVTHVTTS 679

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 68/132 (51%), Gaps = 17/132 (12%)

Query: 1258 DYTITTTGSDGKIETNVVSHITTT-VNGKPTTITTTV-------------PCDVSAEKDR 1303
            DYT T T SDG   T VVSHITTT  +GK  TITTT+             P   S     
Sbjct: 406  DYTTTIT-SDGHTITEVVSHITTTDSDGKTVTITTTMASFAQVDEGVFTSPEPYSQPPVV 464

Query: 1304 TTTVTHSNGVIETNVVSHITTT-VNGKPTTIITTGSFDVGAGKDRITTITHSNGVIETNV 1362
            T+TVT  +G  +T V+S+  +   +G   T  TT S    A  D  TTIT S+G   T V
Sbjct: 465  TSTVTEDDGTSKTVVISYFPSEGEDGVTRTGTTTVSTITPAEADYTTTIT-SDGHTITEV 523

Query: 1363 VSHITTVDTKGN 1374
            VSHITT D+ G 
Sbjct: 524  VSHITTTDSDGK 535

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 42/76 (55%), Gaps = 3/76 (3%)

Query: 1262 TTTGSDGKIETNVVSHITTTVNGKPTTITTTVPCDVSAEKDRTTTVTHSNGVIETNVVSH 1321
            TT   D  +E ++V++   + +      T T+   V  E D TTT+T S+G   T VVSH
Sbjct: 367  TTVSKDRLVEVDIVTYYIASDDTGEHVATKTITVKVE-EPDYTTTIT-SDGHTITEVVSH 424

Query: 1322 ITTT-VNGKPTTIITT 1336
            ITTT  +GK  TI TT
Sbjct: 425  ITTTDSDGKTVTITTT 440

 Score = 31.2 bits (69), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 23/39 (58%), Positives = 26/39 (66%), Gaps = 2/39 (5%)

Query: 1104 AQDGTSKTITVDGEEIIEVV-HITTYTDSDGHTITSTYT 1141
            A+   + TIT DG  I EVV HITT TDSDG T+T T T
Sbjct: 505  AEADYTTTITSDGHTITEVVSHITT-TDSDGKTVTITTT 542

 Score = 31.2 bits (69), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 22/32 (68%), Positives = 23/32 (71%), Gaps = 2/32 (6%)

Query: 1111 TITVDGEEIIEVV-HITTYTDSDGHTITSTYT 1141
            TIT DG  I EVV HITT TDSDG T+T T T
Sbjct: 410  TITSDGHTITEVVSHITT-TDSDGKTVTITTT 440

>YIL169C (YIL169C) [2509] chr9 complement(23119..26106) Protein of
           unknown function, has a region of weak similarity to a
           region of S. cerevisiae Sed4p, which is involved in
           vesicle formation in the endoplasmic reticulum [2988 bp,
           995 aa]
          Length = 995

 Score = 54.3 bits (129), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 65/265 (24%), Positives = 115/265 (43%), Gaps = 40/265 (15%)

Query: 35  LVIQNGDTISYVDGSEYNFG------GGIVSSQEGCTFRAVANDKSDFDFNVGKEFVNYC 88
           +V+  G  ++ +DG +Y+F       G ++  +   T+     D S  +F+V   F    
Sbjct: 330 VVVAAGAKLTLLDGDKYSFSADLKVYGDLLVKKSKETYPGTEFDISGENFDVTGNF---- 385

Query: 89  NFELINKNLDGFKQTINFSPAVFKNYYQVDIQLAHTRSDAV-------SKLILGSPEIIN 141
           N E   ++        +F+P+ F N   + + L+ ++   V       S     S  I+N
Sbjct: 386 NAE---ESAATSASIYSFTPSSFDNSGDISLSLSKSKKGEVTFSPYSNSGAFSFSNAILN 442

Query: 142 AGKLTVRPYSAVEQNDPSREGNILQISTPGGRLVNTGTIELSLGVKYYLYGDVSGTGNIN 201
            G +     S +++ D + EG+           VN G I L  G  Y +   VSG G +N
Sbjct: 443 GGSV-----SGLQRRDDT-EGS-----------VNNGEINLDNGSTYVIVEPVSGKGTVN 485

Query: 202 IARGILHME-TTSFVGNTINLGGISGISVKSTSSNI--IKVRGLISGNLISSIGDNGSFT 258
           I  G L++    +F G T+   G   ++V  T +N   I V G    N I+   D  + +
Sbjct: 486 IISGNLYLHYPDTFTGQTVVFKGEGVLAVDPTETNATPIPVVGYTGKNQIAITADITALS 545

Query: 259 YNNQTGIVTVNTDSGRYVYDIGCGY 283
           Y+  TG++T    + ++ + IG G+
Sbjct: 546 YDGTTGVLTATQGNRQFSFAIGTGF 570

>CAGL0C01133g 114805..117915 some similarities with tr|Q08294
            Saccharomyces cerevisiae YOL155c, hypothetical start
          Length = 1036

 Score = 54.3 bits (129), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 61/182 (33%), Positives = 79/182 (43%), Gaps = 62/182 (34%)

Query: 1254 PSGQDYTITTTGSDGKIETNVVSHITTT-VNGKPTT------------------------ 1288
            P+ QDYT T T SDG   T VVSHITTT  +GK  T                        
Sbjct: 519  PAEQDYTTTIT-SDGHTITEVVSHITTTDSDGKTVTITTTMASFAQVDEGVFTSPEPYSQ 577

Query: 1289 ---ITTTVPCD-------------------------------VSAEKDRTTTVTHSNGVI 1314
               +T+TV  D                               +  E D TTT+   NG  
Sbjct: 578  LPVVTSTVTDDDGSSKTVVISYFPSEGEDGVTRTGTTTVSTIIPEEPDYTTTIDKDNGDF 637

Query: 1315 ETNVVSHITTT-VNGKPTTIITTGSFD-VGAGKDRITTITHSNGVIETNVVSHITTVDTK 1372
            ET++VSHITT   NGKPTTI+TT        G+   T++  S+G   T +V+H+TT D+ 
Sbjct: 638  ETDLVSHITTKDSNGKPTTIVTTIPLKPSDGGEADYTSVFVSDGHTITKIVTHVTTTDSL 697

Query: 1373 GN 1374
            G+
Sbjct: 698  GH 699

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 69/132 (52%), Gaps = 17/132 (12%)

Query: 1258 DYTITTTGSDGKIETNVVSHITTT-VNGKPTTITTTV-------------PCDVSAEKDR 1303
            DYT T T SDG   T VVSHITTT  +GK  TITTT+             P   S     
Sbjct: 421  DYTTTYT-SDGHTITEVVSHITTTDSDGKTVTITTTMASFDQVDEGVFTSPEPYSQPPVV 479

Query: 1304 TTTVTHSNGVIETNVVSHITTT-VNGKPTTIITTGSFDVGAGKDRITTITHSNGVIETNV 1362
            T+TVT  +G  +T V+S+  +   +G   T  TT S    A +D  TTIT S+G   T V
Sbjct: 480  TSTVTEDDGSSKTVVISYFPSEGEDGVTRTGTTTISTITPAEQDYTTTIT-SDGHTITEV 538

Query: 1363 VSHITTVDTKGN 1374
            VSHITT D+ G 
Sbjct: 539  VSHITTTDSDGK 550

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 44/81 (54%), Gaps = 4/81 (4%)

Query: 1262 TTTGSDGKIETNVVSHITTTVNGKPTTITTTVPCDVSAEKDRTTTVTHSNGVIETNVVSH 1321
            TT   D  +E +++++   + +      T TV   V  E D TTT T S+G   T VVSH
Sbjct: 382  TTVSKDRLVEVDIITYYIASDDTGQHIATKTVTVKVE-EPDYTTTYT-SDGHTITEVVSH 439

Query: 1322 ITTT-VNGKPTTIITT-GSFD 1340
            ITTT  +GK  TI TT  SFD
Sbjct: 440  ITTTDSDGKTVTITTTMASFD 460

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 28/40 (70%), Gaps = 3/40 (7%)

Query: 1103 AAQDGTSKTITVDGEEIIEVV-HITTYTDSDGHTITSTYT 1141
            A QD T+ TIT DG  I EVV HITT TDSDG T+T T T
Sbjct: 520  AEQDYTT-TITSDGHTITEVVSHITT-TDSDGKTVTITTT 557

>YOL155C (YOL155C) [4670] chr15 complement(28702..31605) Protein
           with similarity to S. cerevisiae glucan
           1,4-alpha-glucosidase [2904 bp, 967 aa]
          Length = 967

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 72/269 (26%), Positives = 118/269 (43%), Gaps = 29/269 (10%)

Query: 34  ELVIQNGDTISYVDGSEYNFGGGIVSSQEGCTFRAVANDKSDFDFNVGKEFVNYCNFELI 93
           +L + +GD   YV  +++   GG+   +   T+     D S  +F+V   F    N E  
Sbjct: 363 KLTLLDGD--KYVFSADFIIHGGVFVEKSKPTYPGTEFDISGENFDVSGTF----NAE-- 414

Query: 94  NKNLDGFKQTINFSPAVFKNYYQVDIQLAHTRSDAVSKLILGSPEIINAGKLTVRPYSAV 153
            +         +F+P  F N   + + L+ +    V+     SP   N+G  +   +S  
Sbjct: 415 -EPAASSASAYSFTPGSFDNSGDISLSLSESTKGEVTF----SP-YSNSGAFS---FSNA 465

Query: 154 EQNDPSREGNILQISTPGGRLVNTGTIELSLGVKYYLYGDVSGTGNINIARGILHME-TT 212
             N  S  G  LQ     G  VN G I L  G  Y +   VSG+G INI  G L++    
Sbjct: 466 ILNGGSVSG--LQRRAESGS-VNNGEINLENGSTYVVVEPVSGSGTINIISGNLYLHYPD 522

Query: 213 SFVGNTINLGGISGISVKSTSSNI--IKVRGLISGNLISSIGDNGSFTYNNQTGIVTVNT 270
           +F G T+   G   ++V  T +N   I V G    N I+   D  + +Y++ TG++T   
Sbjct: 523 TFTGQTVVFKGEGVLAVDPTETNTTPIPVVGYTGENQIAITADVTALSYDSATGVLTATQ 582

Query: 271 DSGRYVYDIGCGYDETTLGSTTGYIVYHG 299
            + ++ + IG G+      S++G+ V  G
Sbjct: 583 GNSQFSFSIGTGF------SSSGFNVSEG 605

>Scas_678.26
          Length = 1377

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/114 (42%), Positives = 60/114 (52%), Gaps = 10/114 (8%)

Query: 1271 ETNVVSHITTT-VNGKPTTITTTVPCDVSAEKDRT----TTVTHSNGVIETNVVSHITTT 1325
            ET VVS  T+T  +GKPTT+ TT P   S+  D      TTV  S    ETN+VS  T+T
Sbjct: 1114 ETAVVSFYTSTDSSGKPTTVATTYPV-ASSSSDAVLPPYTTVLVSGTSSETNIVSFYTST 1172

Query: 1326 -VNGKPTTIITT---GSFDVGAGKDRITTITHSNGVIETNVVSHITTVDTKGNP 1375
              +GKPTT+ TT    S    A     TT+  S    ET VVS  T+ D+ G P
Sbjct: 1173 DSSGKPTTVATTYPVASSSSDAVLPPYTTVMVSGTSSETAVVSFYTSTDSSGKP 1226

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 43/72 (59%), Gaps = 7/72 (9%)

Query: 1271 ETNVVSHITTT-VNGKPTTITTTVPCDVSAEKDRT----TTVTHSNGVIETNVVSHITTT 1325
            ETN+VS  T+T  +GKPTT+ TT P   S+  D      TTV  S    ET VVS  T+T
Sbjct: 1162 ETNIVSFYTSTDSSGKPTTVATTYPV-ASSSSDAVLPPYTTVMVSGTSSETAVVSFYTST 1220

Query: 1326 -VNGKPTTIITT 1336
              +GKPTT+ TT
Sbjct: 1221 DSSGKPTTVATT 1232

 Score = 35.4 bits (80), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 39/75 (52%), Gaps = 4/75 (5%)

Query: 1305 TTVTHSNGVIETNVVSHITTT-VNGKPTTIITT---GSFDVGAGKDRITTITHSNGVIET 1360
            TTV  S    ET VVS  T+T  +GKPTT+ TT    S    A     TT+  S    ET
Sbjct: 1104 TTVMVSGTSSETAVVSFYTSTDSSGKPTTVATTYPVASSSSDAVLPPYTTVLVSGTSSET 1163

Query: 1361 NVVSHITTVDTKGNP 1375
            N+VS  T+ D+ G P
Sbjct: 1164 NIVSFYTSTDSSGKP 1178

>CAGL0E01661g 160466..164713 some similarities with sp|P08640
            Saccharomyces cerevisiae YIR019c STA1, hypothetical start
          Length = 1429

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 50/81 (61%), Gaps = 5/81 (6%)

Query: 1299 AEKDRTTTVTHSNGVIETNVVSHITTT-VNGKPTTIITTGSF---DVG-AGKDRITTITH 1353
            +E D TTT+   NG  ET++VSHITT   +GKPTTI TT      +VG AG+   TT   
Sbjct: 953  SEADYTTTIDKGNGEFETDLVSHITTKDSDGKPTTITTTIPLKPSEVGEAGEADYTTTII 1012

Query: 1354 SNGVIETNVVSHITTVDTKGN 1374
            S+G   T VVSH+TT D+ G 
Sbjct: 1013 SDGHTITEVVSHVTTTDSDGK 1033

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 61/94 (64%), Gaps = 9/94 (9%)

Query: 1255 SGQDYTITTTGSDGKIETNVVSHITTT-VNGKPTTITTTV---PCDV--SAEKDRTTTVT 1308
            S  DYT T    +G+ ET++VSHITT   +GKPTTITTT+   P +V  + E D TTT+ 
Sbjct: 953  SEADYTTTIDKGNGEFETDLVSHITTKDSDGKPTTITTTIPLKPSEVGEAGEADYTTTII 1012

Query: 1309 HSNGVIETNVVSHITTT-VNGKPTTIITT-GSFD 1340
             S+G   T VVSH+TTT  +GK  T ITT  S+D
Sbjct: 1013 -SDGHTITEVVSHVTTTDSDGKTITYITTMASYD 1045

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 61/131 (46%), Gaps = 15/131 (11%)

Query: 1258 DYTITTTGSDGKIETNVVSHITTT-VNGKPTTITTTVP-------------CDVSAEKDR 1303
            DYT TT  SDG   T VVSH+TTT  +GK  T  TT+                 S     
Sbjct: 1006 DYT-TTIISDGHTITEVVSHVTTTDSDGKTITYITTMASYDQVDEGVFTSAAPYSQPPVV 1064

Query: 1304 TTTVTHSNGVIETNVVSHITTTVNGKPTTIITTGSFDVGAGKDRITTITHSNGVIETNVV 1363
            T+T+T  +G  +T V+S+  +      T   TT    +  G+   TT   S+G   T VV
Sbjct: 1065 TSTITEDDGSSKTVVISYFPSEGEDGVTRTGTTTVSTITPGEADYTTTIISDGHTITEVV 1124

Query: 1364 SHITTVDTKGN 1374
            SH+TT D+ G 
Sbjct: 1125 SHVTTTDSDGK 1135

>CAGL0L13332g 1432034..1435141 some similarities with sp|P39712
            Saccharomyces cerevisiae YAL063c FLO9, hypothetical start
          Length = 1035

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 45/130 (34%), Positives = 65/130 (50%), Gaps = 15/130 (11%)

Query: 1258 DYTITTTGSDGKIETNVVSHITTTVNGKPTTITTTVPCDVSAEKDRTTTVTHSNGVIETN 1317
            DY  T    +G+ ET+++SHIT   +    T T T    ++   D T TVT S+G   T 
Sbjct: 321  DYITTIDKGNGEFETDLISHITQKDSNGTPTNTITTTIHLTPTYDYTKTVT-SDGHTITE 379

Query: 1318 VVSHITTT-VNGKPTTIITTGSFDVGAGKDRIT-------------TITHSNGVIETNVV 1363
            VVSHITTT  +G+     TT  F   AG+   T             T++ S+GV++T V+
Sbjct: 380  VVSHITTTDSDGEGVVYATTRMFYAEAGEAVHTSAWPYSQPSVVTRTVSESDGVVDTVVI 439

Query: 1364 SHITTVDTKG 1373
            S+  +V   G
Sbjct: 440  SYFPSVGEDG 449

 Score = 38.1 bits (87), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 62/131 (47%), Gaps = 18/131 (13%)

Query: 1258 DYTITTTGSDGKIETNVVSHITTT-VNGKPTTITT-------------TVPCDVSAEKDR 1303
            DYT T T SDG   T VVSHITTT  +G+     T             T     S     
Sbjct: 464  DYTTTVT-SDGHTITEVVSHITTTDSDGEGVVYATTRMFYAEAGEAVHTSAWPYSQPSVV 522

Query: 1304 TTTVTHSNGVIETNVVSHITTTVNGKPTTIITTGSFDVGAGKDRITTITHSNGVIETNVV 1363
            T TV+ S+GV++T V+S+  +   G+     T  S       D  TT+T S+G   T VV
Sbjct: 523  TRTVSESDGVVDTVVISYFPSV--GEDGVTRTVTSTVRTITADYTTTVT-SDGHTITEVV 579

Query: 1364 SHITTVDTKGN 1374
            SHITT D+ G 
Sbjct: 580  SHITTTDSDGE 590

 Score = 38.1 bits (87), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 62/131 (47%), Gaps = 18/131 (13%)

Query: 1258 DYTITTTGSDGKIETNVVSHITTT-VNGKPTTITT-------------TVPCDVSAEKDR 1303
            DYT T T SDG   T VVSHITTT  +G+     T             T     S     
Sbjct: 662  DYTTTVT-SDGHTITEVVSHITTTDSDGEGVVYATTRMFYAEAGEAVHTSAWPYSQPSVV 720

Query: 1304 TTTVTHSNGVIETNVVSHITTTVNGKPTTIITTGSFDVGAGKDRITTITHSNGVIETNVV 1363
            T TV+ S+GV++T V+S+  +   G+     T  S       D  TT+T S+G   T VV
Sbjct: 721  TRTVSESDGVVDTVVISYFPSV--GEDGVTRTVTSTVRTITADYTTTVT-SDGHTITEVV 777

Query: 1364 SHITTVDTKGN 1374
            SHITT D+ G 
Sbjct: 778  SHITTTDSDGQ 788

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 1300 EKDRTTTVTHSNGVIETNVVSHITTTVNGKPTTIITTGSFDVGAGKDRITTITHSNGVIE 1359
            E D  TT+   NG  ET+++SHIT   +    T   T +  +    D   T+T S+G   
Sbjct: 319  EPDYITTIDKGNGEFETDLISHITQKDSNGTPTNTITTTIHLTPTYDYTKTVT-SDGHTI 377

Query: 1360 TNVVSHITTVDTKGN 1374
            T VVSHITT D+ G 
Sbjct: 378  TEVVSHITTTDSDGE 392

 Score = 35.4 bits (80), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 65/128 (50%), Gaps = 17/128 (13%)

Query: 1260 TITTTGSDGKIETNVVSHITTTVNGKPTTITTTVPCDVSAEKDRTTTVTHSNGVIETNVV 1319
            T T + SDG ++T V+S+  +      T   T+    ++A  D TTTVT S+G   T VV
Sbjct: 424  TRTVSESDGVVDTVVISYFPSVGEDGVTRTVTSTVRTITA--DYTTTVT-SDGHTITEVV 480

Query: 1320 SHITTT-VNGKPTTIITTGSFDVGAGKDRIT-------------TITHSNGVIETNVVSH 1365
            SHITTT  +G+     TT  F   AG+   T             T++ S+GV++T V+S+
Sbjct: 481  SHITTTDSDGEGVVYATTRMFYAEAGEAVHTSAWPYSQPSVVTRTVSESDGVVDTVVISY 540

Query: 1366 ITTVDTKG 1373
              +V   G
Sbjct: 541  FPSVGEDG 548

 Score = 35.4 bits (80), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 65/128 (50%), Gaps = 17/128 (13%)

Query: 1260 TITTTGSDGKIETNVVSHITTTVNGKPTTITTTVPCDVSAEKDRTTTVTHSNGVIETNVV 1319
            T T + SDG ++T V+S+  +      T   T+    ++A  D TTTVT S+G   T VV
Sbjct: 523  TRTVSESDGVVDTVVISYFPSVGEDGVTRTVTSTVRTITA--DYTTTVT-SDGHTITEVV 579

Query: 1320 SHITTT-VNGKPTTIITTGSFDVGAGKDRIT-------------TITHSNGVIETNVVSH 1365
            SHITTT  +G+     TT  F   AG+   T             T++ S+GV++T V+S+
Sbjct: 580  SHITTTDSDGEGVVYATTRMFYAEAGEAVHTSAWPYSQPSVVTRTVSESDGVVDTVVISY 639

Query: 1366 ITTVDTKG 1373
              +V   G
Sbjct: 640  FPSVGEDG 647

 Score = 35.4 bits (80), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 65/128 (50%), Gaps = 17/128 (13%)

Query: 1260 TITTTGSDGKIETNVVSHITTTVNGKPTTITTTVPCDVSAEKDRTTTVTHSNGVIETNVV 1319
            T T + SDG ++T V+S+  +      T   T+    ++A  D TTTVT S+G   T VV
Sbjct: 622  TRTVSESDGVVDTVVISYFPSVGEDGVTRTVTSTVRTITA--DYTTTVT-SDGHTITEVV 678

Query: 1320 SHITTT-VNGKPTTIITTGSFDVGAGKDRIT-------------TITHSNGVIETNVVSH 1365
            SHITTT  +G+     TT  F   AG+   T             T++ S+GV++T V+S+
Sbjct: 679  SHITTTDSDGEGVVYATTRMFYAEAGEAVHTSAWPYSQPSVVTRTVSESDGVVDTVVISY 738

Query: 1366 ITTVDTKG 1373
              +V   G
Sbjct: 739  FPSVGEDG 746

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/37 (56%), Positives = 24/37 (64%), Gaps = 2/37 (5%)

Query: 1109 SKTITVDGEEIIEVV-HITTYTDSDGHTITSTYTEMF 1144
            +KT+T DG  I EVV HITT TDSDG  +    T MF
Sbjct: 367  TKTVTSDGHTITEVVSHITT-TDSDGEGVVYATTRMF 402

>CAGL0H00110g complement(2611..3711) some similarities with sp|P08640
            Saccharomyces cerevisiae YIR019c STA1, hypothetical start
          Length = 366

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 62/125 (49%), Gaps = 11/125 (8%)

Query: 1260 TITTTGSDGKIETNVVSHITTT-VNG-KPTTITTTVPCDVSAEKDRTTTVTHSNGVIETN 1317
            T TT  +D    T V+SH  +  V+G   T  TT     V  E   TT+V   NG IET+
Sbjct: 51   TTTTVSADTATATVVISHFPSIGVDGVTRTGTTTLSTVSVGGETGYTTSVDRGNGSIETD 110

Query: 1318 VVSHITTT-VNGKPTTII-------TTGSFDVGAGKDRITTITHSNGVIETNVVSHITTV 1369
            V+SHITTT  NG PTTI        +  +     G D  TT+  S+G   T +VSH T  
Sbjct: 111  VISHITTTDSNGNPTTITTTITNAQSASNSKANVGSDYTTTVV-SDGHTLTEIVSHSTGT 169

Query: 1370 DTKGN 1374
            D  G+
Sbjct: 170  DEHGH 174

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 23/35 (65%)

Query: 1341 VGAGKDRITTITHSNGVIETNVVSHITTVDTKGNP 1375
            VG      T++   NG IET+V+SHITT D+ GNP
Sbjct: 90   VGGETGYTTSVDRGNGSIETDVISHITTTDSNGNP 124

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 44/75 (58%), Gaps = 9/75 (12%)

Query: 1259 YTITTTGSDGKIETNVVSHITTT-VNGKPTTITTTVPCDVSAE-------KDRTTTVTHS 1310
            YT +    +G IET+V+SHITTT  NG PTTITTT+    SA         D TTTV  S
Sbjct: 96   YTTSVDRGNGSIETDVISHITTTDSNGNPTTITTTITNAQSASNSKANVGSDYTTTVV-S 154

Query: 1311 NGVIETNVVSHITTT 1325
            +G   T +VSH T T
Sbjct: 155  DGHTLTEIVSHSTGT 169

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 20/34 (58%)

Query: 1111 TITVDGEEIIEVVHITTYTDSDGHTITSTYTEMF 1144
            T+  DG  + E+V  +T TD  GHTI ST TE  
Sbjct: 151  TVVSDGHTLTEIVSHSTGTDEHGHTIVSTVTETL 184

>KLLA0B14498g 1275022..1277322 some similarities with
           ca|CA2713|CaIFF8 Candida albicans unknown function,
           hypothetical start
          Length = 766

 Score = 38.1 bits (87), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 83/207 (40%), Gaps = 42/207 (20%)

Query: 147 VRPYSAVEQN-------DPSREGNILQISTPGGRLVNTGTIELSLGVKYYLYGDVSG-TG 198
           + P S+ E N       +  R+G  L +   G  + N+GTI L  GV Y   G VSG +G
Sbjct: 145 IIPSSSFENNGLLSFTHENGRKGGTLTLGNLGSAITNSGTICLK-GVVYKQSGMVSGESG 203

Query: 199 NINIARGILHMETTSF--VGNTINLGGISGISVKSTSSNIIKVRGLISGNLISSIGDNG- 255
            I+I    L      +     TI L         S+ S  +++  L S   +  +   G 
Sbjct: 204 CISIGDEGLFWAYNGYQLTDQTIYL---------SSDSAALRLEALGSPTFVYKVVGFGK 254

Query: 256 ----------SFTYNNQTGIVTVNTDSGRYVYDIGCGYDETT-----LGSTTGYI----- 295
                      F Y+  TGI+TV++    Y  DIG GYD T      +    GYI     
Sbjct: 255 QKVGLAVAIREFQYDEDTGILTVSSLLITYKLDIGKGYDRTKFYVDDIDFGAGYITVLNG 314

Query: 296 -VYHGESLKTFVIATSLETAPDYQKCY 321
            +Y+   + TF I  + +  P+    Y
Sbjct: 315 GIYYSGDVPTFEIPEACQPCPETAPWY 341

>Scas_545.1*
          Length = 666

 Score = 37.4 bits (85), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 63/130 (48%), Gaps = 19/130 (14%)

Query: 162 GNILQISTPGGRLVNTGTIELSLGVKYYLYGDVSGTGNINIARGILHMETTSFVGNTINL 221
            N +  STP   + N+GTIEL   V   +   +SG+G + ++ G L ++ ++ +  TI +
Sbjct: 157 ANQIGFSTPKSGITNSGTIELEGTVSITV--PMSGSGCV-VSSGALSLDYSNNIDQTIVV 213

Query: 222 GG-----ISGISVKSTSSNIIKVR---GLISGNLISSIGDNGSFTYNNQTGIVTVNTDSG 273
            G     +SG+     S NI KVR      S  ++      G+ TYN  TGI+T      
Sbjct: 214 NGGQFVILSGLE----SGNIPKVRVPGDASSPYILMKNSPTGAITYNATTGILTY----P 265

Query: 274 RYVYDIGCGY 283
            Y  DIG GY
Sbjct: 266 PYQIDIGLGY 275

>Scas_561.3
          Length = 953

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 55/115 (47%), Gaps = 2/115 (1%)

Query: 1262 TTTGSDGKIETNVVSHITTT-VNGKPTTITTTVPCDVSAEKDRTTTVTHSNGVIETNVVS 1320
            TT  S    ET++VS  TTT  +G     TTT P  V++     TT   S    ET++VS
Sbjct: 579  TTVVSGSHTETDIVSFYTTTDSSGHAAIGTTTYPVPVTSVPAPYTTTVVSGSHTETDIVS 638

Query: 1321 HITTT-VNGKPTTIITTGSFDVGAGKDRITTITHSNGVIETNVVSHITTVDTKGN 1374
              TTT  NG      TT  F V +     TT   S    ET++VS  TT D+ G+
Sbjct: 639  FYTTTDANGAAAIGTTTYPFPVTSVPAPYTTTVVSGSHTETDIVSFYTTTDSSGH 693

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 52/106 (49%), Gaps = 2/106 (1%)

Query: 1271 ETNVVSHITTT-VNGKPTTITTTVPCDVSAEKDRTTTVTHSNGVIETNVVSHITTT-VNG 1328
            ET++VS  TTT  +GK    TTT P  V++     TT   S    ET++VS  TTT  NG
Sbjct: 498  ETDIVSFYTTTDSSGKAAIGTTTYPVPVTSVPAPYTTTVVSGSHTETDIVSFYTTTDANG 557

Query: 1329 KPTTIITTGSFDVGAGKDRITTITHSNGVIETNVVSHITTVDTKGN 1374
                  TT    V +     TT   S    ET++VS  TT D+ G+
Sbjct: 558  AAVVATTTYPVPVTSVPAPYTTTVVSGSHTETDIVSFYTTTDSSGH 603

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 42/114 (36%), Positives = 52/114 (45%), Gaps = 2/114 (1%)

Query: 1262 TTTGSDGKIETNVVSHITTT-VNGKPTTITTTVPCDVSAEKDRTTTVTHSNGVIETNVVS 1320
            TT  S    ET++VS  TTT  NG     TTT P  V++     TT   S    ET++VS
Sbjct: 534  TTVVSGSHTETDIVSFYTTTDANGAAVVATTTYPVPVTSVPAPYTTTVVSGSHTETDIVS 593

Query: 1321 HITTT-VNGKPTTIITTGSFDVGAGKDRITTITHSNGVIETNVVSHITTVDTKG 1373
              TTT  +G      TT    V +     TT   S    ET++VS  TT D  G
Sbjct: 594  FYTTTDSSGHAAIGTTTYPVPVTSVPAPYTTTVVSGSHTETDIVSFYTTTDANG 647

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 54/115 (46%), Gaps = 2/115 (1%)

Query: 1262 TTTGSDGKIETNVVSHITTT-VNGKPTTITTTVPCDVSAEKDRTTTVTHSNGVIETNVVS 1320
            TT  S    ET++VS  TTT  NG     TTT P  V++     TT   S    ET++VS
Sbjct: 624  TTVVSGSHTETDIVSFYTTTDANGAAAIGTTTYPFPVTSVPAPYTTTVVSGSHTETDIVS 683

Query: 1321 HITTT-VNGKPTTIITTGSFDVGAGKDRITTITHSNGVIETNVVSHITTVDTKGN 1374
              TTT  +G      TT    V +     TT   S    ET++VS  TT D+ G+
Sbjct: 684  FYTTTDSSGHAAIGTTTYPAPVTSVPAPYTTTVVSGSHTETDIVSFYTTTDSSGH 738

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 54/116 (46%), Gaps = 4/116 (3%)

Query: 1260 TITTTGSDGKIETNVVSHITTT-VNGKPTTITTTVPCDVSAEKDRTTTVTHSNGVIETNV 1318
            TI  TGS    ET ++S+ TTT   G P+   T  P  VS+     TT   S    ET++
Sbjct: 444  TILITGS--TTETVIISYFTTTDSQGDPSAGFTRYPVPVSSLPSPYTTTLISGSSSETDI 501

Query: 1319 VSHITTT-VNGKPTTIITTGSFDVGAGKDRITTITHSNGVIETNVVSHITTVDTKG 1373
            VS  TTT  +GK     TT    V +     TT   S    ET++VS  TT D  G
Sbjct: 502  VSFYTTTDSSGKAAIGTTTYPVPVTSVPAPYTTTVVSGSHTETDIVSFYTTTDANG 557

>Scas_698.41d
          Length = 302

 Score = 34.7 bits (78), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 36/66 (54%), Gaps = 3/66 (4%)

Query: 1274 VVSHITTTVNGKPTTITT--TVPCDVSAEKDRTTTVTHSNGVIETNVVSHITTTVNGKPT 1331
            V+S I+T VNG P T TT  T+P   S     TTT+      + + V+S I+T +NG P 
Sbjct: 139  VISFISTNVNGLPATQTTTSTIPPPFSLPSAYTTTIADGASTV-SEVISFISTNMNGLPA 197

Query: 1332 TIITTG 1337
            T  TT 
Sbjct: 198  TQTTTS 203

>Scas_714.21*
          Length = 673

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 69/142 (48%), Gaps = 26/142 (18%)

Query: 161 EGNILQIST-------PGGRLVNTGTIELSLGVKYYLYGDVSGTGNINIARGILHMETTS 213
           EGN+  ++T       P   + N GTIEL  G    +   ++G G + ++   L ++ ++
Sbjct: 147 EGNMFIVTTTEITVDSPTSGIYNDGTIELEAG-TVTISVPMTGGGCL-VSSSYLVLDLSN 204

Query: 214 FVGNTINLGG------ISGISVKSTSSNIIKVR--GLIS-GNLISSIGDNGSFTYNNQTG 264
            +  TI L G      ++G+S    S NI K+R  G +S  +++      G+ +YN+ TG
Sbjct: 205 KIDQTIVLNGNNQFVTLTGLS----SGNIPKIRVPGTVSPPSILLQTTPTGALSYNSVTG 260

Query: 265 IVTVNTDSGRYVYDIGCGYDET 286
           I+T       Y  DIG GY  T
Sbjct: 261 ILTF----PPYKMDIGLGYPTT 278

>Scas_674.20d
          Length = 537

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 87/185 (47%), Gaps = 25/185 (13%)

Query: 126 SDAVSK-LILGSPEIINAGKLT--VRPYSAVEQNDPSREGNILQISTP-----GGRLVNT 177
           +DAV + L+L   ++IN+  ++  +   S++  N PS+ G +++I            VN 
Sbjct: 100 TDAVPRDLVL--EKLINSDYMSFALSANSSLAVNGPSQNGGLVEIDASRLTLTASNFVNG 157

Query: 178 GTIELSLGVKYYLYGDVSGTGNI--NIARGILHMETTSFVGNTINLGGISGISV---KST 232
           G I L   +   +  +++G G I  N ++  + ++ +     T+     S + +      
Sbjct: 158 GVITLD-PITVDISMNITGKGCIYVNASKPSVSVDLSKGFDQTLYFANASPLMLFYGSQA 216

Query: 233 SSNIIKVRGLISGNL----ISSIGDNGSFT-----YNNQTGIVTVNTDSGRYVYDIGCGY 283
           S+NI  +RGL S       +  I D+ + +     Y++  GI+ +   +G Y+ DIG GY
Sbjct: 217 STNIPIIRGLSSSAPTVVNVGPITDDSALSSTDVEYDSTGGILNITNTAGTYLLDIGTGY 276

Query: 284 DETTL 288
           D + +
Sbjct: 277 DASLM 281

>Scas_538.4d
          Length = 531

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 19/29 (65%)

Query: 252 GDNGSFTYNNQTGIVTVNTDSGRYVYDIG 280
           G+  +F YNN TGIV +   SG Y+ DIG
Sbjct: 247 GEAPAFDYNNITGIVNMTVSSGSYLVDIG 275

>Sklu_2155.3 , Contig c2155 4020-7043 reverse complement
          Length = 1007

 Score = 32.0 bits (71), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 60/138 (43%), Gaps = 15/138 (10%)

Query: 159 SREGNILQISTPGGRLVNTGTIELSLGVKYYLYGDVSGTGNINIARGILHMETTSFVGNT 218
           SR G  + +      + N GT  L  G+ Y+    V+G G I++        T +   NT
Sbjct: 163 SRSGGSMHLGQDDKTITNDGTFCLINGL-YFQGSTVTGNGCIDVGANSTMWVTNA---NT 218

Query: 219 INLGGISGISVKSTSSNI----------IKVRGLISGNLISSIGDNGSFTYNNQTGIVTV 268
             L G + I + S SSN+            V GL  GN +       S+TY++  G++++
Sbjct: 219 RKLQGQT-IYLSSRSSNLRIDAYSPTFSFTVAGLGGGNFVGLNVPISSYTYDSTAGLLSI 277

Query: 269 NTDSGRYVYDIGCGYDET 286
              +  Y   IG GYD T
Sbjct: 278 KYGTYTYQVYIGTGYDST 295

>Kwal_55.22201
          Length = 1524

 Score = 31.6 bits (70), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 56/121 (46%), Gaps = 30/121 (24%)

Query: 1264 TGSDG--------KIETNVVSHITTTVNGKPTTITTTVPCDVSAEKDRTTTVTHSNGV-- 1313
            TGSDG         +ET VV  ++TT+ G   + T+T    VS       T T S+G+  
Sbjct: 1406 TGSDGIPTTETIYYVETPVVESLSTTITGWTGSFTSTYSTAVS-------TFTGSDGIPT 1458

Query: 1314 ------IETNVVSHITTTVNGKPTTIITTGSFDVGAGKDRITTITHSNGVIETNVVSHIT 1367
                  +ET VV  ++TT+ G       TGSF        I+T T S+G+  T  + ++ 
Sbjct: 1459 TETIYYVETPVVESLSTTITGW------TGSF-TSTYSTAISTFTGSDGIPTTETIYYVE 1511

Query: 1368 T 1368
            T
Sbjct: 1512 T 1512

>Kwal_47.16796
          Length = 209

 Score = 30.4 bits (67), Expect = 9.5,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 36/86 (41%), Gaps = 1/86 (1%)

Query: 1264 TGSDGKIETNVVSHITTTVNGKPTTITTTVPCDVSAEKDRTTTVTHSNGVIETNVVSHIT 1323
            TG DGK  T  + H+ T +    TT +     + +      TT T  +G   T  + H+ 
Sbjct: 84   TGEDGKATTETIYHVETPIVAS-TTYSGWTGSETTTVSTELTTFTGEDGKTTTETIYHVE 142

Query: 1324 TTVNGKPTTIITTGSFDVGAGKDRIT 1349
            T V+   +    TGSF      + IT
Sbjct: 143  TPVSVSTSYTAWTGSFTSTYSTEFIT 168

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.130    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 22,867,329
Number of extensions: 912773
Number of successful extensions: 4770
Number of sequences better than 10.0: 151
Number of HSP's gapped: 4076
Number of HSP's successfully gapped: 611
Length of query: 1558
Length of database: 16,596,109
Length adjustment: 115
Effective length of query: 1443
Effective length of database: 12,615,039
Effective search space: 18203501277
Effective search space used: 18203501277
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 68 (30.8 bits)