Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0J01727g97933617430.0
CAGL0J02508g8703075742e-61
CAGL0J02530g7543255321e-56
CAGL0J02552g8953314864e-50
CAGL0J01771g15673244897e-50
Scas_561.39533441242e-06
KLLA0B14498g7661851161e-05
YOL155C967271980.002
CAGL0E06600g965183890.023
YIL169C995288870.041
Scas_674.20d53751780.42
Sklu_2155.31007131703.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J01727g
         (964 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J01727g complement(157842..160781) some similarities with s...   676   0.0  
CAGL0J02508g complement(243607..246219) some similarities with t...   225   2e-61
CAGL0J02530g complement(248026..250290) some similarities with t...   209   1e-56
CAGL0J02552g complement(252259..254946) some similarities with t...   191   4e-50
CAGL0J01771g complement(164808..169469) some similarities with t...   192   7e-50
Scas_561.3                                                             52   2e-06
KLLA0B14498g 1275022..1277322 some similarities with ca|CA2713|C...    49   1e-05
YOL155C (YOL155C) [4670] chr15 complement(28702..31605) Protein ...    42   0.002
CAGL0E06600g 658198..661095 some similarities with sp|P38894 Sac...    39   0.023
YIL169C (YIL169C) [2509] chr9 complement(23119..26106) Protein o...    38   0.041
Scas_674.20d                                                           35   0.42 
Sklu_2155.3 , Contig c2155 4020-7043 reverse complement                32   3.8  

>CAGL0J01727g complement(157842..160781) some similarities with
           sp|P08640 Saccharomyces cerevisiae YIR019c STA1,
           hypothetical start
          Length = 979

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/336 (100%), Positives = 336/336 (100%)

Query: 1   MKALILAQLLALSFANAQNVYNTPTVLTGNQKFSDEVVINDGSALTLNDGSEYIFDGGFR 60
           MKALILAQLLALSFANAQNVYNTPTVLTGNQKFSDEVVINDGSALTLNDGSEYIFDGGFR
Sbjct: 1   MKALILAQLLALSFANAQNVYNTPTVLTGNQKFSDEVVINDGSALTLNDGSEYIFDGGFR 60

Query: 61  GAQQCFMDINADKDSPFTLTFGSNAKEFDSSCAVTINNPNTGPDTVQTINISPPVFKNSN 120
           GAQQCFMDINADKDSPFTLTFGSNAKEFDSSCAVTINNPNTGPDTVQTINISPPVFKNSN
Sbjct: 61  GAQQCFMDINADKDSPFTLTFGSNAKEFDSSCAVTINNPNTGPDTVQTINISPPVFKNSN 120

Query: 121 KFILNLAHTSSDANSKIIIGSPDITNTGEINYISTGGEIHDPNELGNVLQIGTPSGSIQN 180
           KFILNLAHTSSDANSKIIIGSPDITNTGEINYISTGGEIHDPNELGNVLQIGTPSGSIQN
Sbjct: 121 KFILNLAHTSSDANSKIIIGSPDITNTGEINYISTGGEIHDPNELGNVLQIGTPSGSIQN 180

Query: 181 VGTISLNAANSYYLFGKVSGKGGKINVEKGVLQIDSASFTDNVIHLSPGGAISLRRPPAE 240
           VGTISLNAANSYYLFGKVSGKGGKINVEKGVLQIDSASFTDNVIHLSPGGAISLRRPPAE
Sbjct: 181 VGTISLNAANSYYLFGKVSGKGGKINVEKGVLQIDSASFTDNVIHLSPGGAISLRRPPAE 240

Query: 241 EVNVSGLGTATAISSIGKDGKFEYDSKTGLLSITTSEGVYKYNIGCGYNPELASAQEIKI 300
           EVNVSGLGTATAISSIGKDGKFEYDSKTGLLSITTSEGVYKYNIGCGYNPELASAQEIKI
Sbjct: 241 EVNVSGLGTATAISSIGKDGKFEYDSKTGLLSITTSEGVYKYNIGCGYNPELASAQEIKI 300

Query: 301 YFQDTLYDTFSFEIQQAPPTDSKCEDIPPIEPSSVK 336
           YFQDTLYDTFSFEIQQAPPTDSKCEDIPPIEPSSVK
Sbjct: 301 YFQDTLYDTFSFEIQQAPPTDSKCEDIPPIEPSSVK 336

 Score = 90.9 bits (224), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 50/86 (58%)

Query: 879 QRPGSVQNXXXXXXXXXXXXQGSAQPAANASTKTVSGTQASRAPXXXXXXXXXXXXXXXX 938
           QRPGSVQN            QGSAQPAANASTKTVSGTQASRAP                
Sbjct: 879 QRPGSVQNSVRPSASPSSVRQGSAQPAANASTKTVSGTQASRAPSGVNSVSQVRVSSNSA 938

Query: 939 XXXXXXXXPTVVSSTFRGSAVMLHVY 964
                   PTVVSSTFRGSAVMLHVY
Sbjct: 939 SGVVNSRAPTVVSSTFRGSAVMLHVY 964

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/21 (100%), Positives = 21/21 (100%)

Query: 735 ANPSSVKPSSINPSVEPSILK 755
           ANPSSVKPSSINPSVEPSILK
Sbjct: 735 ANPSSVKPSSINPSVEPSILK 755

 Score = 37.4 bits (85), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 18/20 (90%), Positives = 19/20 (95%)

Query: 736 NPSSVKPSSINPSVEPSILK 755
           NPSSV PSS+NPSVEPSILK
Sbjct: 662 NPSSVNPSSVNPSVEPSILK 681

>CAGL0J02508g complement(243607..246219) some similarities with
           tr|Q12218 Saccharomyces cerevisiae YOR009w, hypothetical
           start
          Length = 870

 Score =  225 bits (574), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 132/307 (42%), Positives = 191/307 (62%), Gaps = 6/307 (1%)

Query: 23  TPTVLTGNQKFSDEVVINDGSALTLNDGSEYIFDGGFRGA-QQCFMDINA-DKDSPFTLT 80
           TPT LTG+Q F+++V +   S+LTLNDGS+Y+F+   + A     +  NA    S FT +
Sbjct: 23  TPTTLTGDQTFNEDVSVV--SSLTLNDGSQYLFNNLLQIAPSSASVTANALAAVSVFTFS 80

Query: 81  FGSNAKEFDSSCAVTINNPNTGPDTVQTINISPPVFKNSNKFILNLAHTSSDANSKIIIG 140
              ++   +S   + I+N NTGP T Q I I+P V  N+    L+LAHT++D++S +II 
Sbjct: 81  LPPSSSLSNSGTLI-ISNSNTGPSTEQHIVITPNVMANTGTITLSLAHTNTDSSSTLIID 139

Query: 141 SPDITNTGEINYISTGGEIHDPNELGNVLQIGTPSGSIQNVGTISLNAANSYYLFGKVSG 200
                NTG INY S G E +DP+  GN+L IG+   ++QN+GTI+LNAANSYYL G ++ 
Sbjct: 140 PVTFYNTGTINYESIGSETNDPSLTGNILSIGSSGRTLQNLGTINLNAANSYYLLGTITE 199

Query: 201 KGGKINVEKGVLQIDSASFTDNVIHLSPGGAISLRRPPAEEVNVSGLGTATAISSIGKDG 260
             G INV+KG L +++  F  N I+LS   A++   P ++ V V G+     I+S+G  G
Sbjct: 200 NSGSINVQKGFLYVNALDFIGNTINLSTTTALAFISPVSQVVRVRGVFFGNIIASVGSSG 259

Query: 261 KFEYDSKTGLLSITTSEGVYKYNIGCGYNPELASAQEIKIYFQDTLYDTFSFEIQQAPPT 320
            F Y+++TG+L++TT  GVY Y+IGCGYNP L S Q+  + FQ  LYDTF   + Q  P+
Sbjct: 260 TFSYNTQTGILTVTT-NGVYSYDIGCGYNPALMSGQQETLSFQGNLYDTFLVLVNQPIPS 318

Query: 321 DSKCEDI 327
           D  C  +
Sbjct: 319 DLTCAAV 325

>CAGL0J02530g complement(248026..250290) some similarities with
           tr|Q12218 Saccharomyces cerevisiae YOR009w, hypothetical
           start
          Length = 754

 Score =  209 bits (532), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 130/325 (40%), Positives = 182/325 (56%), Gaps = 5/325 (1%)

Query: 1   MKALILAQLLALSFANAQNVYNTPTVLTGNQKFSDEVVINDGSALTLNDGSEYIFDGGFR 60
           M + IL    +     AQ    TPT LTGNQ F++++ +   S+LTLNDGSEYIF+    
Sbjct: 3   MFSRILLFFASYVLVKAQQTITTPTTLTGNQNFNEDIDVQ--SSLTLNDGSEYIFNNLLD 60

Query: 61  -GAQQCFMDINADKDSPFTLTFGSNAKEFDSSCAVTINNPNTGPDTVQTINISPPVFKNS 119
                  ++ NA   S FT +   ++   +    +TINN N G  + Q INI+P  F NS
Sbjct: 61  ISLDTASVEANAQSGSVFTFSMPPSSSFSNLGT-LTINN-NAGVVSEQHININPSTFSNS 118

Query: 120 NKFILNLAHTSSDANSKIIIGSPDITNTGEINYISTGGEIHDPNELGNVLQIGTPSGSIQ 179
               + + H  SD++S ++I SP   N+G INY  TG EI+DP   GN+L IG+   ++ 
Sbjct: 119 GTLTIRVVHYQSDSSSTMLIDSPSFANSGTINYERTGTEINDPGLEGNILHIGSAGHALD 178

Query: 180 NVGTISLNAANSYYLFGKVSGKGGKINVEKGVLQIDSASFTDNVIHLSPGGAISLRRPPA 239
           N G I+L A N+YYL G + G+GG INV  G+L IDS SF  N I+L P GA+++ RP  
Sbjct: 179 NTGIINLAAGNNYYLQGNIQGEGGSINVNYGLLHIDSTSFAGNTINLGPEGALAMIRPVP 238

Query: 240 EEVNVSGLGTATAISSIGKDGKFEYDSKTGLLSITTSEGVYKYNIGCGYNPELASAQEIK 299
           E V V G      I+S G +G F Y+ +TG+L++TT    Y Y+IGCGY+P L    +  
Sbjct: 239 ETVVVRGFAAPNFIASAGTNGAFAYNEQTGILTVTTDGNTYTYDIGCGYDPALLIGTQSS 298

Query: 300 IYFQDTLYDTFSFEIQQAPPTDSKC 324
           I ++  L D +      A P D  C
Sbjct: 299 IGYEGNLVDGYGVAYTGAAPADVTC 323

>CAGL0J02552g complement(252259..254946) some similarities with
           tr|Q12218 Saccharomyces cerevisiae YOR009w, hypothetical
           start
          Length = 895

 Score =  191 bits (486), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 129/331 (38%), Positives = 178/331 (53%), Gaps = 14/331 (4%)

Query: 1   MKALILAQLLALSFANAQNVYNTPTVLTGNQKFSDEVVINDGSALTLNDGSEYIF----- 55
           MK  I+  +L     +A +V N+   LTG Q F++ V I    AL+L  G+ Y F     
Sbjct: 4   MKVFIV-LMLGFCLVSALDV-NSILSLTGIQLFTEPVHIFSTGALSLTLGNSYAFNDLLT 61

Query: 56  -DGGFRGAQQCFMDINADKDSPFTLTFGSNAKEFDSSCAVTINNPNT-GPDTVQTINISP 113
            DGG   +    +DI      PF+ +  S +   +S  ++TI+N N  G    Q+INI P
Sbjct: 62  IDGGGSLSATALLDILL----PFSFSIPSTSSVTNSG-SMTISNGNLLGLGGSQSINIIP 116

Query: 114 PVFKNSNKFILNLAHTSSDANSKIIIGSPDITNTGEINYISTGGEIHDPNELGNVLQIGT 173
               N+    L+LA T SDA S ++I +    N+G I+YI  G    DPN LGN+LQIG+
Sbjct: 117 SSLTNTGTITLDLARTVSDATSLLVIDAGVFVNSGTISYIGGGAGGTDPNLLGNILQIGS 176

Query: 174 PSGSIQNVGTISLNAANSYYLFGKVSGKGGKINVEKGVLQIDSASFTDNVIHLSPGGAIS 233
              +I N GTI LNAA  Y L G + G GG I++E+G L I S +FT N I L P  A +
Sbjct: 177 VGNTIDNTGTIHLNAAPRYNLLGNIIGDGGVIDIEQGTLVISSQTFTGNSIALHPNTAAA 236

Query: 234 LRRPPAEEVNVSGLGTATAISSIGKDGKFEYDSKTGLLSITTSEGVYKYNIGCGYNPELA 293
                A  + V+GL  A AI S+G DG F YD  TG+L++TTS GV+ Y+IGCG++P L 
Sbjct: 237 FVNAQANAIVVTGLLDAAAIISLGVDGSFVYDPTTGILTVTTSLGVFLYDIGCGFDPALF 296

Query: 294 SAQEIKIYFQDTLYDTFSFEIQQAPPTDSKC 324
              +I I       D +S       P+D+ C
Sbjct: 297 LGAQITIQVGGVNVDAYSVVYLGVAPSDTTC 327

>CAGL0J01771g complement(164808..169469) some similarities with
           tr|Q08294 Saccharomyces cerevisiae YOL155c, hypothetical
           start
          Length = 1567

 Score =  192 bits (489), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 123/324 (37%), Positives = 174/324 (53%), Gaps = 8/324 (2%)

Query: 4   LILAQLLALSFANAQNVYNTPTVLTGNQKFSDEVVINDGSALTLNDGSEYIFDGGFRGAQ 63
           L    L   SF   Q V+       GNQ   +E+VI +G  ++  DGSEY F GG   +Q
Sbjct: 2   LCYTPLFLSSFLYIQGVFAQAKNYEGNQDLKNELVIQNGDTISYVDGSEYNFGGGIVSSQ 61

Query: 64  Q-CFMDINADKDSPFTLTFGSNAKEFDSSCAVTINNPNTGPDTVQTINISPPVFKNSNKF 122
           + C     A+  S F    G   KEF + C   + N N      QTIN SP VFKN  + 
Sbjct: 62  EGCTFRAVANDKSDFDFNVG---KEFVNYCNFELINKNL-DGFKQTINFSPAVFKNYYQV 117

Query: 123 ILNLAHTSSDANSKIIIGSPDITNTGEINYI-STGGEIHDPNELGNVLQIGTPSGSIQNV 181
            + LAHT SDA SK+I+GSP+I N G++     +  E +DP+  GN+LQI TP G + N 
Sbjct: 118 DIQLAHTRSDAVSKLILGSPEIINAGKLTVRPYSAVEQNDPSREGNILQISTPGGRLVNT 177

Query: 182 GTISLNAANSYYLFGKVSGKGGKINVEKGVLQIDSASFTDNVIHLSPGGAISLRRPPAEE 241
           GTI L+    YYL+G VSG G  IN+ +G+L +++ SF  N I+L     IS++   +  
Sbjct: 178 GTIELSLGVKYYLYGDVSGTG-NINIARGILHMETTSFVGNTINLGGISGISVKSTSSNI 236

Query: 242 VNVSGLGTATAISSIGKDGKFEYDSKTGLLSITTSEGVYKYNIGCGYNP-ELASAQEIKI 300
           + V GL +   ISSIG +G F Y+++TG++++ T  G Y Y+IGCGY+   L S     +
Sbjct: 237 IKVRGLISGNLISSIGDNGSFTYNNQTGIVTVNTDSGRYVYDIGCGYDETTLGSTTGYIV 296

Query: 301 YFQDTLYDTFSFEIQQAPPTDSKC 324
           Y  ++L         +  P   KC
Sbjct: 297 YHGESLKTFVIATSLETAPDYQKC 320

>Scas_561.3
          Length = 953

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 89/344 (25%), Positives = 140/344 (40%), Gaps = 42/344 (12%)

Query: 5   ILAQLLALSFANAQNVYNTPTVLTGNQKFSDEVVINDGSALTLNDGSEYIFDGGFRGAQQ 64
           I   +LA+       + +T TVL GN   ++ V IN G+ L L  G      G  +    
Sbjct: 11  IAVPILAVPLVKGLEI-STNTVLDGNVPANEAVTINSGAYLALIHGITQSISGDLKVDGS 69

Query: 65  CFMDINADKDSPFTLTFGSNAKEFDSSCAVTINNPNTGPDTVQTINISPPVFKNSNKFIL 124
            F+      D    +T G      D+S  + I+N N    T  T+NI    F+N + ++ 
Sbjct: 70  LFIGDTNSADPGMKVTLG----NIDNSGTIVIDNRNA--TTGSTLNIGGSTFEN-DGYMY 122

Query: 125 NLAHTSSDANSKIIIGSPDITNTGEINYISTGGEIHDPNELGNVLQIGTPSGSIQNVGTI 184
               ++   NS  I     I N G + +         P  L  V+ I   + SI N GTI
Sbjct: 123 VAGSSTGIVNSWNIQPVDSIVNKGTMQF-----SQDKPGGLPEVVLI---ANSIINDGTI 174

Query: 185 SLNAANSYYLFGKVSGKGGKINV-----------EKGVLQIDSASFTDNVIHLSPGGAIS 233
            L  A S  L  ++ G  G INV           + GVL   +   + N   +  G A  
Sbjct: 175 CLKNAKS-RLQAQIDGN-GCINVGDNAMFVIKERQYGVLGNQTLYMSSNTSVVYAGSAAL 232

Query: 234 LRRPPAEEVNVSGLGTATAISSIGKDGKFEYDSKTGLLSITTSEGV-YKYNIGCGYNPEL 292
                 + ++V+G G    ++       + YD+ TG+LS+     + +++NIG GYNP+L
Sbjct: 233 -----TDNIHVAGFGNGNFLTFRTSITGWNYDANTGILSVNLFIFINHQFNIGKGYNPDL 287

Query: 293 ASAQEIKIYFQDTLYDTFSFEIQQAPPTDSK------CEDIPPI 330
              + I       L +  +   +  PP  S+      C+ IP I
Sbjct: 288 FQMRSITNNVTPDLVNN-ALVYEGVPPDISRPSACAPCQTIPWI 330

>KLLA0B14498g 1275022..1277322 some similarities with
           ca|CA2713|CaIFF8 Candida albicans unknown function,
           hypothetical start
          Length = 766

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 85/185 (45%), Gaps = 26/185 (14%)

Query: 116 FKNSNKFILNLAHTSSDANSKIIIGSPDITNTGEINYISTGGEIHDPNELGNVLQIGTPS 175
           FKN  + I  +A +S   +   II S    N G +++       H+    G  L +G   
Sbjct: 124 FKNDGE-IYWIAQSSLIGSLYEIIPSSSFENNGLLSFT------HENGRKGGTLTLGNLG 176

Query: 176 GSIQNVGTISLNAANSYYLFGKVSGKGGKINV-EKGVLQ-IDSASFTDNVIHLSPGGAIS 233
            +I N GTI L     Y   G VSG+ G I++ ++G+    +    TD  I+LS   A +
Sbjct: 177 SAITNSGTICLKGV-VYKQSGMVSGESGCISIGDEGLFWAYNGYQLTDQTIYLSSDSA-A 234

Query: 234 LRRP----PAEEVNVSG-----LGTATAISSIGKDGKFEYDSKTGLLSITTSEGVYKYNI 284
           LR      P     V G     +G A AI       +F+YD  TG+L++++    YK +I
Sbjct: 235 LRLEALGSPTFVYKVVGFGKQKVGLAVAIR------EFQYDEDTGILTVSSLLITYKLDI 288

Query: 285 GCGYN 289
           G GY+
Sbjct: 289 GKGYD 293

>YOL155C (YOL155C) [4670] chr15 complement(28702..31605) Protein
           with similarity to S. cerevisiae glucan
           1,4-alpha-glucosidase [2904 bp, 967 aa]
          Length = 967

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 71/271 (26%), Positives = 115/271 (42%), Gaps = 28/271 (10%)

Query: 27  LTGNQKFSDEVVINDGSALTLNDGSEYIFDGGFRGAQQCFMDINADKDSPFTLTFGSNAK 86
           LTG+   ++ V +  G  LTL DG +Y+F   F      F++  +    P T  F  + +
Sbjct: 346 LTGSVIATEAVEVAAGGKLTLLDGDKYVFSADFIIHGGVFVE-KSKPTYPGT-EFDISGE 403

Query: 87  EFDSSCAVTINNPNTGPDTVQTINISPPVFKNSNKFILNLAHTSSDANSKIIIGSPDITN 146
            FD S       P     +    + +P  F NS    L+L    S++    +  SP  +N
Sbjct: 404 NFDVSGTFNAEEPAA--SSASAYSFTPGSFDNSGDISLSL----SESTKGEVTFSP-YSN 456

Query: 147 TGEINY---ISTGGEIHDPNELGNVLQIGTPSGSIQNVGTISLNAANSYYLFGKVSGKGG 203
           +G  ++   I  GG +         LQ    SGS+ N G I+L   ++Y +   VSG  G
Sbjct: 457 SGAFSFSNAILNGGSVSG-------LQRRAESGSVNN-GEINLENGSTYVVVEPVSGS-G 507

Query: 204 KINVEKGVLQIDS-ASFTDNVIHLSPGGAISLRRPPAEE----VNVSGLGTATAISSIGK 258
            IN+  G L +    +FT   +     G +++   P E     + V G      I+    
Sbjct: 508 TINIISGNLYLHYPDTFTGQTVVFKGEGVLAVD--PTETNTTPIPVVGYTGENQIAITAD 565

Query: 259 DGKFEYDSKTGLLSITTSEGVYKYNIGCGYN 289
                YDS TG+L+ T     + ++IG G++
Sbjct: 566 VTALSYDSATGVLTATQGNSQFSFSIGTGFS 596

>CAGL0E06600g 658198..661095 some similarities with sp|P38894
           Saccharomyces cerevisiae YHR211w FLO5, hypothetical
           start
          Length = 965

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 79/183 (43%), Gaps = 19/183 (10%)

Query: 134 NSKIIIGSPDITNTGEINYISTGGEIHDPNELGNVLQIGTPSGSIQNVGTISLNAANSYY 193
           NS ++ G  ++ N G I +         P     V  + +PS  + N GTI L    +  
Sbjct: 136 NSFVLTGQTELVNKGLIQFT------QQPTNWDAVGSVSSPS--LVNEGTICLKNMKTQT 187

Query: 194 LFGKVSGKGGKINVEKGV---LQIDSASFTDNVIHLSPGGAISLRRPPAEEVN--VSGLG 248
           +   +SG G  +  E  +   L I   +    +I+LS   +       A+  N  V+G G
Sbjct: 188 I-SSISGSGCIVIGENSIYDMLSISHGTVGSQMIYLSSTSSELYAESDAKTDNIVVAGFG 246

Query: 249 TATAIS---SIGK-DGKFEYDSKTGLLSITTSEGV-YKYNIGCGYNPELASAQEIKIYFQ 303
               I+   SI    GK+ YD KTG+L++     + + +NIG GY+      ++I  +  
Sbjct: 247 NGNVITFRTSIDPFRGKWSYDGKTGILTVKVWPSMTHIFNIGLGYDSSKFDWKQIDNHCT 306

Query: 304 DTL 306
            TL
Sbjct: 307 PTL 309

>YIL169C (YIL169C) [2509] chr9 complement(23119..26106) Protein of
           unknown function, has a region of weak similarity to a
           region of S. cerevisiae Sed4p, which is involved in
           vesicle formation in the endoplasmic reticulum [2988 bp,
           995 aa]
          Length = 995

 Score = 38.1 bits (87), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 71/288 (24%), Positives = 117/288 (40%), Gaps = 45/288 (15%)

Query: 27  LTGNQKFSDEVVINDGSALTLNDGSEYIFDGGFRGAQQCFMDINADKDSPFTLTFGSNAK 86
           LTG    ++ VV+  G+ LTL DG +Y F    +      + +   K++     F  + +
Sbjct: 320 LTGKVIATEGVVVAAGAKLTLLDGDKYSFSADLKVYGD--LLVKKSKETYPGTEFDISGE 377

Query: 87  EFDSSCAVT--INNPNTGPDTVQTINISPPVFKNSNKFILNLAHTSSDANSKIIIGSPDI 144
            FD    VT   N   +   +    + +P  F NS    L+L    S +    +  SP  
Sbjct: 378 NFD----VTGNFNAEESAATSASIYSFTPSSFDNSGDISLSL----SKSKKGEVTFSP-Y 428

Query: 145 TNTGEINY---ISTGGEIHDPNELGNVLQIGTPSGSIQNVGTISLNAANSYYLFGKVSGK 201
           +N+G  ++   I  GG +       +        GS+ N G I+L+  ++Y +   VSGK
Sbjct: 429 SNSGAFSFSNAILNGGSVSGLQRRDDT------EGSVNN-GEINLDNGSTYVIVEPVSGK 481

Query: 202 GGKINVEKGVLQIDS-ASFTDNVIHLSPGGAISLRRPPAEEVNVSGLGTATAISSIGKDG 260
            G +N+  G L +    +FT   +     G +++   P E         AT I  +G  G
Sbjct: 482 -GTVNIISGNLYLHYPDTFTGQTVVFKGEGVLAVD--PTET-------NATPIPVVGYTG 531

Query: 261 K-----------FEYDSKTGLLSITTSEGVYKYNIGCGYNPELASAQE 297
           K             YD  TG+L+ T     + + IG G++    S  E
Sbjct: 532 KNQIAITADITALSYDGTTGVLTATQGNRQFSFAIGTGFSSSDFSVSE 579

>Scas_674.20d
          Length = 537

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 4/51 (7%)

Query: 242 VNVSGLGTATAISSIGKDGKFEYDSKTGLLSITTSEGVYKYNIGCGYNPEL 292
           VNV  +   +A+SS       EYDS  G+L+IT + G Y  +IG GY+  L
Sbjct: 234 VNVGPITDDSALSST----DVEYDSTGGILNITNTAGTYLLDIGTGYDASL 280

>Sklu_2155.3 , Contig c2155 4020-7043 reverse complement
          Length = 1007

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 51/131 (38%), Gaps = 10/131 (7%)

Query: 166 GNVLQIGTPSGSIQNVGTISLNAANSYYLFGKVSGKGGKINV----EKGVLQIDSASFTD 221
           G  + +G    +I N GT  L   N  Y  G      G I+V       V   ++     
Sbjct: 166 GGSMHLGQDDKTITNDGTFCL--INGLYFQGSTVTGNGCIDVGANSTMWVTNANTRKLQG 223

Query: 222 NVIHLSPGGAISLR---RPPAEEVNVSGLGTATAISSIGKDGKFEYDSKTGLLSITTSEG 278
             I+LS   + +LR     P     V+GLG    +        + YDS  GLLSI     
Sbjct: 224 QTIYLSSRSS-NLRIDAYSPTFSFTVAGLGGGNFVGLNVPISSYTYDSTAGLLSIKYGTY 282

Query: 279 VYKYNIGCGYN 289
            Y+  IG GY+
Sbjct: 283 TYQVYIGTGYD 293

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.310    0.129    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,996,704
Number of extensions: 575373
Number of successful extensions: 1343
Number of sequences better than 10.0: 28
Number of HSP's gapped: 1356
Number of HSP's successfully gapped: 45
Length of query: 964
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 853
Effective length of database: 12,753,511
Effective search space: 10878744883
Effective search space used: 10878744883
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 66 (30.0 bits)