Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0J01661g32732217080.0
Sklu_2363.232332413110.0
YPR011C32632213090.0
Kwal_14.221031531211651e-161
AGL047C31631010301e-141
KLLA0D04290g1881867791e-104
Scas_717.203563454202e-48
YHR002W (LEU5)3573244183e-48
KLLA0D04312g103863949e-48
CAGL0K02915g3423244061e-46
KLLA0E18788g3813243951e-44
CAGL0J05522g5193184002e-44
Kwal_23.30425423223962e-43
AGL065C3353143798e-43
KLLA0C11363g5173183854e-42
Kwal_26.79723583233755e-42
YNL083W5453223793e-41
Sklu_2374.75133223705e-40
Scas_578.3*5243163628e-39
AER419W4933093292e-34
YMR056C (AAC1)3093223151e-33
AER184W3053213123e-33
YPR021C (AGC1)9023063254e-33
YBR085W (AAC3)3073033105e-33
Kwal_27.124813043053106e-33
Scas_667.43083083081e-32
Scas_602.88853053211e-32
ADL049W9123023183e-32
CAGL0F04213g3063033053e-32
CAGL0K02365g9193213165e-32
Sklu_2359.69023023158e-32
Scas_718.243373112951e-30
Kwal_47.173218813023051e-30
CAGL0J02002g3613182962e-30
KLLA0E13453g9063023033e-30
YEL006W3353152933e-30
YBL030C (PET9)3183042897e-30
KLLA0D15015g3173202783e-28
KLLA0E12353g3053062765e-28
Kwal_55.208683803112795e-28
Kwal_23.39653073212722e-27
Scas_709.93653052709e-27
CAGL0G03135g3073242679e-27
YIL006W3733062691e-26
ADL009W3793082682e-26
Scas_716.293163382616e-26
Sklu_2334.23193152547e-25
Sklu_2431.53703512489e-24
YGR096W (TPC1)3143202451e-23
KLLA0D07073g2973012432e-23
CAGL0K08250g2972962432e-23
KLLA0D14036g4313522482e-23
YJL133W (MRS3)3143002432e-23
Scas_691.43343192443e-23
CAGL0K11616g3203122354e-22
Kwal_23.47313143072329e-22
Kwal_33.140503143032311e-21
YKR052C (MRS4)3042992292e-21
Sklu_2037.23103062292e-21
AEL253W3653372312e-21
Kwal_27.120813693102312e-21
Scas_640.253063032283e-21
Kwal_26.86692963042265e-21
KLLA0E23705g3683582276e-21
YIL134W (FLX1)3113092248e-21
ACR260W3113002222e-20
Scas_721.273743372242e-20
Scas_379.23012992212e-20
KLLA0E15532g3263192213e-20
CAGL0G08910g2892942176e-20
YJR095W (SFC1)3223062179e-20
Sklu_2430.103243362152e-19
AAR036W3173222143e-19
Scas_582.73292992125e-19
CAGL0M09020g3483332135e-19
YOR130C (ORT1)2923162081e-18
YKL120W (OAC1)3243082091e-18
Kwal_47.182163333232082e-18
Scas_645.93912812092e-18
AFR146W2813052043e-18
YGR257C (MTM1)3662812056e-18
KLLA0F04697g3073062029e-18
Scas_662.123083142021e-17
YOR222W (ODC2)3073042011e-17
KLLA0E02772g2842942001e-17
CAGL0L05742g3053001992e-17
KLLA0E18810g3773042013e-17
AGL311C3623181978e-17
YPL134C (ODC1)3103111941e-16
Kwal_23.43543432761951e-16
CAGL0K10362g3013021931e-16
Scas_489.42973001922e-16
Scas_589.103163091922e-16
Kwal_26.76533253111922e-16
Scas_632.92923281912e-16
Kwal_26.79672973001913e-16
YBR291C (CTP1)2992981913e-16
KLLA0F03212g3053001904e-16
KLLA0E02750g3042841888e-16
ACR109W2993011861e-15
Scas_667.223063271871e-15
Scas_721.1293233151871e-15
Sklu_2127.52782921832e-15
CAGL0M05225g3813611853e-15
Sklu_1149.22963061833e-15
AER366W2932521824e-15
Sklu_1275.13112981825e-15
AFR131C3442731826e-15
CAGL0H10538g2973181807e-15
KLLA0E08877g2943191799e-15
CAGL0L02079g2973101791e-14
Kwal_55.213353172921791e-14
CAGL0K12210g3113001782e-14
Scas_669.63731971792e-14
KLLA0B12826g3193291754e-14
Sklu_1926.23052961744e-14
Scas_697.473283241755e-14
YMR166C3681921731e-13
Sklu_2115.42993191711e-13
YBR192W (RIM2)3772701712e-13
Kwal_33.129883033221692e-13
KLLA0C13431g3281841692e-13
CAGL0D01606g3053231683e-13
Sklu_2435.23443211684e-13
CAGL0F07711g3681891684e-13
YOR100C (CRC1)3273111674e-13
Kwal_27.114192983111666e-13
CAGL0J04114g3033031659e-13
YPR058W (YMC1)3073191649e-13
Sklu_2398.43093171641e-12
AFL196W3611511651e-12
CAGL0F08305g3742701651e-12
Scas_718.53242981632e-12
KLLA0A09383g3662871604e-12
Kwal_55.211063283081595e-12
Kwal_55.213383232761595e-12
YNL003C (PET8)2842481561e-11
CAGL0C02013g3293291571e-11
CAGL0B04543g3171921561e-11
KLLA0D09889g3641771571e-11
Kwal_27.125993042961551e-11
AFR147C3152611561e-11
KLLA0F17864g3073221542e-11
Scas_558.22892091533e-11
Kwal_33.154463053081533e-11
Scas_714.183053081524e-11
Kwal_0.2322741971497e-11
CAGL0H03839g2822991471e-10
Kwal_56.230113033221462e-10
Kwal_23.29133203221453e-10
CAGL0F00231g3073131453e-10
Sklu_2432.52881901444e-10
KLLA0E09680g3073031444e-10
YPR128C (ANT1)3283011445e-10
Sklu_2075.33453081436e-10
Scas_328.12271321408e-10
ADR036C3402561428e-10
AGR383W2932091419e-10
KLLA0B08503g3032801411e-09
YJR077C (MIR1)3113241411e-09
Scas_687.15*3283311401e-09
Kwal_23.35293951851411e-09
YBR104W (YMC2)3293071383e-09
Scas_715.453053231373e-09
YLR348C (DIC1)2982791347e-09
CAGL0G01166g2952891312e-08
Kwal_33.155973052971312e-08
KLLA0B11319g3552531303e-08
Sklu_1119.13072991293e-08
ABL023W3092951284e-08
ADL264C3292151285e-08
Scas_702.103022981267e-08
Scas_673.173143141241e-07
AAL014C2711961222e-07
KLLA0D04950g2742131186e-07
Kwal_23.57573072981171e-06
Kwal_47.192282811311152e-06
YER053C3003191152e-06
Sklu_2260.53022951143e-06
KLLA0B14454g3051911134e-06
Sklu_2442.82753011125e-06
Scas_562.123001951125e-06
Sklu_2127.43232871117e-06
CAGL0D04774g3223021117e-06
YDL119C3072091091e-05
Sklu_2433.84203251092e-05
CAGL0B03883g3063011072e-05
AFR253W3443291054e-05
YDL198C (YHM1)3001951011e-04
Scas_705.93232991021e-04
YFR045W2852941001e-04
AER450C308202992e-04
KLLA0A00979g343347974e-04
AFR542W310197974e-04
YMR241W (YHM2)314185974e-04
Scas_198.17228884e-04
Kwal_27.11626299195947e-04
KLLA0F08547g308188948e-04
Scas_613.24177180900.001
Scas_671.1*123116870.002
Sklu_2194.3312183890.003
Kwal_34.15907312184890.003
Scas_696.9312162880.005
AGL064W296127880.005
CAGL0K07436g307137870.005
Sklu_2250.17525800.006
YDR470C (UGO1)502234800.063
CAGL0J09790g300230720.38
Sklu_2436.1849494720.50
Sklu_2117.229868700.85
KLLA0F13464g30068681.2
Scas_630.19495138681.6
AGR191W298230671.9
YDL056W (MBP1)83366672.1
CAGL0K06545g512118662.7
AEL060C42957628.6
Sklu_1523.155348628.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J01661g
         (322 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...   662   0.0  
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                         509   0.0  
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...   508   0.0  
Kwal_14.2210                                                          453   e-161
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...   401   e-141
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...   304   e-104
Scas_717.20                                                           166   2e-48
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...   165   3e-48
KLLA0D04312g 367160..367471 highly similar to sgd|S0006215 Sacch...   156   9e-48
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...   160   1e-46
KLLA0E18788g complement(1661093..1662238) similar to sp|P38702 S...   156   1e-44
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...   158   2e-44
Kwal_23.3042                                                          157   2e-43
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...   150   8e-43
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...   152   4e-42
Kwal_26.7972                                                          149   5e-42
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...   150   3e-41
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement      147   5e-40
Scas_578.3*                                                           144   8e-39
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...   131   2e-34
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...   125   1e-33
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...   124   3e-33
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...   129   4e-33
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...   124   5e-33
Kwal_27.12481                                                         124   6e-33
Scas_667.4                                                            123   1e-32
Scas_602.8                                                            128   1e-32
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....   127   3e-32
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...   122   3e-32
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...   126   5e-32
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                         125   8e-32
Scas_718.24                                                           118   1e-30
Kwal_47.17321                                                         122   1e-30
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...   118   2e-30
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...   121   3e-30
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...   117   3e-30
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...   115   7e-30
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...   111   3e-28
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...   110   5e-28
Kwal_55.20868                                                         112   5e-28
Kwal_23.3965                                                          109   2e-27
Scas_709.9                                                            108   9e-27
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...   107   9e-27
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...   108   1e-26
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...   107   2e-26
Scas_716.29                                                           105   6e-26
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement        102   7e-25
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                           100   9e-24
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...    99   1e-23
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...    98   2e-23
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...    98   2e-23
KLLA0D14036g complement(1203522..1204817) some similarities with...   100   2e-23
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    98   2e-23
Scas_691.4                                                             99   3e-23
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...    95   4e-22
Kwal_23.4731                                                           94   9e-22
Kwal_33.14050                                                          94   1e-21
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    93   2e-21
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement         93   2e-21
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    94   2e-21
Kwal_27.12081                                                          94   2e-21
Scas_640.25                                                            92   3e-21
Kwal_26.8669                                                           92   5e-21
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    92   6e-21
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    91   8e-21
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    90   2e-20
Scas_721.27                                                            91   2e-20
Scas_379.2                                                             90   2e-20
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    90   3e-20
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    88   6e-20
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...    88   9e-20
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                         87   2e-19
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....    87   3e-19
Scas_582.7                                                             86   5e-19
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...    87   5e-19
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...    85   1e-18
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...    85   1e-18
Kwal_47.18216                                                          85   2e-18
Scas_645.9                                                             85   2e-18
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...    83   3e-18
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    84   6e-18
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    82   9e-18
Scas_662.12                                                            82   1e-17
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...    82   1e-17
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...    82   1e-17
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    81   2e-17
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...    82   3e-17
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...    80   8e-17
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...    79   1e-16
Kwal_23.4354                                                           80   1e-16
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...    79   1e-16
Scas_489.4                                                             79   2e-16
Scas_589.10                                                            79   2e-16
Kwal_26.7653                                                           79   2e-16
Scas_632.9                                                             78   2e-16
Kwal_26.7967                                                           78   3e-16
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...    78   3e-16
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...    78   4e-16
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    77   8e-16
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...    76   1e-15
Scas_667.22                                                            77   1e-15
Scas_721.129                                                           77   1e-15
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement         75   2e-15
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    76   3e-15
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         75   3e-15
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    75   4e-15
Sklu_1275.1 , Contig c1275 314-1249                                    75   5e-15
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    75   6e-15
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    74   7e-15
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    74   9e-15
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...    74   1e-14
Kwal_55.21335                                                          74   1e-14
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...    73   2e-14
Scas_669.6                                                             74   2e-14
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...    72   4e-14
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement          72   4e-14
Scas_697.47                                                            72   5e-14
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    71   1e-13
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            70   1e-13
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    70   2e-13
Kwal_33.12988                                                          70   2e-13
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...    70   2e-13
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...    69   3e-13
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         69   4e-13
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    69   4e-13
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...    69   4e-13
Kwal_27.11419                                                          69   6e-13
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...    68   9e-13
YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...    68   9e-13
Sklu_2398.4 , Contig c2398 9476-10405                                  68   1e-12
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    68   1e-12
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    68   1e-12
Scas_718.5                                                             67   2e-12
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    66   4e-12
Kwal_55.21106                                                          66   5e-12
Kwal_55.21338                                                          66   5e-12
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    65   1e-11
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    65   1e-11
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...    65   1e-11
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    65   1e-11
Kwal_27.12599                                                          64   1e-11
AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 3...    65   1e-11
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...    64   2e-11
Scas_558.2                                                             64   3e-11
Kwal_33.15446                                                          64   3e-11
Scas_714.18                                                            63   4e-11
Kwal_0.232                                                             62   7e-11
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    61   1e-10
Kwal_56.23011                                                          61   2e-10
Kwal_23.2913                                                           60   3e-10
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...    60   3e-10
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement       60   4e-10
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...    60   4e-10
YPR128C (ANT1) [5547] chr16 complement(791212..792198) Peroxisom...    60   5e-10
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement                60   6e-10
Scas_328.1                                                             59   8e-10
ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH] (771097..77...    59   8e-10
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    59   9e-10
KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...    59   1e-09
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...    59   1e-09
Scas_687.15*                                                           59   1e-09
Kwal_23.3529                                                           59   1e-09
YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...    58   3e-09
Scas_715.45                                                            57   3e-09
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...    56   7e-09
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...    55   2e-08
Kwal_33.15597                                                          55   2e-08
KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyce...    55   3e-08
Sklu_1119.1 YJR077C, Contig c1119 366-1289                             54   3e-08
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...    54   4e-08
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...    54   5e-08
Scas_702.10                                                            53   7e-08
Scas_673.17                                                            52   1e-07
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    52   2e-07
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    50   6e-07
Kwal_23.5757                                                           50   1e-06
Kwal_47.19228                                                          49   2e-06
YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of ...    49   2e-06
Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement         49   3e-06
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...    48   4e-06
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                          48   5e-06
Scas_562.12                                                            48   5e-06
Sklu_2127.4 , Contig c2127 6322-7293                                   47   7e-06
CAGL0D04774g complement(467712..468680) similar to tr|Q06497 Sac...    47   7e-06
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    47   1e-05
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       47   2e-05
CAGL0B03883g 383602..384522 weakly similar to sp|P32331 Saccharo...    46   2e-05
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    45   4e-05
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    44   1e-04
Scas_705.9                                                             44   1e-04
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    43   1e-04
AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH] (1500683..1...    43   2e-04
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    42   4e-04
AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH] complement(...    42   4e-04
YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1 ...    42   4e-04
Scas_198.1                                                             39   4e-04
Kwal_27.11626                                                          41   7e-04
KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces c...    41   8e-04
Scas_613.24                                                            39   0.001
Scas_671.1*                                                            38   0.002
Sklu_2194.3 YMR241W, Contig c2194 5245-6183                            39   0.003
Kwal_34.15907                                                          39   0.003
Scas_696.9                                                             39   0.005
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...    39   0.005
CAGL0K07436g complement(734496..735419) highly similar to sp|Q04...    38   0.005
Sklu_2250.1 YBL030C, Contig c2250 1624-1847                            35   0.006
YDR470C (UGO1) [1287] chr4 complement(1399694..1401202) Protein ...    35   0.063
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    32   0.38 
Sklu_2436.18 YDR470C, Contig c2436 37947-39431 reverse complement      32   0.50 
Sklu_2117.2 YDL198C, Contig c2117 3737-4633                            32   0.85 
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    31   1.2  
Scas_630.19                                                            31   1.6  
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    30   1.9  
YDL056W (MBP1) [809] chr4 (352877..355378) Transcription factor ...    30   2.1  
CAGL0K06545g complement(641129..642667) similar to tr|Q03327 Sac...    30   2.7  
AEL060C [2446] [Homologous to NOHBY] (525069..526358) [1290 bp, ...    28   8.6  
Sklu_1523.1 YMR319C, Contig c1523 73-1734 reverse complement           28   8.9  

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score =  662 bits (1708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/322 (100%), Positives = 322/322 (100%)

Query: 1   MSEVILPAIEEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAY 60
           MSEVILPAIEEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAY
Sbjct: 1   MSEVILPAIEEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAY 60

Query: 61  NKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQ 120
           NKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQ
Sbjct: 61  NKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQ 120

Query: 121 LNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLS 180
           LNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLS
Sbjct: 121 LNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLS 180

Query: 181 KAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSM 240
           KAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSM
Sbjct: 181 KAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSM 240

Query: 241 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLT 300
           GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLT
Sbjct: 241 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLT 300

Query: 301 ANLFKVVPSTAVSWLVYELTWD 322
           ANLFKVVPSTAVSWLVYELTWD
Sbjct: 301 ANLFKVVPSTAVSWLVYELTWD 322

 Score = 72.8 bits (177), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 90/207 (43%), Gaps = 21/207 (10%)

Query: 27  FLAGGIAGAISRTVVSPFERVKILLQVQS-----------STTAYNKGLFDAIGQVYKEE 75
             +G + G  S     P + V+  L VQ+           S  A   G++  + + Y EE
Sbjct: 127 LFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEE 186

Query: 76  N-IKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCG 134
             I GL+RG     + + PY A+ F V+E  K+ +   D  G     ++  +L  GA+ G
Sbjct: 187 GGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFM-PSDENGNSSMRDSLYKLSMGAISG 245

Query: 135 GCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYR 194
           G +   TYP DL+R R  V     ++L     S       VW  L      EG   G Y+
Sbjct: 246 GVAQTITYPFDLLRRRFQVLAMGGNELGFHYNS-------VWDALVTIGKTEG-FKGYYK 297

Query: 195 GVWPTSLGIVPYVALNFAVYEQLKEFM 221
           G+      +VP  A+++ VYE   ++M
Sbjct: 298 GLTANLFKVVPSTAVSWLVYELTWDYM 324

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score =  509 bits (1311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/324 (76%), Positives = 279/324 (86%), Gaps = 8/324 (2%)

Query: 1   MSEV--ILPAIEEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTT 58
           MSE+  +LP   + + +K+ LK D+NVAFLAGG+AGA+SRTVVSPFERVKILLQVQ+STT
Sbjct: 1   MSELAQVLP---QPSYVKSILKNDSNVAFLAGGLAGAVSRTVVSPFERVKILLQVQNSTT 57

Query: 59  AYNKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKG 118
           AYN+G+  A+ QVY+EE   GLFRGNGLNCIR+FPYSAVQFVV+E CKKH FHVD     
Sbjct: 58  AYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGR 117

Query: 119 EQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKL 178
           EQL NWQRLFSGALCGGCSV+ATYPLDLVRTRLS+QTANL+KLSKSRA +I+KPPGVW L
Sbjct: 118 EQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDL 177

Query: 179 LSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKL 238
           L + Y EEGGI GLYRGVWPTSLG+VPYVALNFAVYEQ KEFMP    G  +   + YKL
Sbjct: 178 LCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMP---EGTDNTLANFYKL 234

Query: 239 SMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKG 298
           S+GA+SGGVAQT+TYPFDLLRRRFQVLAMGGNELGF Y SV DAL+TIGKTEGF+GYYKG
Sbjct: 235 SIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKG 294

Query: 299 LTANLFKVVPSTAVSWLVYELTWD 322
           LTANLFKV+PSTAVSWLVYE+  D
Sbjct: 295 LTANLFKVIPSTAVSWLVYEVVCD 318

 Score = 77.4 bits (189), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 64/222 (28%), Positives = 103/222 (46%), Gaps = 30/222 (13%)

Query: 12  ENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQ-------SSTTAYN--- 61
             QL+N+ +        +G + G  S     P + V+  L +Q       S + A+N   
Sbjct: 117 REQLQNWQR------LFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISK 170

Query: 62  -KGLFDAIGQVYKEEN-IKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGE 119
             G++D + + YKEE  IKGL+RG     + V PY A+ F V+E  K+ +     +G   
Sbjct: 171 PPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFM----PEGTDN 226

Query: 120 QLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLL 179
            L N+ +L  GAL GG +   TYP DL+R R  V     ++L     S +        L+
Sbjct: 227 TLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDA------LI 280

Query: 180 SKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFM 221
           +    E  G  G Y+G+      ++P  A+++ VYE + + M
Sbjct: 281 TIGKTE--GFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLM 320

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score =  508 bits (1309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 241/322 (74%), Positives = 279/322 (86%), Gaps = 1/322 (0%)

Query: 1   MSEVILPAIEEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAY 60
           M+EV L  +E+ N +K+FLKQD+N+AFLAGG+AGA+SRTVVSPFERVKILLQVQSSTT+Y
Sbjct: 1   MAEV-LTVLEQPNSIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSY 59

Query: 61  NKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQ 120
           N+G+F +I QVY EE  KGLFRGNGLNCIR+FPYSAVQFVV+E CKK +FHV+     EQ
Sbjct: 60  NRGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQ 119

Query: 121 LNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLS 180
           L N QRLFSGALCGGCSVVATYPLDL++TRLS+QTANLS L++S+A  I+KPPG+W+LLS
Sbjct: 120 LTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLS 179

Query: 181 KAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSM 240
           + Y  EGG+ GLYRGVWPTSLG+VPYVALNFAVYEQL+EF  +  +   S + +LYKL++
Sbjct: 180 ETYRLEGGLRGLYRGVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTI 239

Query: 241 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLT 300
           GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGF Y SVWDALVTIG+ EG  GYYKGL 
Sbjct: 240 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLA 299

Query: 301 ANLFKVVPSTAVSWLVYELTWD 322
           ANLFKVVPSTAVSWLVYE+  D
Sbjct: 300 ANLFKVVPSTAVSWLVYEVVCD 321

>Kwal_14.2210
          Length = 315

 Score =  453 bits (1165), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 226/312 (72%), Positives = 261/312 (83%), Gaps = 6/312 (1%)

Query: 11  EENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQ 70
           +++  +  LK D  +AF AGGIAGA+SRTVVSPFERVKILLQVQSST AYN GLF A+ Q
Sbjct: 5   QDHSWRCALKSDAGIAFCAGGIAGAVSRTVVSPFERVKILLQVQSSTHAYNHGLFRAVKQ 64

Query: 71  VYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSG 130
           VY EE + GL RGNGLNCIR+FPYSAVQF+V+E CKK  F    +     + NW RL SG
Sbjct: 65  VYLEEGVPGLLRGNGLNCIRIFPYSAVQFLVYEFCKKQWFQ---QNPDTVVLNWHRLVSG 121

Query: 131 ALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIM 190
           ALCGGCSV+ATYPLDLVRTRLS+QTANL++L K++A+  AKPPGVW+LL K Y +EGGI 
Sbjct: 122 ALCGGCSVLATYPLDLVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQEGGIF 181

Query: 191 GLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQT 250
           GLYRGVWPTS+G+VPYVALNFAVYEQL+E++P+  +  S+   SLYKLS+GAISGGVAQT
Sbjct: 182 GLYRGVWPTSIGVVPYVALNFAVYEQLREYIPASFDPASA---SLYKLSIGAISGGVAQT 238

Query: 251 ITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPST 310
           ITYPFDLLRRRFQVLAMG +ELGFHY SV DAL+TIG+TEGFKGYYKGLTANLFKVVPST
Sbjct: 239 ITYPFDLLRRRFQVLAMGQSELGFHYKSVPDALITIGRTEGFKGYYKGLTANLFKVVPST 298

Query: 311 AVSWLVYELTWD 322
           AVSW+VYE   D
Sbjct: 299 AVSWVVYETVRD 310

 Score = 65.9 bits (159), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 58/224 (25%), Positives = 99/224 (44%), Gaps = 30/224 (13%)

Query: 16  KNFLKQDTNVAFL------AGGIAGAISRTVVSPFERVKILLQVQSSTTA---------- 59
           K + +Q+ +   L      +G + G  S     P + V+  L +Q++  A          
Sbjct: 101 KQWFQQNPDTVVLNWHRLVSGALCGGCSVLATYPLDLVRTRLSIQTANLARLHKAKAASA 160

Query: 60  -YNKGLFDAIGQVYKEEN-IKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGK 117
               G+++ + + Y +E  I GL+RG     I V PY A+ F V+E  +++I        
Sbjct: 161 AKPPGVWELLRKTYTQEGGIFGLYRGVWPTSIGVVPYVALNFAVYEQLREYI----PASF 216

Query: 118 GEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWK 177
                +  +L  GA+ GG +   TYP DL+R R  V     S+L     S    P     
Sbjct: 217 DPASASLYKLSIGAISGGVAQTITYPFDLLRRRFQVLAMGQSELGFHYKS---VPDA--- 270

Query: 178 LLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFM 221
           L++    E  G  G Y+G+      +VP  A+++ VYE ++++M
Sbjct: 271 LITIGRTE--GFKGYYKGLTANLFKVVPSTAVSWVVYETVRDYM 312

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score =  401 bits (1030), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 201/310 (64%), Positives = 246/310 (79%), Gaps = 4/310 (1%)

Query: 10  EEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIG 69
           + EN ++   K D  +AF+AGG+ GA+SRTVVSP ERVKILLQVQSSTTAYN GL  A+ 
Sbjct: 3   QPENYIQTVYKNDGFIAFVAGGVGGAVSRTVVSPVERVKILLQVQSSTTAYNGGLVHAVK 62

Query: 70  QVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFS 129
           QVYKEE +KGLFRGNG+NC+R+FPYSAVQ+ V+E CK  +FHV   G  EQL +W+RL  
Sbjct: 63  QVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGH-EQLRSWERLVG 121

Query: 130 GALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGI 189
           GAL GG SV+ TYPLDLVRTRLS+QTANL+KL +S+A DI +PPG+ +LL + + EEGG+
Sbjct: 122 GALGGGASVLVTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGL 181

Query: 190 MGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQ 249
            G YRGV+PTSLG+VP+VALNFA+YE+LK  +P D +  S    +  KL++GA+SGG+AQ
Sbjct: 182 RGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSV---AAAKLAIGAVSGGIAQ 238

Query: 250 TITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPS 309
           T+ YPFDLLRRRFQVL MG +ELGF Y SV DAL TIG+ EG +GYYKGLTANL KVVP+
Sbjct: 239 TVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPA 298

Query: 310 TAVSWLVYEL 319
            AV W VYEL
Sbjct: 299 MAVQWFVYEL 308

 Score = 63.2 bits (152), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 90/194 (46%), Gaps = 24/194 (12%)

Query: 40  VVSPFERVKILLQVQSSTTA-----------YNKGLFDAIGQVYKEEN-IKGLFRGNGLN 87
           V  P + V+  L +Q++  A              G+ + + ++++EE  ++G +RG    
Sbjct: 132 VTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPT 191

Query: 88  CIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLV 147
            + V P+ A+ F ++E  K  I H    G         +L  GA+ GG +    YP DL+
Sbjct: 192 SLGVVPFVALNFALYERLKALIPHDYDAGSVAA----AKLAIGAVSGGIAQTVVYPFDLL 247

Query: 148 RTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYV 207
           R R  V T   S+L   R + +A    +W +       + G+ G Y+G+    + +VP +
Sbjct: 248 RRRFQVLTMGQSELG-FRYASVAD--ALWTI-----GRQEGLRGYYKGLTANLVKVVPAM 299

Query: 208 ALNFAVYEQLKEFM 221
           A+ + VYE + E M
Sbjct: 300 AVQWFVYELISENM 313

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score =  304 bits (779), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 141/186 (75%), Positives = 165/186 (88%)

Query: 15  LKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKE 74
           LK   KQ++++AF+AGG+AGA+SRTVVSPFERVKILLQVQSST+AYN G+ +A+GQVYKE
Sbjct: 3   LKQLAKQESSIAFIAGGVAGAVSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKE 62

Query: 75  ENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCG 134
           E + GLFRGNGLNC+R+FPYSAVQFVV+E CKKHIFHVD     EQL NWQRL +GALCG
Sbjct: 63  EGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCG 122

Query: 135 GCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYR 194
           G SV+ATYPLDLVRTRLS+QTANL+KLSKS+A DIAKPPGVW+LL K + EEGGI GLYR
Sbjct: 123 GMSVLATYPLDLVRTRLSIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEEGGIRGLYR 182

Query: 195 GVWPTS 200
           G++PTS
Sbjct: 183 GIYPTS 188

 Score = 64.3 bits (155), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 79/182 (43%), Gaps = 21/182 (11%)

Query: 127 LFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEE 186
             +G + G  S     P + V+  L VQ+           S  A   G+   + + Y EE
Sbjct: 15  FIAGGVAGAVSRTVVSPFERVKILLQVQS-----------STSAYNHGIINAVGQVYKEE 63

Query: 187 GGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFM-PSDENGNSSMRDSLYKLSMGAISG 245
           G + GL+RG     + I PY A+ F VYE  K+ +   D         +  +LS GA+ G
Sbjct: 64  G-VAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCG 122

Query: 246 GVAQTITYPFDLLRRRFQVLAMGGNELGFHYNS-------VWDALVTIGKTE-GFKGYYK 297
           G++   TYP DL+R R  +      +L             VW+ LV   K E G +G Y+
Sbjct: 123 GMSVLATYPLDLVRTRLSIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEEGGIRGLYR 182

Query: 298 GL 299
           G+
Sbjct: 183 GI 184

 Score = 41.2 bits (95), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 43/78 (55%), Gaps = 4/78 (5%)

Query: 241 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLT 300
           G ++G V++T+  PF+    R ++L    +    + + + +A+  + K EG  G ++G  
Sbjct: 18  GGVAGAVSRTVVSPFE----RVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNG 73

Query: 301 ANLFKVVPSTAVSWLVYE 318
            N  ++ P +AV ++VYE
Sbjct: 74  LNCVRIFPYSAVQFVVYE 91

>Scas_717.20
          Length = 356

 Score =  166 bits (420), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 110/345 (31%), Positives = 178/345 (51%), Gaps = 40/345 (11%)

Query: 10  EEENQL---KNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNK---- 62
            + NQ+   KN L+  T    LAGGI+G+ ++T+++P +R+KIL Q  +S   Y K    
Sbjct: 17  RKRNQMPIDKNSLEYITRSG-LAGGISGSCAKTLIAPLDRIKILFQ--TSNPHYTKYAGS 73

Query: 63  --GLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQ 120
             GL +A   ++  + I+G F+G+ +  +R+FPY+AV+FV +E  +  +  + +K   E 
Sbjct: 74  LVGLKEAAKHIWLNDGIRGFFQGHSVTLMRIFPYAAVKFVAYEQIRNTL--IPSK---EY 128

Query: 121 LNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLS 180
            ++W+RL SG+L G CSV  TYPLDL+R RL+  T +           I K P    L +
Sbjct: 129 ESHWRRLMSGSLAGLCSVFTTYPLDLIRVRLAYVTEHKRISLLGLVKTIYKEPASTTLEA 188

Query: 181 KAYAEE--GGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMP---------------- 222
           K Y           YRG  PT LG++PY  ++F  ++ L + +                 
Sbjct: 189 KGYIPNWFAHWCNFYRGYTPTVLGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLALSESE 248

Query: 223 SDENGNSSMRDSLY---KLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFH-YNS 278
            +E      R  L    +L  G ++G  +QT  YPF+++RRR QV  +  +++  H + S
Sbjct: 249 QEERHFKHQRLPLRTWAELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQS 308

Query: 279 VWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE-LTWD 322
           + +    I K  G++G++ GL+    KV P  A S+ VYE + W 
Sbjct: 309 ISEIAKIIYKERGWRGFFVGLSIGYIKVTPMVACSFFVYERMKWH 353

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 56/114 (49%), Gaps = 9/114 (7%)

Query: 5   ILPAIEEENQLKNFLKQD----TNVAFLAGGIAGAISRTVVSPFERVKILLQVQS-STTA 59
           +L   E E + ++F  Q     T    L+GG+AG  S+T   PFE ++  LQV + S + 
Sbjct: 241 VLALSESEQEERHFKHQRLPLRTWAELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQ 300

Query: 60  YNKGLFDAIGQV----YKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHI 109
                F +I ++    YKE   +G F G  +  I+V P  A  F V+E  K H+
Sbjct: 301 MYDHRFQSISEIAKIIYKERGWRGFFVGLSIGYIKVTPMVACSFFVYERMKWHL 354

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score =  165 bits (418), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 105/324 (32%), Positives = 167/324 (51%), Gaps = 36/324 (11%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNK------GLFDAIGQVYKEENIKGLF 81
           LAGGI+G+ ++T+++P +R+KIL Q  +S   Y K      GL +A   ++  + ++G F
Sbjct: 38  LAGGISGSCAKTLIAPLDRIKILFQ--TSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFF 95

Query: 82  RGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVAT 141
           +G+    +R+FPY+AV+FV +E  +  +  + +K   E  ++W+RL SG+L G CSV  T
Sbjct: 96  QGHSATLLRIFPYAAVKFVAYEQIRNTL--IPSK---EFESHWRRLVSGSLAGLCSVFIT 150

Query: 142 YPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEE--GGIMGLYRGVWPT 199
           YPLDLVR RL+ +T +           I K P    L+   Y           YRG  PT
Sbjct: 151 YPLDLVRVRLAYETEHKRVKLGRIIKKIYKEPASATLIKNDYIPNWFCHWCNFYRGYVPT 210

Query: 200 SLGIVPYVALNFAVYEQLKEFMPSD----------------ENGNSSMRDSLY---KLSM 240
            LG++PY  ++F  ++ L + + S                 E      R  L    +L  
Sbjct: 211 VLGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLELSEDDELERVQKKQRRPLRTWAELIS 270

Query: 241 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFH-YNSVWDALVTIGKTEGFKGYYKGL 299
           G ++G  +QT  YPF+++RRR QV A+    +  H + S+ +    I K  G +G++ GL
Sbjct: 271 GGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQSISEIAHIIFKERGVRGFFVGL 330

Query: 300 TANLFKVVPSTAVSWLVYE-LTWD 322
           +    KV P  A S+ VYE + W+
Sbjct: 331 SIGYIKVTPMVACSFFVYERMKWN 354

>KLLA0D04312g 367160..367471 highly similar to sgd|S0006215
           Saccharomyces cerevisiae YPR011c, hypothetical start
          Length = 103

 Score =  156 bits (394), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 81/86 (94%)

Query: 234 SLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFK 293
           +LYKL+MGAISGGVAQT+ YPFDLLRRRFQVLAMGGNELGF Y SV DAL+TIGKTEG K
Sbjct: 10  NLYKLAMGAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGKTEGPK 69

Query: 294 GYYKGLTANLFKVVPSTAVSWLVYEL 319
           GYYKGLTANLFKV+PSTAVSWLVYE+
Sbjct: 70  GYYKGLTANLFKVIPSTAVSWLVYEV 95

 Score = 42.7 bits (99), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 51/98 (52%), Gaps = 8/98 (8%)

Query: 22  DTNVAFL----AGGIAGAISRTVVSPFE----RVKILLQVQSSTTAYNKGLFDAIGQVYK 73
           D N+A L     G I+G +++T+V PF+    R ++L    +      K + DA+  + K
Sbjct: 5   DPNLANLYKLAMGAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGK 64

Query: 74  EENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFH 111
            E  KG ++G   N  +V P +AV ++V+E  ++ +  
Sbjct: 65  TEGPKGYYKGLTANLFKVIPSTAVSWLVYEVIREAMVE 102

 Score = 39.7 bits (91), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 47/105 (44%), Gaps = 14/105 (13%)

Query: 120 QLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLL 179
            L N  +L  GA+ GG +    YP DL+R R  V     ++L              +K +
Sbjct: 7   NLANLYKLAMGAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFR-----------YKSV 55

Query: 180 SKAYAEEG---GIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFM 221
           S A    G   G  G Y+G+      ++P  A+++ VYE ++E M
Sbjct: 56  SDALITIGKTEGPKGYYKGLTANLFKVIPSTAVSWLVYEVIREAM 100

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score =  160 bits (406), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 99/324 (30%), Positives = 167/324 (51%), Gaps = 36/324 (11%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNK------GLFDAIGQVYKEENIKGLF 81
           LAGG++G+ ++T+++P +R+KIL Q  +S   Y+K      GL++A   ++  + I+G F
Sbjct: 23  LAGGVSGSCAKTLIAPLDRIKILFQ--TSNPHYSKYAGSLVGLYEAAKHIWINDGIRGFF 80

Query: 82  RGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVAT 141
           +G+ +  +R+FPY+AV+FV +E  +  +         E  ++W+RL SG+L G CSV  T
Sbjct: 81  QGHSVTLLRIFPYAAVKFVAYEQIRSILI-----PSREYESHWRRLASGSLAGLCSVFIT 135

Query: 142 YPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEE--GGIMGLYRGVWPT 199
           YPLDL R RL+  T +     +     I   P    L S     +        YRG  PT
Sbjct: 136 YPLDLTRVRLAYVTEHKRVKLRDIVKTIYHEPASEGLTSHLLVPKWFAHWCNFYRGYVPT 195

Query: 200 SLGIVPYVALNFAVYEQLKEFMPS--------------DENGNSSMRD-----SLYKLSM 240
            LG++PY  ++F  ++ + + M S              +E     +R      +  +L  
Sbjct: 196 VLGMIPYAGVSFFAHDLIHDIMKSSLMAPYAVKQLSSQEELERKKLRQKTPLRTWAELVA 255

Query: 241 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFH-YNSVWDALVTIGKTEGFKGYYKGL 299
           G +SG ++QT  YP +++RRR QV  +   ++  H + S+      I + +G++G++ GL
Sbjct: 256 GGLSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQSISSIARIIYQEKGWRGFFVGL 315

Query: 300 TANLFKVVPSTAVSWLVYE-LTWD 322
           +    KV P  A S+ VYE + W 
Sbjct: 316 SIGYIKVTPMVACSFFVYERMKWH 339

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 52/107 (48%), Gaps = 11/107 (10%)

Query: 11  EENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQ 70
           E  +L+      T    +AGG++G +S+T   P E ++  LQV   +T   + ++D   Q
Sbjct: 237 ERKKLRQKTPLRTWAELVAGGLSGILSQTAAYPLEIIRRRLQV---STLSPRKMYDHKFQ 293

Query: 71  --------VYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHI 109
                   +Y+E+  +G F G  +  I+V P  A  F V+E  K H+
Sbjct: 294 SISSIARIIYQEKGWRGFFVGLSIGYIKVTPMVACSFFVYERMKWHL 340

>KLLA0E18788g complement(1661093..1662238) similar to sp|P38702
           Saccharomyces cerevisiae YHR002w, start by similarity
          Length = 381

 Score =  156 bits (395), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 101/324 (31%), Positives = 165/324 (50%), Gaps = 41/324 (12%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNK------GLFDAIGQVYKEENIKGLF 81
           LAGG+AG+ ++T+++P +R+KIL Q  +S   Y K      GL +A   ++  + ++G+F
Sbjct: 58  LAGGVAGSCAKTLIAPLDRIKILFQ--TSNPHYVKYAGSFQGLLNAGVHIWSRDRLRGVF 115

Query: 82  RGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVAT 141
           +G+    +R+FPY+AV+F+ +E  +  I  + +K   E   +++RL SG+L G CSV  T
Sbjct: 116 QGHSATLLRIFPYAAVKFIAYEQIRNVI--IPSK---EYETHFRRLCSGSLAGLCSVFCT 170

Query: 142 YPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEE--GGIMGLYRGVWPT 199
           YPLDL+R RL+  T +           I   P    L SKAY  +        YRG  PT
Sbjct: 171 YPLDLIRVRLAYVTEHHKVRVWPLVKQIYSEPASEALSSKAYVPKWFAQWCNFYRGYIPT 230

Query: 200 SLGIVPYVALNFAVY-------------------------EQLKEFMPSDENGNSSMRDS 234
            +G++PY  ++F  +                         + LK  + +   G     ++
Sbjct: 231 VIGMIPYAGVSFFAHDLFHDILRHPVIAPYSVLRVDDLDADDLKVDVQTTRTGKRIPLNT 290

Query: 235 LYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKG 294
             +L  G ++G  +QT  YPF+++RRR QV A+  N L   + S+ +    I    G++G
Sbjct: 291 WAELLAGGLAGMASQTAAYPFEIIRRRLQVGAV-TNPLEHKFTSMSEMAKIIFHERGWRG 349

Query: 295 YYKGLTANLFKVVPSTAVSWLVYE 318
           ++ GL+    KV P  A S+ VYE
Sbjct: 350 FFVGLSIGYIKVTPMVACSFFVYE 373

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/211 (20%), Positives = 79/211 (37%), Gaps = 34/211 (16%)

Query: 128 FSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEG 187
            +G + G C+     PLD ++        +  K + S    +     +W           
Sbjct: 58  LAGGVAGSCAKTLIAPLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIW--------SRD 109

Query: 188 GIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGV 247
            + G+++G   T L I PY A+ F  YEQ++  +   +   +  R    +L  G+++G  
Sbjct: 110 RLRGVFQGHSATLLRIFPYAAVKFIAYEQIRNVIIPSKEYETHFR----RLCSGSLAGLC 165

Query: 248 AQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKG------------- 294
           +   TYP DL+R R   +         H   VW  +  I      +              
Sbjct: 166 SVFCTYPLDLIRVRLAYVT------EHHKVRVWPLVKQIYSEPASEALSSKAYVPKWFAQ 219

Query: 295 ---YYKGLTANLFKVVPSTAVSWLVYELTWD 322
              +Y+G    +  ++P   VS+  ++L  D
Sbjct: 220 WCNFYRGYIPTVIGMIPYAGVSFFAHDLFHD 250

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 44/89 (49%), Gaps = 5/89 (5%)

Query: 22  DTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQ----VYKEENI 77
           +T    LAGG+AG  S+T   PFE ++  LQV + T       F ++ +    ++ E   
Sbjct: 289 NTWAELLAGGLAGMASQTAAYPFEIIRRRLQVGAVTNPLEHK-FTSMSEMAKIIFHERGW 347

Query: 78  KGLFRGNGLNCIRVFPYSAVQFVVFEGCK 106
           +G F G  +  I+V P  A  F V+E  K
Sbjct: 348 RGFFVGLSIGYIKVTPMVACSFFVYERMK 376

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score =  158 bits (400), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 106/318 (33%), Positives = 159/318 (50%), Gaps = 38/318 (11%)

Query: 27  FLAGGIAGAISRTVVSPFERVKILLQVQS--STTAYNKG------------------LFD 66
           F+AGGI+G ISRT  +PF+R+K+ L  ++  S+T  N                    L  
Sbjct: 204 FIAGGISGVISRTCTAPFDRLKVFLIARTDLSSTLLNSTEDVLAKNPHAKPNKLRSPLVK 263

Query: 67  AIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQR 126
           AI  +Y++  IK  + GNGLN ++VFP S+++F  FE  KK +  V+     + L+    
Sbjct: 264 AIISLYRQGGIKSFYVGNGLNALKVFPESSIKFGSFEITKKLMTKVENCKDTKDLSKLST 323

Query: 127 LFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEE 186
             +G L G C+  + YP+D ++ R+  Q A L+   K R   I          +K    E
Sbjct: 324 FIAGGLAGVCAQFSVYPIDTLKFRM--QCAPLNAELKGRKLMIQT--------AKEMYTE 373

Query: 187 GGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLS------M 240
           GG+   YRGV    LGI PY AL+   +  LK++  S +    + ++   +LS      M
Sbjct: 374 GGLKLFYRGVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLVVLPM 433

Query: 241 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLT 300
           GA SG    T+ YP +LLR R Q  A G     + Y+   D L+   + EG+ G +KGL 
Sbjct: 434 GAFSGTFGATVVYPINLLRTRLQ--AQGTFAHPYRYDGFRDVLLKTIQREGYPGLFKGLV 491

Query: 301 ANLFKVVPSTAVSWLVYE 318
             L KV P+ ++S+L YE
Sbjct: 492 PTLAKVCPAVSISYLCYE 509

 Score = 77.0 bits (188), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 107/233 (45%), Gaps = 30/233 (12%)

Query: 1   MSEVILPAIEEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQ--SSTT 58
           +++ ++  +E     K+  K  T   F+AGG+AG  ++  V P + +K  +Q    ++  
Sbjct: 301 ITKKLMTKVENCKDTKDLSKLST---FIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAEL 357

Query: 59  AYNKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGK- 117
              K +     ++Y E  +K  +RG  +  + +FPY+A+    F   KK  +++ +K K 
Sbjct: 358 KGRKLMIQTAKEMYTEGGLKLFYRGVTVGVLGIFPYAALDLGTFSMLKK--WYISSKAKK 415

Query: 118 ------GEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAK 171
                   +L+N   L  GA  G       YP++L+RTRL  Q               A 
Sbjct: 416 LNKKEEDVELSNLVVLPMGAFSGTFGATVVYPINLLRTRLQAQGT------------FAH 463

Query: 172 P---PGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFM 221
           P    G   +L K    EG   GL++G+ PT   + P V++++  YE LK+ M
Sbjct: 464 PYRYDGFRDVLLKTIQREG-YPGLFKGLVPTLAKVCPAVSISYLCYENLKKLM 515

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 44/100 (44%), Gaps = 24/100 (24%)

Query: 241 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHY-NSVWD------------------ 281
           G ISG +++T T PFD    R +V  +   +L     NS  D                  
Sbjct: 207 GGISGVISRTCTAPFD----RLKVFLIARTDLSSTLLNSTEDVLAKNPHAKPNKLRSPLV 262

Query: 282 -ALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYELT 320
            A++++ +  G K +Y G   N  KV P +++ +  +E+T
Sbjct: 263 KAIISLYRQGGIKSFYVGNGLNALKVFPESSIKFGSFEIT 302

>Kwal_23.3042
          Length = 542

 Score =  157 bits (396), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 105/322 (32%), Positives = 163/322 (50%), Gaps = 46/322 (14%)

Query: 27  FLAGGIAGAISRTVVSPFERVKILLQVQ---SSTTAYNKG-----------------LFD 66
           F+AGG++G +SRT  +PF+R+K+ L  +   SST   +K                  L  
Sbjct: 228 FIAGGVSGVVSRTCTAPFDRIKVFLIARTDLSSTFLKSKDIILEKNPNADLSKIKSPLVK 287

Query: 67  AIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQR 126
           A   +Y++  I+  + GNGLN ++VFP SA++F  FE  K+ +  ++       L+ +  
Sbjct: 288 AATTLYRQGGIRAFYVGNGLNAMKVFPESAIKFGSFELAKRLMAQLEGVQDTAGLSRFST 347

Query: 127 LFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEE 186
             +G L G  + ++ YP+D ++ R  VQ A L+  SK R   I+    ++K        E
Sbjct: 348 YLAGGLGGVMAQLSVYPIDTLKYR--VQCAPLNTESKGRQLLISTAKDMYK--------E 397

Query: 187 GGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEF----------MPSDENGNSSMRDSLY 236
           GG+   YRG+    +GI PY A++   +  LK++          +P D+   S+M    +
Sbjct: 398 GGLRIFYRGITVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQVTMSNM----F 453

Query: 237 KLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYY 296
            L MGA SG V  T  YP +LLR R Q  A G       YN   D L+   + EG++G +
Sbjct: 454 VLLMGAFSGTVGATAVYPVNLLRTRLQ--AQGTFAHPHRYNGFRDVLLKTVQREGYQGLF 511

Query: 297 KGLTANLFKVVPSTAVSWLVYE 318
           KGL  NL KV P+ ++S+L YE
Sbjct: 512 KGLVPNLAKVCPAVSISYLCYE 533

 Score = 72.8 bits (177), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 59/207 (28%), Positives = 93/207 (44%), Gaps = 25/207 (12%)

Query: 26  AFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKG---LFDAIGQVYKEENIKGLFR 82
            +LAGG+ G +++  V P + +K  +Q     T  +KG   L      +YKE  ++  +R
Sbjct: 347 TYLAGGLGGVMAQLSVYPIDTLKYRVQCAPLNTE-SKGRQLLISTAKDMYKEGGLRIFYR 405

Query: 83  GNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKG---EQ--LNNWQRLFSGALCGGCS 137
           G  +  + +FPY+A+    F   KK       +  G   +Q  ++N   L  GA  G   
Sbjct: 406 GITVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQVTMSNMFVLLMGAFSGTVG 465

Query: 138 VVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPP---GVWKLLSKAYAEEGGIMGLYR 194
             A YP++L+RTRL  Q               A P    G   +L K    EG   GL++
Sbjct: 466 ATAVYPVNLLRTRLQAQGT------------FAHPHRYNGFRDVLLKTVQREG-YQGLFK 512

Query: 195 GVWPTSLGIVPYVALNFAVYEQLKEFM 221
           G+ P    + P V++++  YE LK  M
Sbjct: 513 GLVPNLAKVCPAVSISYLCYENLKRGM 539

 Score = 32.0 bits (71), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 40/99 (40%), Gaps = 24/99 (24%)

Query: 241 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWD------------------- 281
           G +SG V++T T PFD    R +V  +   +L   +    D                   
Sbjct: 231 GGVSGVVSRTCTAPFD----RIKVFLIARTDLSSTFLKSKDIILEKNPNADLSKIKSPLV 286

Query: 282 -ALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYEL 319
            A  T+ +  G + +Y G   N  KV P +A+ +  +EL
Sbjct: 287 KAATTLYRQGGIRAFYVGNGLNAMKVFPESAIKFGSFEL 325

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score =  150 bits (379), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 100/314 (31%), Positives = 162/314 (51%), Gaps = 29/314 (9%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKG----LFDAIGQVYKEENIKGLFRG 83
           LAGGIAG+ ++T+V+P +R+KIL Q  +   A   G    L  A   +   +  +G F+G
Sbjct: 24  LAGGIAGSCAKTLVAPLDRIKILFQTSNPQFAQFAGSMGGLVRASKYIMAHDGPRGFFQG 83

Query: 84  NGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYP 143
           +    +R+FPY+A++F+ +E  +  +            ++W+RL SG+L G CSV  TYP
Sbjct: 84  HSATLLRIFPYAAIKFIAYEQIRSVVIPT-----WRHESHWRRLLSGSLAGLCSVFVTYP 138

Query: 144 LDLVRTRLS-VQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEE--GGIMGLYRGVWPTS 200
           LDLVR RL+ V   + +K+ K  A    + P   + L K Y  +        YRG  PT 
Sbjct: 139 LDLVRVRLAYVTERHDAKVRKIMACIYNERPS--EALRKWYIPQWFAHWSNFYRGYTPTV 196

Query: 201 LGIVPYVALNFAVYEQLKEFM--PSDE------NGNSSMRD------SLYKLSMGAISGG 246
           +G++PY  ++F  ++  ++    P  E       G SS  D      +  +L  G ++G 
Sbjct: 197 IGMIPYAGVSFFAHDLCQDIFRHPMLEPYSVLSPGGSSAYDRTVPLKTWAQLVAGGLAGM 256

Query: 247 VAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKV 306
            +QT  YPF+++RRR QV A+  +    H+  + +    I    G++G++ GL+    KV
Sbjct: 257 ASQTAAYPFEIIRRRLQVSAI-TDPTRRHFVGINEIAKIIYTEGGWRGFFVGLSIGYIKV 315

Query: 307 VPSTAVSWLVYELT 320
            P  A S+ +YE T
Sbjct: 316 TPMVACSFFIYERT 329

 Score = 59.7 bits (143), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 55/247 (22%), Positives = 101/247 (40%), Gaps = 44/247 (17%)

Query: 1   MSEVILPAIEEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSS---- 56
           +  V++P    E+  +  L         +G +AG  S  V  P + V++ L   +     
Sbjct: 105 IRSVVIPTWRHESHWRRLL---------SGSLAGLCSVFVTYPLDLVRVRLAYVTERHDA 155

Query: 57  ------TTAYNKGLFDAIGQVYKEE---NIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKK 107
                    YN+   +A+ + Y  +   +    +RG     I + PY+ V F   + C+ 
Sbjct: 156 KVRKIMACIYNERPSEALRKWYIPQWFAHWSNFYRGYTPTVIGMIPYAGVSFFAHDLCQD 215

Query: 108 HIFH-------VDTKG------KGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQ 154
              H       V + G      +   L  W +L +G L G  S  A YP +++R RL  Q
Sbjct: 216 IFRHPMLEPYSVLSPGGSSAYDRTVPLKTWAQLVAGGLAGMASQTAAYPFEIIRRRL--Q 273

Query: 155 TANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVY 214
            + ++  ++     I +       ++K    EGG  G + G+    + + P VA +F +Y
Sbjct: 274 VSAITDPTRRHFVGINE-------IAKIIYTEGGWRGFFVGLSIGYIKVTPMVACSFFIY 326

Query: 215 EQLKEFM 221
           E+ K ++
Sbjct: 327 ERTKWYL 333

 Score = 56.6 bits (135), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 87/212 (41%), Gaps = 37/212 (17%)

Query: 128 FSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEG 187
            +G + G C+     PLD  R ++  QT+N       + +  A   G     SK      
Sbjct: 24  LAGGIAGSCAKTLVAPLD--RIKILFQTSN------PQFAQFAGSMGGLVRASKYIMAHD 75

Query: 188 GIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGV 247
           G  G ++G   T L I PY A+ F  YEQ++  +       S  R    +L  G+++G  
Sbjct: 76  GPRGFFQGHSATLLRIFPYAAIKFIAYEQIRSVVIPTWRHESHWR----RLLSGSLAGLC 131

Query: 248 AQTITYPFDLLRRRF------------QVLAMGGNE-----LGFHYNSVWDALVTIGKTE 290
           +  +TYP DL+R R             +++A   NE     L   Y   W A        
Sbjct: 132 SVFVTYPLDLVRVRLAYVTERHDAKVRKIMACIYNERPSEALRKWYIPQWFA-------- 183

Query: 291 GFKGYYKGLTANLFKVVPSTAVSWLVYELTWD 322
            +  +Y+G T  +  ++P   VS+  ++L  D
Sbjct: 184 HWSNFYRGYTPTVIGMIPYAGVSFFAHDLCQD 215

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score =  152 bits (385), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 99/318 (31%), Positives = 156/318 (49%), Gaps = 38/318 (11%)

Query: 27  FLAGGIAGAISRTVVSPFERVKILLQVQS--STTAYNKG------------------LFD 66
           F+AGG +G +SRT  +PF+R+K+ L  ++  S+T  N                    L  
Sbjct: 203 FIAGGCSGVVSRTCTAPFDRIKVFLIARTDLSSTLLNSKDTLLAKNPNADLSKIKSPLIK 262

Query: 67  AIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQR 126
           A   +Y++  ++  + GNGLN ++VFP SA++F  FE  K+ +  ++      +L+    
Sbjct: 263 AATTLYRQGGLRAFYVGNGLNVVKVFPESAIKFGSFEMAKRIMARLENVKDTSELSRLST 322

Query: 127 LFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEE 186
             +G L G  +  + YP+D ++ R+     N + L KS          +    +K   ++
Sbjct: 323 YIAGGLGGVAAQFSVYPIDTLKYRIQCAPLN-TNLKKS---------SILLQTAKEMYQQ 372

Query: 187 GGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRD------SLYKLSM 240
           GGI   YRGV    +GI PY AL+   +  LK++    E   + + +      +L  L M
Sbjct: 373 GGIRLFYRGVHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNLIVLPM 432

Query: 241 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLT 300
           GA SG V  T+ YP +LLR R Q  A G       YN   D L    + EG++G +KGL 
Sbjct: 433 GAFSGTVGATLVYPINLLRTRLQ--AQGTYAHPHTYNGFSDVLKKTIQREGYQGLFKGLV 490

Query: 301 ANLFKVVPSTAVSWLVYE 318
            NL KV P+ ++S+L YE
Sbjct: 491 PNLAKVCPAVSISYLCYE 508

 Score = 75.1 bits (183), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 90/203 (44%), Gaps = 17/203 (8%)

Query: 26  AFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKG--LFDAIGQVYKEENIKGLFRG 83
            ++AGG+ G  ++  V P + +K  +Q     T   K   L     ++Y++  I+  +RG
Sbjct: 322 TYIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSILLQTAKEMYQQGGIRLFYRG 381

Query: 84  NGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQ-----LNNWQRLFSGALCGGCSV 138
             +  + +FPY+A+    F   KK     + K  G       ++N   L  GA  G    
Sbjct: 382 VHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNLIVLPMGAFSGTVGA 441

Query: 139 VATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWP 198
              YP++L+RTRL  Q       + +  SD+         L K    EG   GL++G+ P
Sbjct: 442 TLVYPINLLRTRLQAQGTYAHPHTYNGFSDV---------LKKTIQREG-YQGLFKGLVP 491

Query: 199 TSLGIVPYVALNFAVYEQLKEFM 221
               + P V++++  YE LK  M
Sbjct: 492 NLAKVCPAVSISYLCYENLKRLM 514

>Kwal_26.7972
          Length = 358

 Score =  149 bits (375), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 98/323 (30%), Positives = 164/323 (50%), Gaps = 51/323 (15%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNK------GLFDAIGQVYKEENIKGLF 81
           LAGGIAG+ ++T+++P +R+KIL Q  +S   Y K      GL  A   +   + I+G +
Sbjct: 32  LAGGIAGSCAKTLIAPLDRIKILFQ--TSNPHYLKYSGSTMGLIRAGAHINAHDGIRGFY 89

Query: 82  RGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVAT 141
           +G+    IR+FPY+A++F+ +E  +   F + +K   E   + +RL SG++ G CSV  T
Sbjct: 90  QGHSATLIRIFPYAAIKFIAYEQIRH--FMIPSK---EYETHARRLASGSMAGLCSVFMT 144

Query: 142 YPLDLVRTRLSVQTAN--------LSKLSKSRASDIAKPPGVWKLLSKAYAEE--GGIMG 191
           YPLDL+R RL+  T          + ++   RAS+         L SK+Y          
Sbjct: 145 YPLDLIRVRLAYVTDRSRIKMLPVIKQIYTERASE--------SLTSKSYVPRWFAHWCN 196

Query: 192 LYRGVWPTSLGIVPYVALNFAVYEQLKEFMP------------SDE-------NGNSSMR 232
            YRG  PT LG++PY  ++F  ++   + +             SDE         +S   
Sbjct: 197 FYRGFTPTVLGMIPYAGVSFFAHDLCGDILRSGALSPYSVLPISDEELTIRSKKQSSRPL 256

Query: 233 DSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGF 292
            +  +L  G ++G  +QT +YPF+++RRR QV  +    +  ++ ++ D +  I K  G+
Sbjct: 257 KTWAELVAGGLAGMASQTASYPFEIIRRRLQVSVVSPTSI-HNFQTIPDMIRIIYKERGW 315

Query: 293 KGYYKGLTANLFKVVPSTAVSWL 315
           +G++ GL+    KV P  A S+ 
Sbjct: 316 RGFFVGLSIGYIKVTPMVACSFF 338

 Score = 44.3 bits (103), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 50/106 (47%), Gaps = 13/106 (12%)

Query: 221 MPSDENGNSSMRDSLYKLS---MGAISGGVAQTITYPFDLLRRRFQV-----LAMGGNEL 272
           M   +N +   R + Y L     G I+G  A+T+  P D ++  FQ      L   G+ +
Sbjct: 11  MVPSKNQSVDKRSAHYILRSGLAGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTM 70

Query: 273 GFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
           G     +  A   I   +G +G+Y+G +A L ++ P  A+ ++ YE
Sbjct: 71  G-----LIRAGAHINAHDGIRGFYQGHSATLIRIFPYAAIKFIAYE 111

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score =  150 bits (379), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 106/322 (32%), Positives = 162/322 (50%), Gaps = 46/322 (14%)

Query: 27  FLAGGIAGAISRTVVSPFERVK-----------ILLQVQSSTTAYNKG---------LFD 66
           F+AGGI+G ISRT  +PF+R+K           ILL  ++   A N           L  
Sbjct: 231 FIAGGISGVISRTCTAPFDRLKVFLIARTDLSSILLNSKTDLLAKNPNADINKISSPLAK 290

Query: 67  AIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQR 126
           A+  +Y++  IK  + GNGLN I+VFP S+++F  FE  KK +  ++     + L+ +  
Sbjct: 291 AVKSLYRQGGIKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIMTKLEGCRDTKDLSKFST 350

Query: 127 LFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEE 186
             +G L G  +  + YP+D ++ R  VQ A L   +K + +++          +K    E
Sbjct: 351 YIAGGLAGMAAQFSVYPIDTLKFR--VQCAPLD--TKLKGNNLLFQT------AKDMFRE 400

Query: 187 GGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEF----------MPSDENGNSSMRDSLY 236
           GG+   YRGV    +GI PY AL+   +  LK++          +P D+   S    +L 
Sbjct: 401 GGLRLFYRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVTLS----NLV 456

Query: 237 KLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYY 296
            L MGA SG V  ++ YP +LLR R Q  A G     + YN   D L+   + EG++G +
Sbjct: 457 VLPMGAFSGTVGASVVYPINLLRTRLQ--AQGTYAHPYVYNGFKDVLLKTLEREGYQGLF 514

Query: 297 KGLTANLFKVVPSTAVSWLVYE 318
           KGL   L KV P+ ++S+L YE
Sbjct: 515 KGLVPTLAKVCPAVSISYLCYE 536

 Score = 77.0 bits (188), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 105/233 (45%), Gaps = 30/233 (12%)

Query: 1   MSEVILPAIEEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAY 60
           +++ I+  +E     K+  K  T   ++AGG+AG  ++  V P + +K  +Q     T  
Sbjct: 328 VTKKIMTKLEGCRDTKDLSKFST---YIAGGLAGMAAQFSVYPIDTLKFRVQCAPLDTKL 384

Query: 61  --NKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKG 118
             N  LF     +++E  ++  +RG  +  + +FPY+A+    F   KK  +++  + K 
Sbjct: 385 KGNNLLFQTAKDMFREGGLRLFYRGVTVGIVGIFPYAALDLGTFSALKK--WYIAKQAKT 442

Query: 119 EQLNNWQRLFS-------GALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAK 171
             L   Q   S       GA  G       YP++L+RTRL  Q               A 
Sbjct: 443 LNLPQDQVTLSNLVVLPMGAFSGTVGASVVYPINLLRTRLQAQGT------------YAH 490

Query: 172 P---PGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFM 221
           P    G   +L K    EG   GL++G+ PT   + P V++++  YE LK+FM
Sbjct: 491 PYVYNGFKDVLLKTLEREG-YQGLFKGLVPTLAKVCPAVSISYLCYENLKKFM 542

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 46/96 (47%), Gaps = 16/96 (16%)

Query: 241 GAISGGVAQTITYPFD---------------LLRRRFQVLAMGGN-ELGFHYNSVWDALV 284
           G ISG +++T T PFD               LL  +  +LA   N ++    + +  A+ 
Sbjct: 234 GGISGVISRTCTAPFDRLKVFLIARTDLSSILLNSKTDLLAKNPNADINKISSPLAKAVK 293

Query: 285 TIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYELT 320
           ++ +  G K +Y G   N+ KV P +++ +  +E+T
Sbjct: 294 SLYRQGGIKAFYVGNGLNVIKVFPESSIKFGSFEVT 329

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score =  147 bits (370), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 102/322 (31%), Positives = 157/322 (48%), Gaps = 46/322 (14%)

Query: 27  FLAGGIAGAISRTVVSPFERVKILLQVQS--STTAYNKG------------------LFD 66
           F+AGG +G ISRT  +PF+R+K+ L  ++  S+T  N                    L  
Sbjct: 199 FIAGGCSGVISRTCTAPFDRIKVFLIARTDLSSTLLNSKDKVLMKNPNADISKIKSPLIK 258

Query: 67  AIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQR 126
           A   +Y++  I+  + GNGLN I+VFP SA++F  FE  K+ + H++      +L+ +  
Sbjct: 259 AATTLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMAHLEGVHHTSELSKFST 318

Query: 127 LFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEE 186
             +G + G  +  + YP+D ++ R  VQ A L    K     I+    +++        +
Sbjct: 319 YIAGGMGGVVAQFSVYPIDTLKYR--VQCAPLDTALKGNELLISTARQMYR--------D 368

Query: 187 GGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEF----------MPSDENGNSSMRDSLY 236
           GG+   YRGV    +GI PY AL+   +  LK++          +P D+   S    +  
Sbjct: 369 GGLKLFYRGVTVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVDQVTIS----NFI 424

Query: 237 KLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYY 296
            L MGA SG V  T+ YP +LLR R Q  A G       Y    D L    + EG++G +
Sbjct: 425 VLPMGAFSGTVGATVVYPINLLRTRLQ--AQGTYAHPHTYTGFRDVLWKTVQREGYQGLF 482

Query: 297 KGLTANLFKVVPSTAVSWLVYE 318
           KGL  NL KV P+ ++S+L YE
Sbjct: 483 KGLVPNLAKVCPAVSISYLCYE 504

 Score = 78.6 bits (192), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 95/203 (46%), Gaps = 17/203 (8%)

Query: 26  AFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAY--NKGLFDAIGQVYKEENIKGLFRG 83
            ++AGG+ G +++  V P + +K  +Q     TA   N+ L     Q+Y++  +K  +RG
Sbjct: 318 TYIAGGMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNELLISTARQMYRDGGLKLFYRG 377

Query: 84  NGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKG---EQ--LNNWQRLFSGALCGGCSV 138
             +  + +FPY+A+    F   KK       K  G   +Q  ++N+  L  GA  G    
Sbjct: 378 VTVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVDQVTISNFIVLPMGAFSGTVGA 437

Query: 139 VATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWP 198
              YP++L+RTRL  Q       + +   D+     +WK + +      G  GL++G+ P
Sbjct: 438 TVVYPINLLRTRLQAQGTYAHPHTYTGFRDV-----LWKTVQRE-----GYQGLFKGLVP 487

Query: 199 TSLGIVPYVALNFAVYEQLKEFM 221
               + P V++++  YE  K  M
Sbjct: 488 NLAKVCPAVSISYLCYENFKRLM 510

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 43/95 (45%), Gaps = 16/95 (16%)

Query: 241 GAISGGVAQTITYPFD---------------LLRRRFQVLAMGGN-ELGFHYNSVWDALV 284
           G  SG +++T T PFD               LL  + +VL    N ++    + +  A  
Sbjct: 202 GGCSGVISRTCTAPFDRIKVFLIARTDLSSTLLNSKDKVLMKNPNADISKIKSPLIKAAT 261

Query: 285 TIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYEL 319
           T+ +  G + +Y G   N+ KV P +A+ +  +EL
Sbjct: 262 TLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFEL 296

>Scas_578.3*
          Length = 524

 Score =  144 bits (362), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 99/316 (31%), Positives = 154/316 (48%), Gaps = 36/316 (11%)

Query: 27  FLAGGIAGAISRTVVSPFERVKILLQVQS--STTAYN-------KGL---------FDAI 68
           F+AGG++G ISRT  +P +R+K+ L  ++  S+T  N       +GL           AI
Sbjct: 212 FIAGGLSGVISRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRIQGLNLAKIRSPIIKAI 271

Query: 69  GQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLF 128
             +Y++  ++  + GNGL+  ++ P S+++F  FE  K+ + ++        L+  Q   
Sbjct: 272 RSLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLMANLSGDKLVNDLSKLQTYV 331

Query: 129 SGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGG 188
           +G + G  + ++ YP+D ++ R  +Q A L    K  A  I+    ++K        EGG
Sbjct: 332 AGGIAGVMAQISIYPIDTLKFR--IQCAPLEGNLKGNALLISTAKEMYK--------EGG 381

Query: 189 IMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENG------NSSMRDSLYKLSMGA 242
           I   YRGV   +LGI PY AL+   +  LK++    ++          M   L  L MGA
Sbjct: 382 IRVFYRGVLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVMLSYLLVLPMGA 441

Query: 243 ISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTAN 302
            SG V  T  YP +LLR R Q  A G     + Y    D  +   K EG  G+YKGL   
Sbjct: 442 FSGTVGATAVYPINLLRTRLQ--AQGTYAHPYTYTGFRDVFMQTLKREGVPGFYKGLVPT 499

Query: 303 LFKVVPSTAVSWLVYE 318
           L KV P+ ++ +L YE
Sbjct: 500 LVKVCPAVSIGYLCYE 515

 Score = 76.3 bits (186), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 91/202 (45%), Gaps = 17/202 (8%)

Query: 27  FLAGGIAGAISRTVVSPFERVKILLQVQ--SSTTAYNKGLFDAIGQVYKEENIKGLFRGN 84
           ++AGGIAG +++  + P + +K  +Q          N  L     ++YKE  I+  +RG 
Sbjct: 330 YVAGGIAGVMAQISIYPIDTLKFRIQCAPLEGNLKGNALLISTAKEMYKEGGIRVFYRGV 389

Query: 85  GLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKG-----KGEQLNNWQRLFSGALCGGCSVV 139
            L  + +FPY+A+    F   KK      +K      K   L+    L  GA  G     
Sbjct: 390 LLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVMLSYLLVLPMGAFSGTVGAT 449

Query: 140 ATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPT 199
           A YP++L+RTRL  Q       + +   D+       + L +      G+ G Y+G+ PT
Sbjct: 450 AVYPINLLRTRLQAQGTYAHPYTYTGFRDV-----FMQTLKRE-----GVPGFYKGLVPT 499

Query: 200 SLGIVPYVALNFAVYEQLKEFM 221
            + + P V++ +  YE+ K  M
Sbjct: 500 LVKVCPAVSIGYLCYEKFKAAM 521

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 43/94 (45%), Gaps = 16/94 (17%)

Query: 241 GAISGGVAQTITYPFD---------------LLRRRFQVLAMGGNELGFHYNSVWDALVT 285
           G +SG +++T T P D               LL  +  +   G N L    + +  A+ +
Sbjct: 215 GGLSGVISRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRIQGLN-LAKIRSPIIKAIRS 273

Query: 286 IGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYEL 319
           + +  G + +Y G   ++FK+ P +++ +  +EL
Sbjct: 274 LYRQGGLRAFYVGNGLSVFKICPESSIKFGTFEL 307

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score =  131 bits (329), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 93/309 (30%), Positives = 143/309 (46%), Gaps = 38/309 (12%)

Query: 36  ISRTVVSPFERVKILLQVQSSTTA--------------------YNKGLFDAIGQVYKEE 75
           +SRT  +PF+R+K+ L  ++  ++                        L  A   +Y++ 
Sbjct: 188 VSRTCTAPFDRIKVFLIARTDLSSPLLHTPEQLLHHNPRADPAKIRSPLVKAATSLYRQG 247

Query: 76  NIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGG 135
            ++  + GNGLN I+VFP SA++F  FE  K+ +  ++  G+  +L+      +G L G 
Sbjct: 248 GLRAFYLGNGLNVIKVFPESAMKFGSFELAKRVLAGLEGCGETGELSRLSTYVAGGLGGI 307

Query: 136 CSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRG 195
            +  + YP+D ++ R  +Q A L    +         P + K     Y  EGG+   YRG
Sbjct: 308 MAQFSVYPIDTLKFR--IQCAPLDTRCRGL-------PLLIKTAKDMY-REGGLRLFYRG 357

Query: 196 VWPTSLGIVPYVALNFAVYEQLKE-FMPSDENG-----NSSMRDSLYKLSMGAISGGVAQ 249
           +    LG+ PY AL+   +  LK  ++    N      N  +  +L  L MGA SG V  
Sbjct: 358 LGVGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAFSGTVGA 417

Query: 250 TITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPS 309
           T+ YP +LLR R Q  A G       Y+   D      + EG  G YKGL   L KV P+
Sbjct: 418 TVVYPINLLRTRLQ--AQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLVPTLAKVCPA 475

Query: 310 TAVSWLVYE 318
            A+S+L YE
Sbjct: 476 VAISYLCYE 484

 Score = 72.4 bits (176), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 92/203 (45%), Gaps = 19/203 (9%)

Query: 27  FLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGL---FDAIGQVYKEENIKGLFRG 83
           ++AGG+ G +++  V P + +K  +Q     T   +GL         +Y+E  ++  +RG
Sbjct: 299 YVAGGLGGIMAQFSVYPIDTLKFRIQCAPLDTR-CRGLPLLIKTAKDMYREGGLRLFYRG 357

Query: 84  NGLNCIRVFPYSAVQFVVFEGCKKHIF--HVDTKGKGEQ---LNNWQRLFSGALCGGCSV 138
            G+  + VFPY+A+    F   K+       +  G  E    ++N   L  GA  G    
Sbjct: 358 LGVGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAFSGTVGA 417

Query: 139 VATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWP 198
              YP++L+RTRL  Q            +   +  G   +  K    EG + GLY+G+ P
Sbjct: 418 TVVYPINLLRTRLQAQGTY---------AHPHRYDGFQDVFRKTVQREG-LPGLYKGLVP 467

Query: 199 TSLGIVPYVALNFAVYEQLKEFM 221
           T   + P VA+++  YE LK  M
Sbjct: 468 TLAKVCPAVAISYLCYENLKRAM 490

 Score = 29.6 bits (65), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 39/93 (41%), Gaps = 24/93 (25%)

Query: 247 VAQTITYPFDLLRRRFQVLAMGGNELG----------FHYNSVWD----------ALVTI 286
           V++T T PFD    R +V  +   +L            H+N   D          A  ++
Sbjct: 188 VSRTCTAPFD----RIKVFLIARTDLSSPLLHTPEQLLHHNPRADPAKIRSPLVKAATSL 243

Query: 287 GKTEGFKGYYKGLTANLFKVVPSTAVSWLVYEL 319
            +  G + +Y G   N+ KV P +A+ +  +EL
Sbjct: 244 YRQGGLRAFYLGNGLNVIKVFPESAMKFGSFEL 276

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score =  125 bits (315), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 98/322 (30%), Positives = 150/322 (46%), Gaps = 31/322 (9%)

Query: 6   LPAIEEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQ------VQSSTTA 59
           +   E + Q  +F      V FL GG++ AI++T  +P ERVK+L+Q       Q S   
Sbjct: 1   MSHTETQTQQSHF-----GVDFLMGGVSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDT 55

Query: 60  YNKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGE 119
             KG+ D   +    E I   +RGN  N +R FP  A+ F  F+   K +   D +  G 
Sbjct: 56  RYKGILDCFKRTATHEGIVSFWRGNTANVLRYFPTQALNF-AFKDKIKSLLSYDRERDGY 114

Query: 120 QLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLL 179
                  LFSG   GG S++  Y LD  RTRL+           S+++   +  G+  + 
Sbjct: 115 AKWFAGNLFSGGAAGGLSLLFVYSLDYARTRLAADARG------SKSTSQRQFNGLLDVY 168

Query: 180 SKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSL--YK 237
            K    + G++GLYRG  P+ LGI+ Y  L F +Y+  K  + +     S +   L  + 
Sbjct: 169 KKTLKTD-GLLGLYRGFVPSVLGIIVYRGLYFGLYDSFKPVLLTGALEGSFVASFLLGWV 227

Query: 238 LSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYK 297
           ++MG      A T +YP D +RRR  ++   G  +   Y+   D L  I + EG    +K
Sbjct: 228 ITMG------ASTASYPLDTVRRR--MMMTSGQTI--KYDGALDCLRKIVQKEGAYSLFK 277

Query: 298 GLTANLFKVVPSTAVSWLVYEL 319
           G  AN+F+ V +  V  L  +L
Sbjct: 278 GCGANIFRGVAAAGVISLYDQL 299

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score =  124 bits (312), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 102/321 (31%), Positives = 157/321 (48%), Gaps = 39/321 (12%)

Query: 11  EENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQ-------SSTTAYNKG 63
            +N+  NFL     + F+ GG++ A+S+T  +P ERVK+L+Q Q       S    YN G
Sbjct: 2   SDNKQSNFL-----INFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKQGSLDRRYN-G 55

Query: 64  LFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNN 123
           + D   +    E +   +RGN  N IR FP  A+ F  F+   K +F     G  ++++ 
Sbjct: 56  IVDCFKRTAASEGVISFWRGNTANVIRYFPTQALNFA-FKDKIKAMF-----GFRKEVDG 109

Query: 124 WQRLFSGALC-----GGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKL 178
           + + F+G L      GG S++  Y LD  RTRL+  + +  K  + + +      G+  +
Sbjct: 110 YAKWFAGNLASGGAAGGLSLLFVYSLDYARTRLAADSKSAKKGGERQFN------GLVDV 163

Query: 179 LSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKL 238
             K  A +G I GLYRG  P+ +GIV Y  L F +Y+ LK  + +  N  SS   S + L
Sbjct: 164 YKKTLASDG-IAGLYRGFLPSVVGIVVYRGLYFGMYDSLKPLLLTG-NLESSFIAS-FLL 220

Query: 239 SMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKG 298
                +G  A T +YP D +RRR  ++   G  +   Y+  +DA   I   EG K  +KG
Sbjct: 221 GWAVTTG--ASTASYPLDTVRRR--MMMTSGQAV--KYDGAFDAFRKIVAAEGVKSLFKG 274

Query: 299 LTANLFKVVPSTAVSWLVYEL 319
             AN+ + V    V  L  +L
Sbjct: 275 CGANILRGVAGAGVISLYDQL 295

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score =  129 bits (325), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 98/306 (32%), Positives = 152/306 (49%), Gaps = 33/306 (10%)

Query: 22  DTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLF 81
           D+   F  G IAG I  TVV P + +K  +Q Q S   Y K   D + ++   E IKGL+
Sbjct: 529 DSLYNFSLGSIAGCIGATVVYPIDFIKTRMQAQRSLAQY-KNSIDCLLKIISREGIKGLY 587

Query: 82  RGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVAT 141
            G G   I V P  A++  V +  +  +   D  GK   L+ +  + SGA  G C V+ T
Sbjct: 588 SGLGPQLIGVAPEKAIKLTVNDFMRNRL--TDKNGK---LSLFPEIISGASAGACQVIFT 642

Query: 142 YPLDLVRTRLSVQT----ANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVW 197
            PL++V+ RL VQ+     N+ + +++ A+ I K     KL         G+ GLY GV 
Sbjct: 643 NPLEIVKIRLQVQSDYVGENIQQANET-ATQIVK-----KL---------GLRGLYNGVA 687

Query: 198 PTSLGIVPYVALNFAVYEQLK----EFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITY 253
              +  VP+ A+ F  Y  LK    +F P+D+   + ++ +   L+ GAI+G  A  +T 
Sbjct: 688 ACLMRDVPFSAIYFPTYAHLKKDLFDFDPNDKTKRNRLK-TWELLTAGAIAGMPAAFLTT 746

Query: 254 PFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVS 313
           PFD+++ R Q+    G      YN ++ A+ TI K E F+ ++KG  A + +  P    +
Sbjct: 747 PFDVIKTRLQIDPRKGET---KYNGIFHAIRTILKEESFRSFFKGGGARVLRSSPQFGFT 803

Query: 314 WLVYEL 319
              YEL
Sbjct: 804 LAAYEL 809

 Score = 81.6 bits (200), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 91/202 (45%), Gaps = 14/202 (6%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYN-KGLFDAIGQVYKEENIKGLFRGNGL 86
           ++G  AGA      +P E VKI LQVQS     N +   +   Q+ K+  ++GL+ G   
Sbjct: 629 ISGASAGACQVIFTNPLEIVKIRLQVQSDYVGENIQQANETATQIVKKLGLRGLYNGVAA 688

Query: 87  NCIRVFPYSAVQFVVFEGCKKHIFHVD--TKGKGEQLNNWQRLFSGALCGGCSVVATYPL 144
             +R  P+SA+ F  +   KK +F  D   K K  +L  W+ L +GA+ G  +   T P 
Sbjct: 689 CLMRDVPFSAIYFPTYAHLKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPF 748

Query: 145 DLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIV 204
           D+++TRL +           R  +  K  G++  +     EE      ++G     L   
Sbjct: 749 DVIKTRLQID---------PRKGE-TKYNGIFHAIRTILKEES-FRSFFKGGGARVLRSS 797

Query: 205 PYVALNFAVYEQLKEFMPSDEN 226
           P      A YE  K F+PS +N
Sbjct: 798 PQFGFTLAAYELFKGFIPSPDN 819

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 46/94 (48%), Gaps = 3/94 (3%)

Query: 29  AGGIAGAISRTVVSPFERVKILLQV--QSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGL 86
           AG IAG  +  + +PF+ +K  LQ+  +   T YN G+F AI  + KEE+ +  F+G G 
Sbjct: 733 AGAIAGMPAAFLTTPFDVIKTRLQIDPRKGETKYN-GIFHAIRTILKEESFRSFFKGGGA 791

Query: 87  NCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQ 120
             +R  P        +E  K  I   D K K  +
Sbjct: 792 RVLRSSPQFGFTLAAYELFKGFIPSPDNKLKSRE 825

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score =  124 bits (310), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 100/303 (33%), Positives = 142/303 (46%), Gaps = 29/303 (9%)

Query: 20  KQDTNVA--FLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYN------KGLFDAIGQV 71
           +Q+TN A  FL GG++ AI++T  SP ERVKIL+Q Q              G+ D   + 
Sbjct: 7   QQETNFAINFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIVDCFKRT 66

Query: 72  YKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNW--QRLFS 129
            K+E +   +RGN  N IR FP  A+ F  F+   K +F      K E    W    L S
Sbjct: 67  AKQEGLISFWRGNTANVIRYFPTQALNF-AFKDKIKLMFGFK---KEEGYGKWFAGNLAS 122

Query: 130 GALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGI 189
           G   G  S++  Y LD  RTRL+   A  SK   +R  +     G+  +  K    + GI
Sbjct: 123 GGAAGALSLLFVYSLDFARTRLAAD-AKSSKKGGARQFN-----GLTDVYKKTLKSD-GI 175

Query: 190 MGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQ 249
            GLYRG  P+ +GIV Y  L F +++ LK  + +     S +   L    +G +    A 
Sbjct: 176 AGLYRGFMPSVVGIVVYRGLYFGMFDSLKPLVLTGSLDGSFLASFL----LGWVVTTGAS 231

Query: 250 TITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPS 309
           T +YP D +RRR  ++   G  +   YN   D L  I  +EG    +KG  AN+ + V  
Sbjct: 232 TCSYPLDTVRRR--MMMTSGQAV--KYNGAIDCLKKIVASEGVGSLFKGCGANILRSVAG 287

Query: 310 TAV 312
             V
Sbjct: 288 AGV 290

 Score = 35.4 bits (80), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 41/79 (51%), Gaps = 6/79 (7%)

Query: 240 MGAISGGVAQTITYPFD----LLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGY 295
           MG +S  +A+T   P +    L++ + +++  G   L   Y+ + D      K EG   +
Sbjct: 18  MGGVSAAIAKTAASPIERVKILIQNQDEMIKQG--TLDKKYSGIVDCFKRTAKQEGLISF 75

Query: 296 YKGLTANLFKVVPSTAVSW 314
           ++G TAN+ +  P+ A+++
Sbjct: 76  WRGNTANVIRYFPTQALNF 94

>Kwal_27.12481
          Length = 304

 Score =  124 bits (310), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 102/305 (33%), Positives = 144/305 (47%), Gaps = 33/305 (10%)

Query: 20  KQDTNVA--FLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFD----AIGQVYK 73
           K+ +N A  FL GG++ A+S+T  +P ERVK+L+Q Q       +G  D     IG+ +K
Sbjct: 5   KKQSNFAVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMI--KQGSLDRRYTGIGECFK 62

Query: 74  E----ENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNW--QRL 127
                E I   +RGN  N IR FP  A+ F  F+   K +F      K E    W    L
Sbjct: 63  RTAANEGIASFWRGNTANVIRYFPTQALNF-AFKDKIKAMFGFK---KEEGYAKWFAGNL 118

Query: 128 FSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEG 187
            SG   GG S++  Y LD  RTRL+  +    K  + + +      G+  +  K  A + 
Sbjct: 119 ASGGAAGGLSLMFVYSLDYARTRLAADSKGAKKGGERQFN------GLVDVYKKTLASD- 171

Query: 188 GIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGV 247
           GI GLYRG  P+ +GIV Y  L F  Y+ LK  + +     S +   L  L     +G  
Sbjct: 172 GIAGLYRGFLPSVVGIVVYRGLYFGGYDSLKPLLLTGSLEGSFLASFL--LGWAVTTG-- 227

Query: 248 AQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVV 307
           A T +YP D +RRR  + +  G  +   YN  +DA   I   EG K  +KG  AN+ + V
Sbjct: 228 ASTASYPLDTVRRRMMMTS--GQAV--KYNGAFDAFRKIVAAEGIKSLFKGCGANILRGV 283

Query: 308 PSTAV 312
               V
Sbjct: 284 AGAGV 288

 Score = 31.6 bits (70), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 18/79 (22%), Positives = 39/79 (49%), Gaps = 6/79 (7%)

Query: 240 MGAISGGVAQTITYPFD----LLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGY 295
           MG +S  V++T   P +    L++ + +++  G   L   Y  + +        EG   +
Sbjct: 16  MGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQG--SLDRRYTGIGECFKRTAANEGIASF 73

Query: 296 YKGLTANLFKVVPSTAVSW 314
           ++G TAN+ +  P+ A+++
Sbjct: 74  WRGNTANVIRYFPTQALNF 92

>Scas_667.4
          Length = 308

 Score =  123 bits (308), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 102/308 (33%), Positives = 149/308 (48%), Gaps = 31/308 (10%)

Query: 16  KNFLKQDTNVA--FLAGGIAGAISRTVVSPFERVKILLQ------VQSSTTAYNKGLFDA 67
           K  +K+++N A  FL GG++ A+++T  SP ERVK+L+Q       Q S  +  KG+ + 
Sbjct: 4   KEEVKKESNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDSKYKGIIEC 63

Query: 68  IGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNW--Q 125
             +  K E I   +RGN  N IR FP  A+ F  F+   K +F      K E    W   
Sbjct: 64  FQRTAKTEGIIAFWRGNTANVIRYFPTQALNF-AFKDKIKAMFGFK---KEEGYGKWFAG 119

Query: 126 RLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAE 185
            L SG   GG S++  Y LD  RTRL+   A  SK   SR     +  G+  +  +  A 
Sbjct: 120 NLASGGAAGGLSLLFVYSLDYARTRLAAD-AKSSKKGGSR-----QYKGLIDVYKQTLAT 173

Query: 186 EGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDS-LYKLSMGAIS 244
           + G+ GLYRG  P+ +GI+ Y  L F +Y+ LK   P+   G  S+  S L    +G I 
Sbjct: 174 D-GMAGLYRGFLPSVVGIIVYRGLYFGLYDSLK---PAVLTG--SLEGSFLASFLLGWIV 227

Query: 245 GGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLF 304
              A T +YP D +RRR  ++   G  +   Y+  +D    +   EG    +KG  AN+ 
Sbjct: 228 TTGASTASYPLDTVRRR--MMMTSGQAV--KYDGAFDCFRKVVAAEGVSSLFKGCGANIL 283

Query: 305 KVVPSTAV 312
           + V    V
Sbjct: 284 RGVAGAGV 291

 Score = 36.2 bits (82), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 41/79 (51%), Gaps = 6/79 (7%)

Query: 240 MGAISGGVAQTITYPFD----LLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGY 295
           MG +S  VA+T   P +    L++ + +++  G   L   Y  + +      KTEG   +
Sbjct: 19  MGGVSAAVAKTAASPIERVKLLIQNQDEMIKQG--SLDSKYKGIIECFQRTAKTEGIIAF 76

Query: 296 YKGLTANLFKVVPSTAVSW 314
           ++G TAN+ +  P+ A+++
Sbjct: 77  WRGNTANVIRYFPTQALNF 95

>Scas_602.8
          Length = 885

 Score =  128 bits (321), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 98/305 (32%), Positives = 150/305 (49%), Gaps = 31/305 (10%)

Query: 22  DTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLF 81
           D+   F  G +AG I  T+V P + +K  +Q Q S T Y K   D + +++ +E I+GL+
Sbjct: 497 DSIFNFSLGSVAGCIGATLVYPIDFIKTRMQAQRSLTKY-KNSIDCLVKIFGKEGIRGLY 555

Query: 82  RGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVAT 141
            G G   I V P  A++  V +  +K +  VD KG    L     + SGA  G C VV T
Sbjct: 556 SGLGPQLIGVAPEKAIKLTVNDFMRKSL--VDKKG---NLQLGAEVLSGATAGACQVVFT 610

Query: 142 YPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSL 201
            PL++V+ RL V         KS  ++   P    +L +    +E  ++GLY+GV    L
Sbjct: 611 NPLEIVKIRLQV---------KSEYTNAMIPKS--QLTAFQIIKELKLIGLYKGVGACLL 659

Query: 202 GIVPYVALNFAVYEQLK----EFMPSDENGNSSMRDSLYK---LSMGAISGGVAQTITYP 254
             VP+ A+ F  Y  LK    +F P+D++     RD L     L+ GA++G  A  +T P
Sbjct: 660 RDVPFSAIYFPTYAHLKKNVFQFDPNDKDK----RDRLKTWELLTAGALAGVPAAFLTTP 715

Query: 255 FDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSW 314
           FD+++ R Q+    G      Y  +  A+ TI K E F+ ++KG  A + +  P    + 
Sbjct: 716 FDVIKTRLQIEPGVGET---RYTGILHAVRTILKEESFRSFFKGGAARVMRSSPQFGFTL 772

Query: 315 LVYEL 319
             YEL
Sbjct: 773 AAYEL 777

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score =  127 bits (318), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 89/302 (29%), Positives = 148/302 (49%), Gaps = 26/302 (8%)

Query: 22  DTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLF 81
           D+   F  G +AG I   VV P + VK  +Q Q   + Y K   D + ++  +E ++GL+
Sbjct: 523 DSIYNFTLGSVAGCIGAMVVYPIDMVKTRMQAQRDFSKY-KNSIDCLLKILSKEGVRGLY 581

Query: 82  RGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVAT 141
            G G   I V P  A++  V +  +  +      G+  +L+    + SGA  G C VV T
Sbjct: 582 SGLGPQLIGVAPEKAIKLTVNDHMRATL-----AGRDGKLSLPCEIISGATAGACQVVFT 636

Query: 142 YPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSL 201
            PL++V+ RL V++  ++  +++  + I+    V K L        G++GLYRG     L
Sbjct: 637 NPLEIVKIRLQVKSDYVADAARNSVNAIS----VIKNL--------GLIGLYRGAGACLL 684

Query: 202 GIVPYVALNFAVYEQLK----EFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDL 257
             +P+ A+ F  Y  +K     F P D +  + + ++   L  G ++G  A  +T PFD+
Sbjct: 685 RDIPFSAIYFPTYAHIKSNVFNFDPKDSDKRNKL-NTWQLLVSGGLAGMPAAFLTTPFDV 743

Query: 258 LRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVY 317
           ++ R Q+    G  +   YN +WDA  TI K EG K ++KG  A + +  P    +   Y
Sbjct: 744 IKTRLQIDPKKGESV---YNGIWDAARTILKEEGIKSFFKGGPARVLRSSPQFGFTLAAY 800

Query: 318 EL 319
           E+
Sbjct: 801 EI 802

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score =  122 bits (305), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 98/303 (32%), Positives = 141/303 (46%), Gaps = 27/303 (8%)

Query: 25  VAFLAGGIAGAISRTVVSPFERVKILLQ------VQSSTTAYNKGLFDAIGQVYKEENIK 78
           + FL GG++ A+++T  SP ERVK+L+Q       Q S     KG+ D   +  ++E I 
Sbjct: 13  IDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDHRYKGIVDCFQRTARQEGII 72

Query: 79  GLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNW--QRLFSGALCGGC 136
             +RGN  N IR FP  A+ F  F+   K +F      K E    W    L SG + GG 
Sbjct: 73  SFWRGNTANVIRYFPTQALNF-AFKDQIKAMFGFK---KEEGYAKWFAGNLASGGIAGGL 128

Query: 137 SVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGV 196
           S++  Y LD  RTRL+   A  SK    R  +     G+  +  K  A + G+ GLYRG 
Sbjct: 129 SLMFVYSLDYARTRLAAD-AKSSKKGGERQFN-----GLVDVYKKTIASD-GVAGLYRGF 181

Query: 197 WPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFD 256
            P+ +GIV Y  L F +Y+  K  + +     S +   L    +G +    A T +YP D
Sbjct: 182 LPSVIGIVVYRGLYFGLYDSCKPLLLTGSLEGSFIASFL----LGWVVTTGASTASYPLD 237

Query: 257 LLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLV 316
            +RRR  ++   G  +   Y    D L  I   EG    +KG  AN+ + V    V  L 
Sbjct: 238 TVRRR--MMMTSGQAV--KYKGAMDCLQKIVAAEGVSSLFKGCGANILRGVAGAGVISLY 293

Query: 317 YEL 319
            +L
Sbjct: 294 DQL 296

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score =  126 bits (316), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 97/321 (30%), Positives = 150/321 (46%), Gaps = 28/321 (8%)

Query: 6   LPAIEEENQLKNFLKQ---DTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNK 62
           L  IEEE+   N+      D+   F  G +AG I  T+V P + VK  +Q Q S + Y K
Sbjct: 523 LRHIEEESLYTNYYFYPIFDSLYNFSLGSVAGCIGATIVYPIDFVKTRMQAQRSLSQY-K 581

Query: 63  GLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLN 122
              D   ++   E I+G++ G G   I V P  A++  V +  +  +     K K  +L 
Sbjct: 582 NSIDCFLKILSREGIRGVYSGLGPQLIGVAPEKAIKLTVNDYMRNKL-----KDKNGKLG 636

Query: 123 NWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKA 182
               + SGA  G C V+ T PL++V+ RL V           +   +A+     KL +  
Sbjct: 637 LLSEIISGASAGACQVIFTNPLEIVKIRLQV-----------KGEYVAENAENAKLTALQ 685

Query: 183 YAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKE----FMPSDENGNSSMRDSLYKL 238
             +  G+ GLY+G     L  VP+ A+ F  Y  LK     F P+D+N  S + ++   L
Sbjct: 686 IIKRLGLPGLYKGAAACLLRDVPFSAIYFPTYAHLKRDLFNFDPNDKNKRSRL-NTWELL 744

Query: 239 SMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKG 298
           S GA++G  A  +T PFD+++ R Q+    G  +   Y  +  A  TI + E FK ++KG
Sbjct: 745 SAGALAGMPAAYLTTPFDVIKTRLQIDPKKGETI---YKGIIHAARTILREESFKSFFKG 801

Query: 299 LTANLFKVVPSTAVSWLVYEL 319
             A + +  P    +   YEL
Sbjct: 802 GAARVLRSSPQFGFTLAAYEL 822

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score =  125 bits (315), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 91/302 (30%), Positives = 145/302 (48%), Gaps = 26/302 (8%)

Query: 22  DTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLF 81
           D+   F  G IAG I  TVV P + VK  +Q Q S + Y K   D   +++  E I+G++
Sbjct: 517 DSIYNFTLGSIAGCIGATVVYPIDLVKTRMQAQRSFSQY-KNSIDCFAKIFSREGIRGIY 575

Query: 82  RGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVAT 141
            G G   I V P  A++  V +  +  +       K   L  +  + SGA  G C VV T
Sbjct: 576 SGLGPQLIGVAPEKAIKLTVNDYMRGRLM-----DKHANLKWYFEILSGACAGACQVVFT 630

Query: 142 YPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSL 201
            PL++V+ RL V++     + KS+ + +    GV K L        GI GLY+G+    +
Sbjct: 631 NPLEVVKIRLQVRSEYAGDVLKSQVTAL----GVIKQL--------GIKGLYKGIAACLM 678

Query: 202 GIVPYVALNFAVYEQLK----EFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDL 257
             VP+ A+ F  Y  LK    ++ P D+   + ++ +   L  G ++G  A  +T PFD+
Sbjct: 679 RDVPFSAIYFPTYAHLKKDVFKYDPKDKKQRNKLK-TWELLVAGGLAGMPAAYLTTPFDV 737

Query: 258 LRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVY 317
           ++ R Q+    G      Y  ++ A  TI K E FK ++KG +A + +  P    +   Y
Sbjct: 738 IKTRLQIDPRKGET---RYEGIFHAARTILKEESFKSFFKGGSARVLRSSPQFGFTLAAY 794

Query: 318 EL 319
           E+
Sbjct: 795 EI 796

>Scas_718.24
          Length = 337

 Score =  118 bits (295), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 94/311 (30%), Positives = 145/311 (46%), Gaps = 27/311 (8%)

Query: 11  EENQLKNFLKQDTNVA--FLAGGIAGAISRTVVSPFERVKILLQVQSST-------TAYN 61
           + N + +  K  +N A  FL GG++ A+++T  SP ERVK+L+Q Q+         T Y 
Sbjct: 28  QSNTIMSTEKPQSNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQNEMLKQGTLDTKY- 86

Query: 62  KGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQL 121
           KG+ D   +  ++E I   +RGN  N IR FP  A+ F   +  K         G G+  
Sbjct: 87  KGIVDCFRRTAQQEGIISFWRGNTANVIRYFPTQALNFAFKDKIKLMFGFKKEDGYGKWF 146

Query: 122 NNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSK 181
                L SG   GG S++  Y LD  RTRL+  + + SK   SR  +     G+  +  K
Sbjct: 147 AG--NLASGGAAGGLSLLFVYSLDFARTRLAADSKS-SKKGGSRQFN-----GLIDVYKK 198

Query: 182 AYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMG 241
               + G+ GLYRG  P+ +GI+ Y  L F +Y+ +K  + +     S +   L    +G
Sbjct: 199 TLKSD-GVAGLYRGFLPSVVGIIVYRGLYFGLYDSIKPVLLTGSLEGSFLASFL----LG 253

Query: 242 AISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTA 301
            +    A T +YP D +RR+  ++   G  +   Y   +D    I   EG    +KG  A
Sbjct: 254 WVVTTGASTCSYPLDTVRRK--MMMTSGQAV--KYKGAFDCFKKIVAAEGVASLFKGCGA 309

Query: 302 NLFKVVPSTAV 312
           N+ + V    V
Sbjct: 310 NILRGVAGAGV 320

 Score = 35.4 bits (80), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 40/79 (50%), Gaps = 6/79 (7%)

Query: 240 MGAISGGVAQTITYPFD----LLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGY 295
           MG +S  VA+T   P +    L++ + ++L  G   L   Y  + D      + EG   +
Sbjct: 48  MGGVSAAVAKTAASPIERVKLLIQNQNEMLKQG--TLDTKYKGIVDCFRRTAQQEGIISF 105

Query: 296 YKGLTANLFKVVPSTAVSW 314
           ++G TAN+ +  P+ A+++
Sbjct: 106 WRGNTANVIRYFPTQALNF 124

>Kwal_47.17321
          Length = 881

 Score =  122 bits (305), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 88/302 (29%), Positives = 144/302 (47%), Gaps = 26/302 (8%)

Query: 22  DTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLF 81
           D+   FL G +AG I  T V P + VK  +Q Q + + Y K   D   +++  E I+G++
Sbjct: 499 DSIYNFLLGSVAGCIGATAVYPIDLVKTRMQAQRNFSQY-KNSIDCFVKIFSREGIRGIY 557

Query: 82  RGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVAT 141
            G G   + V P  A++  V +  +K +       +  +L     + SGA  G C V+ T
Sbjct: 558 SGLGPQLVGVAPEKAIKLTVNDYVRKLLM-----DENNRLTLPLEIISGAAAGACQVIFT 612

Query: 142 YPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSL 201
            PL++V+ RL V++     L KS+ + +    GV K L        G+ GLY+G+    +
Sbjct: 613 NPLEIVKIRLQVRSEYADSLPKSQLTAL----GVVKSL--------GLRGLYKGLVACLM 660

Query: 202 GIVPYVALNFAVYEQLKE----FMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDL 257
             VP+ A+ F  Y  LK     + P D+N  + +  +   L+ G ++G  A  +T PFD+
Sbjct: 661 RDVPFSAIYFPTYAHLKRDIFNYDPQDKNKRARLH-TWELLTAGGLAGMPAAYLTTPFDV 719

Query: 258 LRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVY 317
           ++ R Q+    G      Y  +  A  TI K E FK ++KG  A + +  P    +   Y
Sbjct: 720 IKTRLQIDPRKGET---RYTGILHAARTILKEERFKSFFKGGGARVLRSSPQFGFTLAAY 776

Query: 318 EL 319
           E+
Sbjct: 777 EI 778

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score =  118 bits (296), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 88/318 (27%), Positives = 152/318 (47%), Gaps = 33/318 (10%)

Query: 12  ENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQ-----SSTTAYNKGLFD 66
            N L  F   D  +  ++G +AG +S  VV P +  K  LQ Q     ++   Y +G   
Sbjct: 57  RNTLFGFTLNDNRINAISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIG 116

Query: 67  AIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQR 126
            +  + ++E ++GL++G     +  FP   + F V+E CK ++            +NW  
Sbjct: 117 TMTTIVRDEGVRGLYKGLVPIIMGYFPTWMIYFSVYEFCKDNL--------RTNSSNWSF 168

Query: 127 L---FSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAY 183
           +   FS    G  S V T P+ +V+TRL +QT           S+     G +    K  
Sbjct: 169 VSHSFSAITAGAVSTVVTNPIWVVKTRLMLQT--------HIGSNTTHYQGTYDAFKKII 220

Query: 184 AEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLK---EFMPSDENGNSSMRDSLYKLSM 240
            +E G+  LY G+ P+ LG++ +VA++F VYE+LK   +    DE+ N S  +    +  
Sbjct: 221 NQE-GVKALYAGLVPSLLGLL-HVAIHFPVYERLKVSFKCYQRDESSNESKINLKRLILA 278

Query: 241 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLT 300
            ++S  VA  ++YP ++LR R Q+     ++L  H   +   +      EG  G+Y G  
Sbjct: 279 SSVSKMVASVLSYPHEILRTRLQL----KSDLPSHQRRLIPLIKITYIQEGIFGFYSGFG 334

Query: 301 ANLFKVVPSTAVSWLVYE 318
            NLF+ +P++A++ + +E
Sbjct: 335 TNLFRTLPASAITLVSFE 352

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 45/94 (47%), Gaps = 4/94 (4%)

Query: 10  EEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIG 69
           E  N+ K  LK+      LA  ++  ++  +  P E ++  LQ++S   ++ + L   I 
Sbjct: 263 ESSNESKINLKR----LILASSVSKMVASVLSYPHEILRTRLQLKSDLPSHQRRLIPLIK 318

Query: 70  QVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFE 103
             Y +E I G + G G N  R  P SA+  V FE
Sbjct: 319 ITYIQEGIFGFYSGFGTNLFRTLPASAITLVSFE 352

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 42/94 (44%), Gaps = 1/94 (1%)

Query: 230 SMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNEL-GFHYNSVWDALVTIGK 288
           ++ D+      GA++G ++  +  P D+ + R Q   +        +Y      + TI +
Sbjct: 64  TLNDNRINAISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVR 123

Query: 289 TEGFKGYYKGLTANLFKVVPSTAVSWLVYELTWD 322
            EG +G YKGL   +    P+  + + VYE   D
Sbjct: 124 DEGVRGLYKGLVPIIMGYFPTWMIYFSVYEFCKD 157

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score =  121 bits (303), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 87/302 (28%), Positives = 147/302 (48%), Gaps = 26/302 (8%)

Query: 22  DTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLF 81
           D+   F  G IAG I  TVV P + VK  +Q Q ++  Y K   D + ++++ + I+GL+
Sbjct: 503 DSIHNFTLGSIAGCIGATVVYPIDLVKTRMQAQRNSVQY-KNSIDCVVKIFQTKGIRGLY 561

Query: 82  RGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVAT 141
            G G   I V P  A++  V +  +++        K   +  +Q + SGA  G C VV T
Sbjct: 562 SGLGPQLIGVAPEKAIKLTVNDFMRQYFM-----NKSRTIKWYQEILSGATAGACQVVFT 616

Query: 142 YPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSL 201
            PL++V+ RL +++  + + ++ +   +    G+ + L        G+ GLY+G     L
Sbjct: 617 NPLEIVKIRLQMRSDYVGENARPQLGAV----GIIRQL--------GLRGLYKGAAACLL 664

Query: 202 GIVPYVALNFAVYEQLKE----FMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDL 257
             VP+ A+ F  Y  LK+    F P+D+N  + ++ +   L  G I+G  A  +T PFD+
Sbjct: 665 RDVPFSAIYFPTYAHLKKDVFNFDPNDKNKRNKLK-TWELLLAGGIAGMPAAYLTTPFDV 723

Query: 258 LRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVY 317
           ++ R Q+    G      Y  V  A  TI K E  K ++KG  A + +  P    +   +
Sbjct: 724 IKTRLQIDPRKGETT---YTGVIHAARTILKEESIKSFFKGGPARVLRSSPQFGFTLAAF 780

Query: 318 EL 319
           E+
Sbjct: 781 EM 782

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score =  117 bits (293), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 94/315 (29%), Positives = 149/315 (47%), Gaps = 29/315 (9%)

Query: 13  NQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQ-----SSTTAYNKGLFDA 67
           N+LK     D  VA ++G ++GA+S  +V PF+  K  LQ Q     +  + + KG F  
Sbjct: 30  NRLKK--NADPRVAAISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGT 87

Query: 68  IGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRL 127
              ++K+E   GL++G     +   P   + F V++ C+K  + VD       L+N    
Sbjct: 88  FATIFKDEGAAGLYKGLQPTVLGYIPTLMIYFSVYDFCRK--YSVDIFPHSPFLSNAS-- 143

Query: 128 FSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEG 187
            S    G  S VAT P+ +V+TRL +QT  + K S           G      K   +EG
Sbjct: 144 -SAITAGAISTVATNPIWVVKTRLMLQTG-IGKYSTHYK-------GTIDTFRKIIQQEG 194

Query: 188 GIMGLYRGVWPTSLGIVPYVALNFAVYEQLK---EFMPSDENGNSSMRDSLYKLSMGA-I 243
               LY G+ P  LG++  VA+ F +YE LK    +  S +        +  KL + + +
Sbjct: 195 A-KALYAGLVPALLGMLN-VAIQFPLYENLKIRFGYSESTDVSTDVTSSNFQKLILASML 252

Query: 244 SGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANL 303
           S  VA T+TYP ++LR R Q+ +   N +  H   +   +    + EGF G+Y G   NL
Sbjct: 253 SKMVASTVTYPHEILRTRMQLKSDLPNTVQRH---LLPLIKITYRQEGFAGFYSGFATNL 309

Query: 304 FKVVPSTAVSWLVYE 318
            + VP+  V+ + +E
Sbjct: 310 VRTVPAAVVTLVSFE 324

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 40/83 (48%), Gaps = 1/83 (1%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSS-TTAYNKGLFDAIGQVYKEENIKGLFRGNGL 86
           LA  ++  ++ TV  P E ++  +Q++S       + L   I   Y++E   G + G   
Sbjct: 248 LASMLSKMVASTVTYPHEILRTRMQLKSDLPNTVQRHLLPLIKITYRQEGFAGFYSGFAT 307

Query: 87  NCIRVFPYSAVQFVVFEGCKKHI 109
           N +R  P + V  V FE  KK++
Sbjct: 308 NLVRTVPAAVVTLVSFEYSKKYL 330

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score =  115 bits (289), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 92/304 (30%), Positives = 138/304 (45%), Gaps = 32/304 (10%)

Query: 17  NFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYN------KGLFDAIGQ 70
           NFL     + FL GG++ A+++T  SP ERVK+L+Q Q              G+ D   +
Sbjct: 22  NFL-----IDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKR 76

Query: 71  VYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNW--QRLF 128
              +E +   +RGN  N IR FP  A+ F  F+   K +F      K E    W    L 
Sbjct: 77  TATQEGVISFWRGNTANVIRYFPTQALNF-AFKDKIKAMFGFK---KEEGYAKWFAGNLA 132

Query: 129 SGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGG 188
           SG   G  S++  Y LD  RTRL+  + +      S+     +  G+  +  K    + G
Sbjct: 133 SGGAAGALSLLFVYSLDYARTRLAADSKS------SKKGGARQFNGLIDVYKKTLKSD-G 185

Query: 189 IMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVA 248
           + GLYRG  P+ +GIV Y  L F +Y+ LK  + +     S +   L    +G +    A
Sbjct: 186 VAGLYRGFLPSVVGIVVYRGLYFGMYDSLKPLLLTGSLEGSFLASFL----LGWVVTTGA 241

Query: 249 QTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVP 308
            T +YP D +RRR  ++   G  +   Y+  +D L  I   EG    +KG  AN+ + V 
Sbjct: 242 STCSYPLDTVRRR--MMMTSGQAV--KYDGAFDCLRKIVAAEGVGSLFKGCGANILRGVA 297

Query: 309 STAV 312
              V
Sbjct: 298 GAGV 301

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score =  111 bits (278), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 92/320 (28%), Positives = 138/320 (43%), Gaps = 34/320 (10%)

Query: 16  KNFLKQDTNVAF----LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQV 71
           K+ L++   V++    +AG ++G  +R   +P + VKI  Q+Q       KG+   +  +
Sbjct: 7   KDHLRKGETVSWYNSVIAGSVSGVFARMATAPMDTVKIRYQLQPVQEDKYKGIASTVRTI 66

Query: 72  YKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGA 131
            KEE ++ L++GN         Y AVQF    G      +V +          Q L  GA
Sbjct: 67  MKEEGLRALWKGNIPATAMYVVYGAVQF----GSYSWFNNVWSAKFPRFSQQGQTLTVGA 122

Query: 132 LCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMG 191
           L G  S V +YPLDL+RTRL      ++  +  R S   +   +W           G+ G
Sbjct: 123 LAGMTSSVVSYPLDLLRTRL------IANRTSHRTSVAEECRQMWL--------NEGVRG 168

Query: 192 LYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTI 251
            + G+      +    A+ F  YE +       EN            S G I+G V++T+
Sbjct: 169 FFTGISTAMTTVTLSTAIMFLTYETVNIVC---ENHEKEFWSRPVSASSGIIAGFVSKTM 225

Query: 252 TYPFDLLRRRFQVL---------AMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTAN 302
            +P D LRRR QV+                 + Y S    +  I + EG    Y+GLT  
Sbjct: 226 VFPIDTLRRRMQVMNSKRTVHFTKFPAVYHEYRYKSSTAIIYKILRQEGVSALYRGLTMG 285

Query: 303 LFKVVPSTAVSWLVYELTWD 322
           L K VP+TA+S  VYE T D
Sbjct: 286 LCKSVPTTAISLFVYERTMD 305

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score =  110 bits (276), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 95/306 (31%), Positives = 142/306 (46%), Gaps = 35/306 (11%)

Query: 20  KQDTNVA--FLAGGIAGAISRTVVSPFERVKILLQ------VQSSTTAYNKGLFDAIGQV 71
           K+ +N A  FL GG++ A+S+T  +P ERVK+L+Q       Q S      G+ +   + 
Sbjct: 5   KKQSNFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIVECFKRT 64

Query: 72  YKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGA 131
             +E +   +RGN  N IR FP  A+ F  F+   K +F      K E    W   F+G 
Sbjct: 65  AADEGVASFWRGNTANVIRYFPTQALNFA-FKDKIKAMFGFK---KEEGYAKW---FAGN 117

Query: 132 LCGGCSVVA-----TYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEE 186
           L  G           Y LD  RTRL+  + +  K  + + +      G+  +  K  A +
Sbjct: 118 LASGGLAGGLSLLFVYSLDYARTRLAADSKSAKKGGERQFN------GLVDVYKKTLASD 171

Query: 187 GGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGG 246
           G + GLYRG  P+ +GIV Y  L F +Y+ LK  + +    NS +   L  L     +G 
Sbjct: 172 G-VAGLYRGFLPSVVGIVVYRGLYFGLYDSLKPLLLTGSLENSFLASFL--LGWAVTTG- 227

Query: 247 VAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKV 306
            A T +YP D +RRR  ++   G  +   Y+  +DA   I   EG K  +KG  AN+ + 
Sbjct: 228 -ASTASYPLDTVRRR--MMMTSGQAV--KYDGAFDAFRKIVAAEGIKSLFKGCGANILRG 282

Query: 307 VPSTAV 312
           V    V
Sbjct: 283 VAGAGV 288

 Score = 35.4 bits (80), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 7/84 (8%)

Query: 26  AFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNG 85
           +FL G      + T   P + V+  + + S       G FDA  ++   E IK LF+G G
Sbjct: 217 SFLLGWAVTTGASTASYPLDTVRRRMMMTSGQAVKYDGAFDAFRKIVAAEGIKSLFKGCG 276

Query: 86  LNCIR-------VFPYSAVQFVVF 102
            N +R       +  Y  +Q ++F
Sbjct: 277 ANILRGVAGAGVISMYDQLQVILF 300

>Kwal_55.20868
          Length = 380

 Score =  112 bits (279), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 88/311 (28%), Positives = 150/311 (48%), Gaps = 31/311 (9%)

Query: 21  QDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQ---SSTTAYNKGLFDAIGQVYKEENI 77
            DT +  L+G +AG ++   V P +  K  LQ Q   S+ + Y KG+   +  + ++E  
Sbjct: 73  DDTEITALSGAMAGFLAGVTVCPLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDEGA 132

Query: 78  KGLFRGNGLNCIRVFPYSAVQFVVFEGCKK---HIFHVDTKGKGEQLNNWQRLFSGALCG 134
           +GL++G     +  FP   + F V+E  KK    IF           +      S    G
Sbjct: 133 RGLYKGLVPIIMGYFPTWMIYFSVYERSKKLYPRIF--------PSFDFISHSASALTAG 184

Query: 135 GCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYR 194
             S + T P+ +V+TRL +QT +++K S    S        +    K Y  EG +   Y 
Sbjct: 185 TVSTILTNPVWVVKTRLMLQT-HVNKNSTHYTS-------TFDAFHKMYTTEG-LRTFYA 235

Query: 195 GVWPTSLGIVPYVALNFAVYEQLKEFM---PSDENGNSSMRDSLYKLSMGAISGGVAQTI 251
           G+ P+ LG+  +VA++F +YE+LK ++   PS         +    +   + S  VA T+
Sbjct: 236 GLLPSLLGLF-HVAIHFPIYEKLKVWLHCTPSMSRTEDHNLNLARLIIASSASKMVASTL 294

Query: 252 TYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTI----GKTEGFKGYYKGLTANLFKVV 307
           TYP ++LR R Q+ A   + L     +    L+ +     K+EG +G+Y G TANL + +
Sbjct: 295 TYPHEILRTRMQLKAYPTDPLAALQKTSRHGLIRLIKHTYKSEGLRGFYSGFTANLARTL 354

Query: 308 PSTAVSWLVYE 318
           P++A++ + +E
Sbjct: 355 PASAITLVSFE 365

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 42/91 (46%), Gaps = 1/91 (1%)

Query: 228 NSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIG 287
           N S  D+      GA++G +A     P D+ + R Q   +  N   + Y  +   L TI 
Sbjct: 69  NRSFDDTEITALSGAMAGFLAGVTVCPLDVAKTRLQAQGLHSNPSNY-YKGILGTLTTII 127

Query: 288 KTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
           + EG +G YKGL   +    P+  + + VYE
Sbjct: 128 RDEGARGLYKGLVPIIMGYFPTWMIYFSVYE 158

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 41/90 (45%), Gaps = 8/90 (8%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTT--------AYNKGLFDAIGQVYKEENIKG 79
           +A   +  ++ T+  P E ++  +Q+++  T            GL   I   YK E ++G
Sbjct: 282 IASSASKMVASTLTYPHEILRTRMQLKAYPTDPLAALQKTSRHGLIRLIKHTYKSEGLRG 341

Query: 80  LFRGNGLNCIRVFPYSAVQFVVFEGCKKHI 109
            + G   N  R  P SA+  V FE  +K++
Sbjct: 342 FYSGFTANLARTLPASAITLVSFEYFRKYL 371

>Kwal_23.3965
          Length = 307

 Score =  109 bits (272), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 85/321 (26%), Positives = 147/321 (45%), Gaps = 37/321 (11%)

Query: 12  ENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQV 71
           E+ L+   +     + +AG ++G  +R V +P + +KI LQ+Q +  A   G+     ++
Sbjct: 3   EDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRL 62

Query: 72  YKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGA 131
            ++E ++ L++GN         Y + QF  +    K +       K +          GA
Sbjct: 63  VRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLL------SKSQLPAQIHTGMVGA 116

Query: 132 LCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMG 191
           L G CS +A+YP D++RTR       ++  S+  ++ ++    +W+          G  G
Sbjct: 117 LSGTCSAIASYPCDVLRTRF------IANHSRELSTMLSTAQEIWR--------HEGFRG 162

Query: 192 LYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTI 251
            ++GV  + + I    +   A YE +K F     + +SS+   L + S   I+G V++TI
Sbjct: 163 FFKGVSSSIVSIAVATSSILATYESVKIFCEQRPDRDSSVIQ-LLESSASVIAGIVSKTI 221

Query: 252 TYPFDLLRRRFQVLAMGGNELGF--HYNSVWDAL------------VTIGKTEGFKGYYK 297
            +P D +R+R+QV+     +LG   H N  + A             + I + EG    Y 
Sbjct: 222 VFPIDTVRKRYQVI--DWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYH 279

Query: 298 GLTANLFKVVPSTAVSWLVYE 318
           G T  + K VPST VS  VYE
Sbjct: 280 GYTLGIAKSVPSTVVSLGVYE 300

>Scas_709.9
          Length = 365

 Score =  108 bits (270), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 83/305 (27%), Positives = 146/305 (47%), Gaps = 26/305 (8%)

Query: 22  DTNVAFLAGGIAGAISRTVVSPFERVKILLQ---VQSSTTAYNKGLFDAIGQVYKEENIK 78
           D  +  L+G +AG +S  +V P +  K  LQ   +QS    Y +G+   +  +  +E ++
Sbjct: 63  DPKITALSGALAGFLSGIIVCPLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIVVDEGVR 122

Query: 79  GLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSV 138
           GL++G     +  FP   + F V+E  K     V         +      S    G  S 
Sbjct: 123 GLYKGLIPIILGYFPTWMIYFSVYEFAKDLYPRVLPNS-----DFISHSCSAITAGAAST 177

Query: 139 VATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWP 198
           V T P+ +V+TRL +QT     L +SR           K++++      G+  LY G+ P
Sbjct: 178 VLTNPIWVVKTRLMLQTP----LGESRTHYRGTIDAFKKIITQE-----GVRTLYTGLVP 228

Query: 199 TSLGIVPYVALNFAVYEQLKEFMPSDE--NGNSSMRDSLYKLSM---GAISGGVAQTITY 253
           +  G++ +VA++F VYE+LK  +  D    G++S   SL+   +    + S  +A  +TY
Sbjct: 229 SMFGLL-HVAIHFPVYEKLKNRLHCDTITGGHNSQEHSLHLTRLIIASSASKMLASILTY 287

Query: 254 PFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVS 313
           P ++LR R Q   +  ++L    + + D +    + EG  G+Y G   NL + VP++A++
Sbjct: 288 PHEILRTRMQ---LKSDKLLISKHKLLDLIKRTYRYEGLLGFYSGFATNLLRTVPASAIT 344

Query: 314 WLVYE 318
            + +E
Sbjct: 345 LVSFE 349

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 39/82 (47%), Gaps = 1/82 (1%)

Query: 241 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLT 300
           GA++G ++  I  P D+ + R Q   +   E  + Y  V   + TI   EG +G YKGL 
Sbjct: 71  GALAGFLSGIIVCPLDVTKTRLQAQGIQSIENPY-YRGVLGTMSTIVVDEGVRGLYKGLI 129

Query: 301 ANLFKVVPSTAVSWLVYELTWD 322
             +    P+  + + VYE   D
Sbjct: 130 PIILGYFPTWMIYFSVYEFAKD 151

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score =  107 bits (267), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 95/324 (29%), Positives = 151/324 (46%), Gaps = 46/324 (14%)

Query: 16  KNFLKQDTNVA----FLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQV 71
           K+ L++D  V+     +AG ++G  +RT ++P + VKI LQV    T +NK   + +  +
Sbjct: 4   KDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQV----TPHNKNA-NVLINI 58

Query: 72  YKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFS-- 129
            K E I+G ++GN    I    Y   QF  +      +     +G G  LN   +L+S  
Sbjct: 59  LKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFL-----RG-GLDLNISPQLYSCL 112

Query: 130 -GALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGG 188
            G+L G  S +A+YP D++RTR +  +    +L K R   +A    +W           G
Sbjct: 113 VGSLAGMTSSLASYPFDVLRTRFAANSQG--QLIKLRDEIMA----IW--------SHEG 158

Query: 189 IMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLS--MGAISGG 246
           +MG + G   + + I    A+ F VYE +K F   + +  S  RD    L+   G ISG 
Sbjct: 159 LMGFFSGCGSSMINIGLNTAIMFGVYESIKIFT-EERSKLSDRRDPFTLLNELAGPISGF 217

Query: 247 VAQTITYPFDLLRRRFQVLAMGGNEL-----------GFHYNSVWDALVTIGKTEGFKGY 295
            ++  T+P D +RRR Q+      E             +         +++ + EG    
Sbjct: 218 TSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSL 277

Query: 296 YKGLTANLFKVVPSTAVSWLVYEL 319
           Y+G+T +L K VPSTA+S   YEL
Sbjct: 278 YRGVTMSLIKSVPSTAISLWSYEL 301

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 49/109 (44%), Gaps = 15/109 (13%)

Query: 10  EEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTT----------- 58
           EE ++L +     T +  LAG I+G  S+    P + V+  +Q+++S             
Sbjct: 192 EERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKD 251

Query: 59  ---AYNKGLFDAIG-QVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFE 103
              +Y    F  +G  + ++E    L+RG  ++ I+  P +A+    +E
Sbjct: 252 IYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYE 300

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score =  108 bits (269), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 83/306 (27%), Positives = 145/306 (47%), Gaps = 31/306 (10%)

Query: 22  DTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTT----AYNKGLFDAIGQVYKEENI 77
            T +  L+G  AG +S   V P +  K  LQ Q   T     Y +G+   +  + ++E  
Sbjct: 76  STQITALSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGP 135

Query: 78  KGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCS 137
           +GL++G     +  FP   + F V+E  KK  FH    G   Q +   +  +    G  S
Sbjct: 136 RGLYKGLVPIVLGYFPTWMIYFSVYEFSKK-FFH----GIFPQFDFVAQSCAAITAGAAS 190

Query: 138 VVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPP----GVWKLLSKAYAEEGGIMGLY 193
              T P+ +V+TRL +Q            S++ + P    G +    K + +EG    LY
Sbjct: 191 TTLTNPIWVVKTRLMLQ------------SNLGEHPTHYKGTFDAFRKLFYQEG-FKALY 237

Query: 194 RGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGA-ISGGVAQTIT 252
            G+ P+ LG+  +VA++F +YE LK         N++   +L +L M + +S  +A  +T
Sbjct: 238 AGLVPSLLGLF-HVAIHFPIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASAVT 296

Query: 253 YPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAV 312
           YP ++LR R Q+ +   + +      ++  +      EG KG+Y G T NL + +P++A+
Sbjct: 297 YPHEILRTRMQLKSDIPDSIQ---RRLFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAI 353

Query: 313 SWLVYE 318
           + + +E
Sbjct: 354 TLVSFE 359

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 44/88 (50%), Gaps = 1/88 (1%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTT-AYNKGLFDAIGQVYKEENIKGLFRGNGL 86
           +A  ++  I+  V  P E ++  +Q++S    +  + LF  I   Y +E +KG + G   
Sbjct: 283 MASSVSKMIASAVTYPHEILRTRMQLKSDIPDSIQRRLFPLIKATYAQEGLKGFYSGFTT 342

Query: 87  NCIRVFPYSAVQFVVFEGCKKHIFHVDT 114
           N +R  P SA+  V FE  +  + ++ T
Sbjct: 343 NLVRTIPASAITLVSFEYFRNRLENIST 370

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 37/80 (46%)

Query: 241 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLT 300
           GA +G ++     P D+ + R Q   +       +Y  +   L TI + EG +G YKGL 
Sbjct: 84  GAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKGLV 143

Query: 301 ANLFKVVPSTAVSWLVYELT 320
             +    P+  + + VYE +
Sbjct: 144 PIVLGYFPTWMIYFSVYEFS 163

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score =  107 bits (268), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 86/308 (27%), Positives = 144/308 (46%), Gaps = 30/308 (9%)

Query: 19  LKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTA--YNKGLFDAIGQVYKEEN 76
           L  DT V  ++G +AG +S  +V P +  K  LQ Q + +   Y +G+   +  + ++E 
Sbjct: 80  LLDDTQVTAVSGALAGFVSGIMVCPLDVAKTRLQAQGAGSGERYYRGIVGTLSAILRDEG 139

Query: 77  IKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGC 136
           + GL++G     +  FP   + F V+E CK+        G            S    G  
Sbjct: 140 VAGLYKGLAPIVLGYFPTWMLYFSVYEKCKQRYPSYLPGGFVSHAA------SALTAGAI 193

Query: 137 SVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGV 196
           S   T P+ +V+TRL +Q+ ++S+ S +  S +           K Y  E G+   Y G+
Sbjct: 194 STALTNPIWVVKTRLMIQS-DVSRDSTNYRSTL-------DAFRKMYRSE-GLKVFYSGL 244

Query: 197 WPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSM------GAISGGVAQT 250
            P+  G+  +VA++F VYE+LK ++  +       R    KL +        +S  VA  
Sbjct: 245 VPSLFGLF-HVAIHFPVYEKLKIWLHRNTPAADGQRLDHNKLQLDRLIVASCLSKVVASV 303

Query: 251 ITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPST 310
           ITYP ++LR R QV   G         S+ + L  I  +EG+ G+Y G   NL + VP++
Sbjct: 304 ITYPHEILRTRMQVRHSGVPP------SLLNLLGRIRASEGYVGFYSGFATNLVRTVPAS 357

Query: 311 AVSWLVYE 318
            ++ + +E
Sbjct: 358 VITLVSFE 365

>Scas_716.29
          Length = 316

 Score =  105 bits (261), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 93/338 (27%), Positives = 153/338 (45%), Gaps = 53/338 (15%)

Query: 6   LPAIEEENQLKNFLKQDTNV----AFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYN 61
           +  I++     + L++  +V    + +AG ++G ++RTV++P + +KI LQ++ S T   
Sbjct: 1   MTNIDDGQHNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQA 60

Query: 62  -KGLFDAI-GQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGE 119
             GL   + G +  E  ++  ++GN    +    Y   QF  +       F+ +  G+  
Sbjct: 61  PSGLLKMMKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYS------FYNNLFGETS 114

Query: 120 QLN-NWQRLFSGALCGGCSVVATYPLDLVRTR-LSVQTANLSKLSKSRASDIAKPPGVWK 177
            +N   Q L  GAL G  S   +YP D++RTR ++ Q   LS LS            +W 
Sbjct: 115 DMNGQLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKE-------IWN 167

Query: 178 LLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYK 237
           +         GI G +RG   +   I    ++ F  YE +K +   DE    S   +  +
Sbjct: 168 M--------EGIPGFFRGCTASMFTITLSASILFGTYESIKIY--CDEYSKESDYTNYLR 217

Query: 238 LSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVT------------ 285
            S  +ISG  ++ +TYP D +RRR QV     N +   +N V + +VT            
Sbjct: 218 YSASSISGVTSKMVTYPLDTIRRRIQVR----NSVYVQHN-VENKIVTEIYQSYKGASFI 272

Query: 286 -----IGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
                I + EG    Y+G++ +L K VPST VS   YE
Sbjct: 273 RMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYE 310

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score =  102 bits (254), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 87/315 (27%), Positives = 137/315 (43%), Gaps = 33/315 (10%)

Query: 20  KQDTN--VAFLAGGIAGAISRTVVSPFERVKILLQV--QSSTTAYNKGLFDAIGQ-VYKE 74
           K+ +N  V  +AGG AG        P + +K+ +Q+  +S+        F   G+ +Y E
Sbjct: 5   KKSSNPAVNLIAGGTAGLFEALCCHPLDTIKVRMQIYRRSALEGIKPPGFIKTGRNIYTE 64

Query: 75  ENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCG 134
           E +  L++G G   I + P  A++F  +E  +  +    T      ++      +G   G
Sbjct: 65  EGLLALYKGLGAVVIGIIPKMAIRFSSYEFYRSALADKQTG----SVSTGNTFLAGVGAG 120

Query: 135 GC-SVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAY--AEEGGIMG 191
              +V+   P+++V+ RL  Q  +          + A  P     L   Y   +E GI  
Sbjct: 121 TTEAVLVVNPMEVVKIRLQAQHLH---------PETAASPRYRNALQACYLIVKEEGIGA 171

Query: 192 LYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTI 251
           LYRGV  T+         NF VY +LKEF+   E+  +    S     +G ISG +    
Sbjct: 172 LYRGVSLTAARQATNQGANFTVYSKLKEFL--QEHHKTDALPSWETSCIGLISGAIGPFS 229

Query: 252 TYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKT----EGFKGYYKGLTANLFKVV 307
             P D ++ R Q      N  G      W  +VTIGK     EGF+  YKG+T  + +V 
Sbjct: 230 NAPLDTIKTRLQKDKSTANMSG------WSRIVTIGKQLIKEEGFRALYKGITPRVMRVA 283

Query: 308 PSTAVSWLVYELTWD 322
           P  AV++ VYE   +
Sbjct: 284 PGQAVTFTVYEFVRE 298

 Score = 72.0 bits (175), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 60/208 (28%), Positives = 89/208 (42%), Gaps = 23/208 (11%)

Query: 22  DTNVAFLAGGIAGAISRT-VVSPFERVKILLQVQ-----SSTTAYNKGLFDAIGQVYKEE 75
            T   FLAG  AG      VV+P E VKI LQ Q     ++ +   +    A   + KEE
Sbjct: 108 STGNTFLAGVGAGTTEAVLVVNPMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEE 167

Query: 76  NIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGG 135
            I  L+RG  L   R        F V+   K+ +       K + L +W+    G + G 
Sbjct: 168 GIGALYRGVSLTAARQATNQGANFTVYSKLKEFL---QEHHKTDALPSWETSCIGLISGA 224

Query: 136 CSVVATYPLDLVRTRLSVQ--TANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLY 193
               +  PLD ++TRL     TAN+S  S+               + K   +E G   LY
Sbjct: 225 IGPFSNAPLDTIKTRLQKDKSTANMSGWSR------------IVTIGKQLIKEEGFRALY 272

Query: 194 RGVWPTSLGIVPYVALNFAVYEQLKEFM 221
           +G+ P  + + P  A+ F VYE ++E +
Sbjct: 273 KGITPRVMRVAPGQAVTFTVYEFVREHL 300

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score =  100 bits (248), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 99/351 (28%), Positives = 152/351 (43%), Gaps = 60/351 (17%)

Query: 7   PAIEEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYN----- 61
           P    ++  +N  +    V F+AGGI G     V  PF+ VK  LQ      AY      
Sbjct: 36  PVQRADSSQQNIKEVKPWVHFVAGGIGGMAGAVVTCPFDVVKTRLQSDVFQAAYKSHAKS 95

Query: 62  ----------------KGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGC 105
                           K  F  I  VY+ E  + LF+G G N + V P  ++ F  + G 
Sbjct: 96  IGPNQANVIAQGVRHFKETFGIISNVYRNEGFRSLFKGLGPNLVGVIPARSINFFTY-GT 154

Query: 106 KKHIFHVDTKGKGEQLNN-----WQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSK 160
            K I+        + LNN     W  L + A  G  +  AT P+ LV+TRL +  A  +K
Sbjct: 155 TKEIY-------SKTLNNGQEAVWIHLMAAATAGWATSTATNPIWLVKTRLQLDKAGTTK 207

Query: 161 LSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEF 220
             K+           W  L     +E GI+GLY+G+  + LG V  + L + +YEQ+K  
Sbjct: 208 KYKNS----------WDCLKNVVQKE-GILGLYKGLSASYLGSVEGI-LQWVLYEQMKHI 255

Query: 221 MPS---DENGN-----SSMRDSLYKLSMGAISGG----VAQTITYPFDLLRRRFQVLAMG 268
           +     ++ GN      S  D + +    + S G    VA  ITYP +++R R +   + 
Sbjct: 256 IKQRSMEKFGNISEVEKSTSDKIKEWCQRSGSAGLAKFVASIITYPHEVVRTRLRQAPLE 315

Query: 269 GNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYEL 319
             +L   Y  +  ++  I K EG    Y GLT +L + VP++ + +  +EL
Sbjct: 316 NGKL--KYTGLVQSIRVIIKEEGLASMYGGLTPHLLRTVPNSIIMFGTWEL 364

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 60/143 (41%), Gaps = 22/143 (15%)

Query: 200 SLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRD-----SLYKLSMGAISGGVAQTITYP 254
           +L  VPY+A +         F P  +  +SS ++            G I G     +T P
Sbjct: 13  ALESVPYLASDEKSSNLKDAFPPPVQRADSSQQNIKEVKPWVHFVAGGIGGMAGAVVTCP 72

Query: 255 FDLLRRRFQ-----------VLAMGGNELGF------HYNSVWDALVTIGKTEGFKGYYK 297
           FD+++ R Q             ++G N+         H+   +  +  + + EGF+  +K
Sbjct: 73  FDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGVRHFKETFGIISNVYRNEGFRSLFK 132

Query: 298 GLTANLFKVVPSTAVSWLVYELT 320
           GL  NL  V+P+ ++++  Y  T
Sbjct: 133 GLGPNLVGVIPARSINFFTYGTT 155

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 99.0 bits (245), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 80/320 (25%), Positives = 146/320 (45%), Gaps = 42/320 (13%)

Query: 19  LKQDTNVA----FLAGGIAGAISRTVVSPFERVKILLQVQSST--TAYNKGLFDAIGQVY 72
           L++  NVA     LAG ++G ++R++ +P + +KI LQ+  +     +   + +    + 
Sbjct: 8   LRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMI 67

Query: 73  KEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGAL 132
           K E I+  ++GN    +    Y + QF  +    +++     + +         L  GA 
Sbjct: 68  KNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEAR------LHSLVVGAF 121

Query: 133 CGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGL 192
            G  S + +YP D++RTRL V    +  +S +R     +   +WKL         G+ G 
Sbjct: 122 AGITSSIVSYPFDVLRTRL-VANNQMHSMSITR-----EVRDIWKL--------EGLPGF 167

Query: 193 YRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKL-----SMGAISGGV 247
           ++G   +   I    ++ F  YE ++ +   DEN  ++     ++L     S G I G +
Sbjct: 168 FKGSIASMTTITLTASIMFGTYETIRIY--CDENEKTTAAHKKWELATLNHSAGTIGGVI 225

Query: 248 AQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDAL---------VTIGKTEGFKGYYKG 298
           A+ IT+P + +RRR Q +     E    ++SV+ +          + I K EG    Y+G
Sbjct: 226 AKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRG 285

Query: 299 LTANLFKVVPSTAVSWLVYE 318
           +   L K +P+T VS+  YE
Sbjct: 286 ILVALSKTIPTTFVSFWGYE 305

 Score = 75.1 bits (183), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 98/206 (47%), Gaps = 21/206 (10%)

Query: 113 DTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKP 172
           D+  KG+ +  W+ L +GA+ G  +   T P+D ++ RL +  AN  K   S+  ++A  
Sbjct: 6   DSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVA-- 63

Query: 173 PGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMR 232
                   ++  +  GI   ++G  P SL  V Y +  F+ Y     ++         + 
Sbjct: 64  --------RSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTP-----FGLE 110

Query: 233 DSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGF 292
             L+ L +GA +G  +  ++YPFD+LR R     +  N++  H  S+   +  I K EG 
Sbjct: 111 ARLHSLVVGAFAGITSSIVSYPFDVLRTRL----VANNQM--HSMSITREVRDIWKLEGL 164

Query: 293 KGYYKGLTANLFKVVPSTAVSWLVYE 318
            G++KG  A++  +  + ++ +  YE
Sbjct: 165 PGFFKGSIASMTTITLTASIMFGTYE 190

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score = 98.2 bits (243), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 81/301 (26%), Positives = 132/301 (43%), Gaps = 30/301 (9%)

Query: 27  FLAGGIAGAISRTVVSPFERVKILLQVQSS--TTAYNKGLFDAIGQVYKEENIKGLFRGN 84
           F+AG +AG     V+ P + VK ++Q+Q S  +    KG+FD + Q+  +E    L++G 
Sbjct: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGI 72

Query: 85  GLNCIRVFPYSAVQFVV---FEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVAT 141
               +   P  A +F     F+   K +F        E+L     + SGA  G C     
Sbjct: 73  SSPILMEAPKRATKFACNDEFQKIYKDLFG------AEKLTQPLSILSGASAGICESFVV 126

Query: 142 YPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSL 201
            P +LV+ RL         +S    S IA        + K   E+ GI+ +Y G+  T  
Sbjct: 127 VPFELVKIRLQ-------DVSSKFTSPIA--------VVKNIVEKEGILAMYNGLESTMW 171

Query: 202 GIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRR 261
               + A  F +  Q++  +P     +   R+ L     G + G ++  ++ PFD+++ R
Sbjct: 172 RHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDLLA---GTVGGTLSSLLSTPFDVVKSR 228

Query: 262 FQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYELTW 321
            Q  A+    +   YN  W AL TI K EGFK  YKG    + ++ P   +  +V+    
Sbjct: 229 VQNTAVIPG-VPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVM 287

Query: 322 D 322
           D
Sbjct: 288 D 288

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 79/180 (43%), Gaps = 19/180 (10%)

Query: 126 RLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAE 185
           +  +GA+ G   ++  YPLD+V+T + +Q +  S              GV+  L +  A+
Sbjct: 12  QFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYK---------GVFDCLKQIAAK 62

Query: 186 EGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISG 245
           EG    LY+G+    L   P  A  FA  ++ ++    D  G   +   L  LS GA +G
Sbjct: 63  EGPSR-LYKGISSPILMEAPKRATKFACNDEFQKIY-KDLFGAEKLTQPLSILS-GASAG 119

Query: 246 GVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFK 305
                +  PF+L++ R Q       ++   + S    +  I + EG    Y GL + +++
Sbjct: 120 ICESFVVVPFELVKIRLQ-------DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWR 172

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 82/203 (40%), Gaps = 30/203 (14%)

Query: 25  VAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGN 84
           ++ L+G  AG     VV PFE VKI LQ  SS           +  + ++E I  ++ G 
Sbjct: 110 LSILSGASAGICESFVVVPFELVKIRLQDVSSKFTSP---IAVVKNIVEKEGILAMYNGL 166

Query: 85  GLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPL 144
                R   ++A  F +    +  +    T  K EQ  N   L +G + G  S + + P 
Sbjct: 167 ESTMWRHGIWNAGYFGIIFQVRALLPKAST--KSEQTRN--DLLAGTVGGTLSSLLSTPF 222

Query: 145 DLVRTRLSVQTANLSKLSKSRASDIAKPPGV-------WKLLSKAYAEEGGIMGLYRGVW 197
           D+V               KSR  + A  PGV       W  L+  Y EE G   LY+G  
Sbjct: 223 DVV---------------KSRVQNTAVIPGVPRKYNWSWPALATIYKEE-GFKALYKGFV 266

Query: 198 PTSLGIVPYVALNFAVYEQLKEF 220
           P  L + P   +   V+  + +F
Sbjct: 267 PKVLRLGPGGGILLVVFTGVMDF 289

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 39/80 (48%), Gaps = 2/80 (2%)

Query: 235 LYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKG 294
           +Y+   GA++G     + YP D+++   Q+   GG+  G  Y  V+D L  I   EG   
Sbjct: 10  VYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGS--GPQYKGVFDCLKQIAAKEGPSR 67

Query: 295 YYKGLTANLFKVVPSTAVSW 314
            YKG+++ +    P  A  +
Sbjct: 68  LYKGISSPILMEAPKRATKF 87

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 45/99 (45%), Gaps = 5/99 (5%)

Query: 21  QDTNVAFLAGGIAGAISRTVVSPFERVKILLQ----VQSSTTAYNKGLFDAIGQVYKEEN 76
           + T    LAG + G +S  + +PF+ VK  +Q    +      YN   + A+  +YKEE 
Sbjct: 199 EQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWS-WPALATIYKEEG 257

Query: 77  IKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTK 115
            K L++G     +R+ P   +  VVF G       V  K
Sbjct: 258 FKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFRTVHEK 296

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 98.2 bits (243), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 80/296 (27%), Positives = 127/296 (42%), Gaps = 32/296 (10%)

Query: 27  FLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGL 86
            LAG  AG +  +V+ P + +K  +Q  SS+ A  +GL   I ++   E    L++G   
Sbjct: 20  LLAGAFAGIMEHSVLFPVDAIKTRIQ-SSSSGAATQGLIKQISKITTAEGSLALWKGVQS 78

Query: 87  NCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDL 146
             +   P  AV F  +E  K  +         + +   +   SG      +     P D+
Sbjct: 79  VILGAGPAHAVYFATYEFSKSKLIDPQDMHTHQPI---KTAISGMAATTVADALMNPFDV 135

Query: 147 VRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGI-VP 205
           ++ R+ + T         R S       VW +    Y +EG     Y   +PT+L + +P
Sbjct: 136 IKQRMQLNT---------RES-------VWHVTKNIYHKEGFAAFYYS--YPTTLVMNIP 177

Query: 206 YVALNFAVYEQLKEFM-PSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQV 264
           + A NFA+YE   +FM PS+E       +       G +SG     IT P D ++   QV
Sbjct: 178 FAAFNFAIYESATKFMNPSNE------YNPFIHCISGGLSGATCAAITTPLDCIKTVLQV 231

Query: 265 LAMG--GNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
                  NE+    N+   A   I K  G+KG+ +GL   +   +P+TA+SW  YE
Sbjct: 232 RGSETVSNEIMKQANTFQRAASAIYKIHGWKGFLRGLKPRVIANMPATAISWTSYE 287

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 84/196 (42%), Gaps = 28/196 (14%)

Query: 125 QRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYA 184
            +L +GA  G       +P+D ++TR+              +S  A   G+ K +SK   
Sbjct: 18  HQLLAGAFAGIMEHSVLFPVDAIKTRI------------QSSSSGAATQGLIKQISKITT 65

Query: 185 EEGGIMGLYRGVWPTSLGIVPYVALNFAVYE--QLKEFMPSDENGNSSMRDSLYKLSMGA 242
            EG  + L++GV    LG  P  A+ FA YE  + K   P D + +  ++ ++     G 
Sbjct: 66  AEGS-LALWKGVQSVILGAGPAHAVYFATYEFSKSKLIDPQDMHTHQPIKTAI----SGM 120

Query: 243 ISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTAN 302
            +  VA  +  PFD++++R Q+             SVW     I   EGF  +Y      
Sbjct: 121 AATTVADALMNPFDVIKQRMQLNTR---------ESVWHVTKNIYHKEGFAAFYYSYPTT 171

Query: 303 LFKVVPSTAVSWLVYE 318
           L   +P  A ++ +YE
Sbjct: 172 LVMNIPFAAFNFAIYE 187

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/194 (20%), Positives = 85/194 (43%), Gaps = 17/194 (8%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLN 87
           ++G  A  ++  +++PF+ +K  +Q+ +      + ++     +Y +E     +      
Sbjct: 117 ISGMAATTVADALMNPFDVIKQRMQLNT-----RESVWHVTKNIYHKEGFAAFYYSYPTT 171

Query: 88  CIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLV 147
            +   P++A  F ++E   K +          + N +    SG L G      T PLD +
Sbjct: 172 LVMNIPFAAFNFAIYESATKFM------NPSNEYNPFIHCISGGLSGATCAAITTPLDCI 225

Query: 148 RTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYV 207
           +T L V+       S++ +++I K    ++  + A  +  G  G  RG+ P  +  +P  
Sbjct: 226 KTVLQVRG------SETVSNEIMKQANTFQRAASAIYKIHGWKGFLRGLKPRVIANMPAT 279

Query: 208 ALNFAVYEQLKEFM 221
           A+++  YE  K F+
Sbjct: 280 AISWTSYECAKHFL 293

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score =  100 bits (248), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 94/352 (26%), Positives = 162/352 (46%), Gaps = 69/352 (19%)

Query: 6   LPAIEEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQS---------- 55
           L  + EE         DT +  L+G +AG ++  +V P +  K  LQ Q           
Sbjct: 91  LSIVREEGHF-----NDTEITALSGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRP 145

Query: 56  ----STT---AYNKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKH 108
               +TT    Y  G++  +  + ++E+I+GL++G     +  FP   + F V+E CK  
Sbjct: 146 VGSVATTFGGKYYSGIWGTLTTIVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCKLS 205

Query: 109 IFHVDTKGKGEQLNNWQRL---FSGALCGGCSVVATYPLDLVRTRLSVQTA-NLSKLSKS 164
                        NN + L    S    G  S   T P+ +V+TRL +Q+  N+  ++  
Sbjct: 206 Y--------PRYFNNSEFLSHSMSALTAGAISTTLTNPIWVVKTRLMLQSGKNIKGMTHY 257

Query: 165 RASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFM--- 221
           + +  A          K Y  EG I   Y G+ P+  G++ +VA++F VYE+LK+ +   
Sbjct: 258 KNTLDA--------FIKIYKVEG-IKSFYSGLIPSLFGLL-HVAIHFPVYEKLKKVLHCY 307

Query: 222 ----PSDE----NGNSSMRDS------LYKLSMGAI-SGGVAQTITYPFDLLRRRFQVLA 266
               P+ E    NGNS+ + +      L +L + +  S  +A T+TYP ++LR R Q+ +
Sbjct: 308 PSGRPNQETMNVNGNSNPQTTGSTNFQLGRLIVASCGSKMIASTLTYPHEILRTRLQLKS 367

Query: 267 MGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
                      S+   + T    EG +G+Y G   N+F+ VP++A++ + +E
Sbjct: 368 D-------MKPSIKSIIRTTYAKEGIRGFYSGFLTNMFRTVPASAITLVSFE 412

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 36/73 (49%), Gaps = 3/73 (4%)

Query: 36  ISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYS 95
           I+ T+  P E ++  LQ++S      K +   I   Y +E I+G + G   N  R  P S
Sbjct: 348 IASTLTYPHEILRTRLQLKSDMKPSIKSI---IRTTYAKEGIRGFYSGFLTNMFRTVPAS 404

Query: 96  AVQFVVFEGCKKH 108
           A+  V FE  +KH
Sbjct: 405 AITLVSFEYFRKH 417

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 98.2 bits (243), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 73/300 (24%), Positives = 131/300 (43%), Gaps = 39/300 (13%)

Query: 27  FLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGL 86
            +AG  AG +  +V+ P + +K  +Q  ++ +   K +   I  +   E    L++G   
Sbjct: 37  LIAGAFAGIMEHSVMFPIDALKTRIQSANAKSLSAKNMLSQISHISTSEGTLALWKGVQS 96

Query: 87  NCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVAT----Y 142
             +   P  AV F  +E CKK++  +D+             F  A+ G C+  A+     
Sbjct: 97  VILGAGPAHAVYFGTYEFCKKNL--IDSSDTQT-----HHPFKTAISGACATTASDALMN 149

Query: 143 PLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLG 202
           P D ++ R+ + T+                  VW+   + Y  EG  +  +   +PT+L 
Sbjct: 150 PFDTIKQRIQLNTSA----------------SVWQTTKQIYQSEG--LAAFYYSYPTTLV 191

Query: 203 I-VPYVALNFAVYEQLKEFM-PSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRR 260
           + +P+ A NF +YE   +F+ PS+E       + L     G+ISG     IT P D ++ 
Sbjct: 192 MNIPFAAFNFVIYESSTKFLNPSNE------YNPLIHCLCGSISGSTCAAITTPLDCIKT 245

Query: 261 RFQVLAMG--GNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
             Q+        E+    ++   A   I +  G+KG+++G    +   +P+TA+SW  YE
Sbjct: 246 VLQIRGSQTVSLEIMRKADTFSKAASAIYQVYGWKGFWRGWKPRIVANMPATAISWTAYE 305

 Score = 63.5 bits (153), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/194 (21%), Positives = 83/194 (42%), Gaps = 17/194 (8%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLN 87
           ++G  A   S  +++PF+ +K  +Q+ +S +     ++    Q+Y+ E +   +      
Sbjct: 135 ISGACATTASDALMNPFDTIKQRIQLNTSAS-----VWQTTKQIYQSEGLAAFYYSYPTT 189

Query: 88  CIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLV 147
            +   P++A  FV++E   K +          + N       G++ G      T PLD +
Sbjct: 190 LVMNIPFAAFNFVIYESSTKFL------NPSNEYNPLIHCLCGSISGSTCAAITTPLDCI 243

Query: 148 RTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYV 207
           +T L ++ +    L   R +D       +   + A  +  G  G +RG  P  +  +P  
Sbjct: 244 KTVLQIRGSQTVSLEIMRKAD------TFSKAASAIYQVYGWKGFWRGWKPRIVANMPAT 297

Query: 208 ALNFAVYEQLKEFM 221
           A+++  YE  K F+
Sbjct: 298 AISWTAYECAKHFL 311

 Score = 59.7 bits (143), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 86/198 (43%), Gaps = 29/198 (14%)

Query: 124 WQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLS-KSRASDIAKPPGVWKLLSKA 182
           + +L +GA  G       +P+D ++TR  +Q+AN   LS K+  S I+            
Sbjct: 34  YHQLIAGAFAGIMEHSVMFPIDALKTR--IQSANAKSLSAKNMLSQISH----------- 80

Query: 183 YAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFM--PSDENGNSSMRDSLYKLSM 240
            +   G + L++GV    LG  P  A+ F  YE  K+ +   SD   +   + ++     
Sbjct: 81  ISTSEGTLALWKGVQSVILGAGPAHAVYFGTYEFCKKNLIDSSDTQTHHPFKTAI----S 136

Query: 241 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLT 300
           GA +   +  +  PFD +++R Q+             SVW     I ++EG   +Y    
Sbjct: 137 GACATTASDALMNPFDTIKQRIQLNTSA---------SVWQTTKQIYQSEGLAAFYYSYP 187

Query: 301 ANLFKVVPSTAVSWLVYE 318
             L   +P  A ++++YE
Sbjct: 188 TTLVMNIPFAAFNFVIYE 205

>Scas_691.4
          Length = 334

 Score = 98.6 bits (244), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 83/319 (26%), Positives = 133/319 (41%), Gaps = 31/319 (9%)

Query: 17  NFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQ-VYKEE 75
           N  K    +  +AGG AG        P + +K+ +Q+   T       F   G+ +Y  E
Sbjct: 7   NDKKSSPLINLVAGGTAGLFEALCCHPLDTIKVRMQIAKRTEGMRPHGFITTGRNIYSHE 66

Query: 76  NIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGG 135
               L++G G   I + P  A++F  +E  +  +   +T+     +       +G   G 
Sbjct: 67  GFLALYKGLGAVVIGIIPKMAIRFSSYEFYRNALTDKETR----TITTGNTFLAGVGAGI 122

Query: 136 C-SVVATYPLDLVRTRLSVQTAN-----LSKLSKSRASDIAKPPGVWKLLSKAYA--EEG 187
             +V+   P+++V+ RL  Q  N      + +S +  +     P     +  AY   +E 
Sbjct: 123 TEAVLVVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIVKEE 182

Query: 188 GIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSL---YKLSMGAIS 244
           G   LYRGV  T+         NF VY  LK+++    N     R+SL       +G IS
Sbjct: 183 GAGALYRGVSLTAARQATNQGANFTVYSYLKDYLQKYHN-----RESLPSWETSCIGLIS 237

Query: 245 GGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIG----KTEGFKGYYKGLT 300
           G +      P D ++ R Q       +     NS W  +  IG    K EGF+  YKG+T
Sbjct: 238 GAIGPFSNAPLDTIKTRLQ------KDKSISSNSAWKKIYIIGTQLIKEEGFRALYKGIT 291

Query: 301 ANLFKVVPSTAVSWLVYEL 319
             + +V P  AV++ VYE 
Sbjct: 292 PRVMRVAPGQAVTFTVYEF 310

 Score = 63.5 bits (153), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 62/224 (27%), Positives = 93/224 (41%), Gaps = 43/224 (19%)

Query: 23  TNVAFLAG---GIAGAISRTVVSPFERVKILLQVQ----------------SSTTAYNKG 63
           T   FLAG   GI  A+   VV+P E VKI LQ Q                ++ T     
Sbjct: 110 TGNTFLAGVGAGITEAV--LVVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPK 167

Query: 64  LFDAIGQVY---KEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQ 120
             +AI   Y   KEE    L+RG  L   R        F V+   K ++     +   E 
Sbjct: 168 YANAIHAAYTIVKEEGAGALYRGVSLTAARQATNQGANFTVYSYLKDYLQKYHNR---ES 224

Query: 121 LNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWK--- 177
           L +W+    G + G     +  PLD ++TRL        +  KS +S+ A     WK   
Sbjct: 225 LPSWETSCIGLISGAIGPFSNAPLDTIKTRL--------QKDKSISSNSA-----WKKIY 271

Query: 178 LLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFM 221
           ++     +E G   LY+G+ P  + + P  A+ F VYE +++ +
Sbjct: 272 IIGTQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRKHL 315

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/213 (19%), Positives = 86/213 (40%), Gaps = 32/213 (15%)

Query: 127 LFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEE 186
           L +G   G    +  +PLD ++ R+ +          ++ ++  +P G        Y+ E
Sbjct: 17  LVAGGTAGLFEALCCHPLDTIKVRMQI----------AKRTEGMRPHGFITTGRNIYSHE 66

Query: 187 GGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGG 246
           G  + LY+G+    +GI+P +A+ F+ YE  +  +   E    +  ++     +  +  G
Sbjct: 67  G-FLALYKGLGAVVIGIIPKMAIRFSSYEFYRNALTDKETRTITTGNTF----LAGVGAG 121

Query: 247 VAQTI--TYPFDLLRRRFQVLAM--------GGNELGF-------HYNSVWDALVTIGKT 289
           + + +    P ++++ R Q   +        G +  G         Y +   A  TI K 
Sbjct: 122 ITEAVLVVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIVKE 181

Query: 290 EGFKGYYKGLTANLFKVVPSTAVSWLVYELTWD 322
           EG    Y+G++    +   +   ++ VY    D
Sbjct: 182 EGAGALYRGVSLTAARQATNQGANFTVYSYLKD 214

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score = 95.1 bits (235), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 95/312 (30%), Positives = 137/312 (43%), Gaps = 44/312 (14%)

Query: 26  AFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGL----FDAIGQVYKEENIKGLF 81
           +F AGG+A  I+ TV +P E VKI +Q+Q    A N+ +    F A+G V++ E I+GL 
Sbjct: 21  SFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQ 80

Query: 82  RG--------NGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALC 133
           +G          LN  R+  Y  ++ V+        F+ D +    Q +    +F+GA  
Sbjct: 81  KGLVAAYIYQIALNGSRLGFYEPIRAVM-----NKTFYPDQESHKVQ-SVGINVFAGAAS 134

Query: 134 GGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKP---PGVWKLLSKAYAEEGGIM 190
           G    V   PL LV+TRL          S S A  I +     GVW  L   Y  E G+ 
Sbjct: 135 GIIGAVMGSPLFLVKTRLQ---------SYSNAIKIGEQTHYTGVWNGLKTIYMTE-GVK 184

Query: 191 GLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRD--SLYKLSMGAISGGVA 248
           GL+RG+    L      ++   +Y   K F+      N  M D  SL+ L+   ISG   
Sbjct: 185 GLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLR----NDIMEDGPSLH-LTASTISGLGV 239

Query: 249 QTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVP 308
             +  P+D++  R        N+ G  Y    D LV   K EG    YKG  A +F++ P
Sbjct: 240 AVVMNPWDVILTRIY------NQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGP 293

Query: 309 STAVSWLVYELT 320
            T +     E T
Sbjct: 294 HTILCLTFLEQT 305

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/212 (22%), Positives = 91/212 (42%), Gaps = 22/212 (10%)

Query: 115 KGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPG 174
           K   ++++ +    +G L    +V  T P+++V+ R+ +Q     +L  +       P  
Sbjct: 10  KSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQ----GELMAANQRIYTNP-- 63

Query: 175 VWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQL-----KEFMPSDENGNS 229
            ++ +   +  EG I GL +G+    +  +         YE +     K F P  E+   
Sbjct: 64  -FQAMGVVFRNEG-IRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQES--H 119

Query: 230 SMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQ----VLAMGGNELGFHYNSVWDALVT 285
            ++     +  GA SG +   +  P  L++ R Q     + +G      HY  VW+ L T
Sbjct: 120 KVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQT---HYTGVWNGLKT 176

Query: 286 IGKTEGFKGYYKGLTANLFKVVPSTAVSWLVY 317
           I  TEG KG ++G+ A + +    ++V   +Y
Sbjct: 177 IYMTEGVKGLFRGIDAAILRTGAGSSVQLPIY 208

>Kwal_23.4731
          Length = 314

 Score = 94.0 bits (232), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 76/307 (24%), Positives = 146/307 (47%), Gaps = 32/307 (10%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEEN-----IKGLFR 82
           +AG  AG ++     P + VK+ LQ+  +TT ++ G  + I  + ++        +  +R
Sbjct: 18  IAGLAAGTLTTIATHPLDLVKLRLQLLVNTT-HSHGYKEVIKTIIRDSKADSNVFREAYR 76

Query: 83  GNGLNCIRVFPYSAVQFVVFEGCKKHIFHVD-TKGKGEQLNNWQR---------LFSGAL 132
           G G+N I       + F ++   K  ++     + K    +++Q+         L S AL
Sbjct: 77  GLGVNLIGNSIAWGLYFGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKAMGPSLYLASAAL 136

Query: 133 CGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGL 192
            G  + + T P+ +++TR+   ++  S+  K+           W  + K YA EG   G 
Sbjct: 137 SGLGTAILTNPIWVIKTRIMSTSSQASERYKT----------TWDGIRKVYAHEG-FSGF 185

Query: 193 YRGVWPTSLGIVPYVALNFAVYEQLK-EFMPSDENGNSSMRDSLYKLSMGAISGGVAQTI 251
           +RG+ P+  G V   A+ F +Y+ L+ ++             +L  +++ ++S  ++ T 
Sbjct: 186 WRGLVPSLFG-VAQGAIYFTIYDSLRHQYFARRGITEDEKMGNLENIAITSVSKMLSVTA 244

Query: 252 TYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTA 311
            YPF LL+   Q  A       + +   W+ + +I + EG +G YKGL+ANL + +PST 
Sbjct: 245 VYPFQLLKSNLQSFAAVEKRDSYRF---WNLVKSIHQKEGLQGLYKGLSANLLRAIPSTC 301

Query: 312 VSWLVYE 318
           +++ +YE
Sbjct: 302 ITFCIYE 308

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 42/194 (21%), Positives = 85/194 (43%), Gaps = 13/194 (6%)

Query: 29  AGGIAGAISRTVVSPFERVKI-LLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLN 87
           +  ++G  +  + +P   +K  ++   S  +   K  +D I +VY  E   G +RG   +
Sbjct: 133 SAALSGLGTAILTNPIWVIKTRIMSTSSQASERYKTTWDGIRKVYAHEGFSGFWRGLVPS 192

Query: 88  CIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLV 147
              V    A+ F +++  +   F      + E++ N + +   ++    SV A YP  L+
Sbjct: 193 LFGV-AQGAIYFTIYDSLRHQYFARRGITEDEKMGNLENIAITSVSKMLSVTAVYPFQLL 251

Query: 148 RTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYV 207
           ++       NL   +     D  +    W L+   + +EG + GLY+G+    L  +P  
Sbjct: 252 KS-------NLQSFAAVEKRDSYR---FWNLVKSIHQKEG-LQGLYKGLSANLLRAIPST 300

Query: 208 ALNFAVYEQLKEFM 221
            + F +YE L+ ++
Sbjct: 301 CITFCIYENLRHWL 314

 Score = 53.5 bits (127), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 51/207 (24%), Positives = 91/207 (43%), Gaps = 27/207 (13%)

Query: 125 QRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRA-SDIAKPPGVWKLLSKAY 183
           + + +G   G  + +AT+PLDLV+ RL +    L   + S    ++ K      ++  + 
Sbjct: 15  REIIAGLAAGTLTTIATHPLDLVKLRLQL----LVNTTHSHGYKEVIKT-----IIRDSK 65

Query: 184 AEEGGIMGLYRGVWPTSLGIVPYVALNFAVYE------------QLKEFMPSDENGNSSM 231
           A+       YRG+    +G      L F +Y             Q+K    S    + +M
Sbjct: 66  ADSNVFREAYRGLGVNLIGNSIAWGLYFGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKAM 125

Query: 232 RDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEG 291
             SLY L+  A+SG     +T P  +++ R    +   +E    Y + WD +  +   EG
Sbjct: 126 GPSLY-LASAALSGLGTAILTNPIWVIKTRIMSTSSQASE---RYKTTWDGIRKVYAHEG 181

Query: 292 FKGYYKGLTANLFKVVPSTAVSWLVYE 318
           F G+++GL  +LF V    A+ + +Y+
Sbjct: 182 FSGFWRGLVPSLFGVAQG-AIYFTIYD 207

>Kwal_33.14050
          Length = 314

 Score = 93.6 bits (231), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 75/303 (24%), Positives = 125/303 (41%), Gaps = 40/303 (13%)

Query: 29  AGGIAGAISRTVVSPFERVKILLQVQSST-------TAYNKGLFDAIGQVYKEENIKGLF 81
           AG  AG +  +++ P + +K  +Q  S+T             +   I ++   E    L+
Sbjct: 22  AGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARISTTEGSMALW 81

Query: 82  RGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVAT 141
           +G     +   P  AV F  +E CK ++         +     Q L + A     +V A 
Sbjct: 82  KGVQSVILGAGPAHAVYFATYEMCKSYLI------DPQDFQTHQPLKTAASGIAATVAAD 135

Query: 142 Y---PLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWP 198
               P D ++ R+ ++T      SK R         +W + S+ Y  EG     Y   +P
Sbjct: 136 LLMNPFDTIKQRMQLRT-----FSKDR---------MWSVASRIYRNEGLAAFFYS--YP 179

Query: 199 TSLGI-VPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDL 257
           T++ + +P+ A NFA+YE   +F   +   N      L     G ISG     IT P D 
Sbjct: 180 TTIAMNIPFAAFNFAIYESATKFFNPENTYNP-----LIHCLCGGISGATCAAITTPLDC 234

Query: 258 LRRRFQVLAMGG--NELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWL 315
           ++   QV       + L    ++   A   I K  G+ G+++GL   +   +P+TA+SW 
Sbjct: 235 IKTVLQVRGSESVVDPLFRQADTFSRAASAISKVYGWSGFWRGLKPRIISNMPATAISWT 294

Query: 316 VYE 318
            YE
Sbjct: 295 AYE 297

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 45/196 (22%), Positives = 88/196 (44%), Gaps = 18/196 (9%)

Query: 125 QRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYA 184
            +L +GA  G       +P+D ++TR+   +A +   S + A+ +  P  + + +++   
Sbjct: 18  HQLAAGAFAGIMEHSIMFPIDAIKTRMQALSATIG--SANAAAKL--PSNIVQQIARIST 73

Query: 185 EEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFM--PSDENGNSSMRDSLYKLSMGA 242
            EG  M L++GV    LG  P  A+ FA YE  K ++  P D   +  ++ +    + G 
Sbjct: 74  TEGS-MALWKGVQSVILGAGPAHAVYFATYEMCKSYLIDPQDFQTHQPLKTA----ASGI 128

Query: 243 ISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTAN 302
            +   A  +  PFD +++R Q+         F  + +W     I + EG   ++      
Sbjct: 129 AATVAADLLMNPFDTIKQRMQLRT-------FSKDRMWSVASRIYRNEGLAAFFYSYPTT 181

Query: 303 LFKVVPSTAVSWLVYE 318
           +   +P  A ++ +YE
Sbjct: 182 IAMNIPFAAFNFAIYE 197

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/192 (21%), Positives = 80/192 (41%), Gaps = 16/192 (8%)

Query: 29  AGGIAGAISRTV-VSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLN 87
           A GIA  ++  + ++PF+ +K  +Q++   T     ++    ++Y+ E +   F      
Sbjct: 125 ASGIAATVAADLLMNPFDTIKQRMQLR---TFSKDRMWSVASRIYRNEGLAAFFYSYPTT 181

Query: 88  CIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLV 147
                P++A  F ++E   K     +T       N       G + G      T PLD +
Sbjct: 182 IAMNIPFAAFNFAIYESATKFFNPENT------YNPLIHCLCGGISGATCAAITTPLDCI 235

Query: 148 RTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYV 207
           +T L V+       S+S    + +    +   + A ++  G  G +RG+ P  +  +P  
Sbjct: 236 KTVLQVRG------SESVVDPLFRQADTFSRAASAISKVYGWSGFWRGLKPRIISNMPAT 289

Query: 208 ALNFAVYEQLKE 219
           A+++  YE  K 
Sbjct: 290 AISWTAYECAKH 301

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 43/87 (49%), Gaps = 3/87 (3%)

Query: 236 YKLSMGAISGGVAQTITYPFDLLRRRFQVLAM---GGNELGFHYNSVWDALVTIGKTEGF 292
           ++L+ GA +G +  +I +P D ++ R Q L+      N      +++   +  I  TEG 
Sbjct: 18  HQLAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARISTTEGS 77

Query: 293 KGYYKGLTANLFKVVPSTAVSWLVYEL 319
              +KG+ + +    P+ AV +  YE+
Sbjct: 78  MALWKGVQSVILGAGPAHAVYFATYEM 104

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 51/110 (46%), Gaps = 18/110 (16%)

Query: 12  ENQLKNFLKQDTN---VAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLF--- 65
           E+  K F  ++T    +  L GGI+GA    + +P + +K +LQV+ S +  +  LF   
Sbjct: 197 ESATKFFNPENTYNPLIHCLCGGISGATCAAITTPLDCIKTVLQVRGSESVVDP-LFRQA 255

Query: 66  -------DAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKH 108
                   AI +VY      G +RG     I   P +A+ +  +E C KH
Sbjct: 256 DTFSRAASAISKVY---GWSGFWRGLKPRIISNMPATAISWTAYE-CAKH 301

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 92.8 bits (229), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 79/299 (26%), Positives = 127/299 (42%), Gaps = 37/299 (12%)

Query: 27  FLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGL 86
            LAG  AG +  +++ P + +K  +Q      A + G+   I ++   E    L++G   
Sbjct: 27  LLAGAFAGIMEHSLMFPIDALKTRVQAAGLNKAASTGMISQISKISTMEGSMALWKGVQS 86

Query: 87  NCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVAT----Y 142
             +   P  AV F  +E CK  +         E +   Q +   AL G  + +A      
Sbjct: 87  VILGAGPAHAVYFGTYEFCKARLI------SPEDMQTHQPM-KTALSGTIATIAADALMN 139

Query: 143 PLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLG 202
           P D V+ RL + T NL                VW +  + Y  EG     Y   +PT+L 
Sbjct: 140 PFDTVKQRLQLDT-NLR---------------VWNVTKQIYQNEGFAAFYYS--YPTTLA 181

Query: 203 I-VPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRR 261
           + +P+ A NF +YE   +F     N  +S    ++ L  G ISG     +T P D ++  
Sbjct: 182 MNIPFAAFNFMIYESASKFF----NPQNSYNPLIHCLC-GGISGATCAALTTPLDCIKTV 236

Query: 262 FQVLAMG--GNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
            QV        E+    N+   A   I +  G+KG+++GL   +   +P+TA+SW  YE
Sbjct: 237 LQVRGSETVSIEIMKDANTFGRASRAILEVHGWKGFWRGLKPRIVANIPATAISWTAYE 295

 Score = 65.5 bits (158), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 87/195 (44%), Gaps = 27/195 (13%)

Query: 126 RLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAE 185
           +L +GA  G       +P+D ++TR  VQ A L+K + +         G+   +SK    
Sbjct: 26  QLLAGAFAGIMEHSLMFPIDALKTR--VQAAGLNKAAST---------GMISQISKISTM 74

Query: 186 EGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFM--PSDENGNSSMRDSLYKLSMGAI 243
           EG  M L++GV    LG  P  A+ F  YE  K  +  P D   +  M+ +L     G I
Sbjct: 75  EGS-MALWKGVQSVILGAGPAHAVYFGTYEFCKARLISPEDMQTHQPMKTALS----GTI 129

Query: 244 SGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANL 303
           +   A  +  PFD +++R Q+       L      VW+    I + EGF  +Y      L
Sbjct: 130 ATIAADALMNPFDTVKQRLQL----DTNL-----RVWNVTKQIYQNEGFAAFYYSYPTTL 180

Query: 304 FKVVPSTAVSWLVYE 318
              +P  A ++++YE
Sbjct: 181 AMNIPFAAFNFMIYE 195

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 83/194 (42%), Gaps = 17/194 (8%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLN 87
           L+G IA   +  +++PF+ VK  LQ+ +     N  +++   Q+Y+ E     +      
Sbjct: 125 LSGTIATIAADALMNPFDTVKQRLQLDT-----NLRVWNVTKQIYQNEGFAAFYYSYPTT 179

Query: 88  CIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLV 147
                P++A  F+++E   K              N       G + G      T PLD +
Sbjct: 180 LAMNIPFAAFNFMIYESASKFF------NPQNSYNPLIHCLCGGISGATCAALTTPLDCI 233

Query: 148 RTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYV 207
           +T L V+       S++ + +I K    +   S+A  E  G  G +RG+ P  +  +P  
Sbjct: 234 KTVLQVRG------SETVSIEIMKDANTFGRASRAILEVHGWKGFWRGLKPRIVANIPAT 287

Query: 208 ALNFAVYEQLKEFM 221
           A+++  YE  K F+
Sbjct: 288 AISWTAYECAKHFL 301

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score = 92.8 bits (229), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 80/306 (26%), Positives = 138/306 (45%), Gaps = 27/306 (8%)

Query: 27  FLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFR---- 82
            ++G  AG I+     P + VK+ LQ+ + T    +G +D + ++ K+      FR    
Sbjct: 12  MISGLTAGTITTVSTHPLDLVKVRLQLLA-TNKKPQGYYDVVKRIVKDSKQHSFFRETYR 70

Query: 83  GNGLNCI--------RVFPYSAVQFVVFEGCKKHIFHVD-TKGKGEQLNNWQRLFSGALC 133
           G G+N +            Y A +  VF+ C   +   + T    +++ +   L + A+ 
Sbjct: 71  GLGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKEMTSLMYLLAAAMS 130

Query: 134 GGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLY 193
           G  + V T P+ +++TR+   +   S+  +S    I           K Y  EG + G +
Sbjct: 131 GVATSVLTNPIWVIKTRIMSTSFVDSRSYRSTVDGI----------KKLYRIEG-LAGFW 179

Query: 194 RGVWPTSLGIVPYVALNFAVYEQLK-EFMPSDENGNSSMRDSLYKLSMGAISGGVAQTIT 252
           RG+ P+  G V   A+ F VY+ LK  +  +          +L  +++ ++S  V+ T  
Sbjct: 180 RGLVPSLFG-VSQGAIYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITITSLSKMVSVTAV 238

Query: 253 YPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAV 312
           YP  LL+   Q   +         + VW  + TI   +G  G YKGL ANL + VPST +
Sbjct: 239 YPLQLLKSNLQSFEVSTVINPKTSHRVWKLITTIYVRDGVTGLYKGLLANLIRAVPSTCI 298

Query: 313 SWLVYE 318
           ++ VYE
Sbjct: 299 TFCVYE 304

 Score = 74.7 bits (182), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 55/215 (25%), Positives = 104/215 (48%), Gaps = 11/215 (5%)

Query: 9   IEEENQLKNFLKQDTNVAFL-AGGIAGAISRTVVSPFERVKILLQVQSSTTAYN-KGLFD 66
           ++  N   N  K+ T++ +L A  ++G  +  + +P   +K  +   S   + + +   D
Sbjct: 105 VKRFNNTMNNDKEMTSLMYLLAAAMSGVATSVLTNPIWVIKTRIMSTSFVDSRSYRSTVD 164

Query: 67  AIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQR 126
            I ++Y+ E + G +RG   +   V    A+ F V++  K H F      K ++L+N + 
Sbjct: 165 GIKKLYRIEGLAGFWRGLVPSLFGV-SQGAIYFTVYDTLKYHYFAAKHVDKKKKLSNLEY 223

Query: 127 LFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEE 186
           +   +L    SV A YPL L+++ L  Q+  +S +   + S       VWKL++  Y  +
Sbjct: 224 ITITSLSKMVSVTAVYPLQLLKSNL--QSFEVSTVINPKTSH-----RVWKLITTIYVRD 276

Query: 187 GGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFM 221
           G + GLY+G+    +  VP   + F VYE  + ++
Sbjct: 277 G-VTGLYKGLLANLIRAVPSTCITFCVYENFRHWL 310

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 87/208 (41%), Gaps = 31/208 (14%)

Query: 125 QRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPG---VWKLLSK 181
           + + SG   G  + V+T+PLDLV+ RL +   N             KP G   V K + K
Sbjct: 10  KEMISGLTAGTITTVSTHPLDLVKVRLQLLATN------------KKPQGYYDVVKRIVK 57

Query: 182 AYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFM-----------PSDENGNSS 230
              +       YRG+    LG      L F +Y   K+++            +  N +  
Sbjct: 58  DSKQHSFFRETYRGLGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKE 117

Query: 231 MRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTE 290
           M   +Y L+  A+SG     +T P  +++ R    +   +     Y S  D +  + + E
Sbjct: 118 MTSLMYLLA-AAMSGVATSVLTNPIWVIKTRIMSTSFVDSR---SYRSTVDGIKKLYRIE 173

Query: 291 GFKGYYKGLTANLFKVVPSTAVSWLVYE 318
           G  G+++GL  +LF  V   A+ + VY+
Sbjct: 174 GLAGFWRGLVPSLFG-VSQGAIYFTVYD 200

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 93.6 bits (231), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 93/337 (27%), Positives = 145/337 (43%), Gaps = 44/337 (13%)

Query: 12  ENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYN---------- 61
           EN+ +N       V F+AGGI G     +  PF+ VK  LQ      AY           
Sbjct: 38  ENKKENHPHVAPWVHFVAGGIGGMAGAIITCPFDVVKTRLQSDVFHGAYKTQATARTNVV 97

Query: 62  -KGLFD------AIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDT 114
            +GL         I  VY +E  + LF+G G N + V P  ++ F  +   K     +  
Sbjct: 98  YQGLMHFRETVGIIQNVYTQEGFRSLFKGLGPNLVGVIPARSINFFTYGVTKDTASRLLN 157

Query: 115 KGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPG 174
            G   Q   W    +GA  G  +  AT P+ LV+TRL +  A   +  + + S       
Sbjct: 158 DG---QEAPWIHFLAGATAGWATSTATNPIWLVKTRLQLDKAADGRSRRYKNS------- 207

Query: 175 VWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMP----------SD 224
            W  L K      GI+GLY+G+  + LG V  + L + +YEQ+K  +           S+
Sbjct: 208 -WDCL-KGVMRNEGILGLYKGLSASYLGSVESI-LQWVLYEQMKHIIRQRSIEEFGDISE 264

Query: 225 ENGNSSMRDSLYKLSMGAISGG--VAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDA 282
           EN  + M+   +    G+       A  +TYP +++R R +       +L   Y  ++ +
Sbjct: 265 ENKTTYMKVKEWCQRSGSAGAAKLFASILTYPHEVVRTRLRQAPKENGKL--KYTGLFQS 322

Query: 283 LVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYEL 319
              I K EGF   Y GLT +L + VP++ + +  +EL
Sbjct: 323 FSLIIKEEGFASMYSGLTPHLMRTVPNSIIMFGTWEL 359

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 40/84 (47%), Gaps = 13/84 (15%)

Query: 252 TYPFDLLRRRFQVLAMGG---NELGFHYNSVWDALVTIGKT----------EGFKGYYKG 298
           T PFD+++ R Q     G    +     N V+  L+   +T          EGF+  +KG
Sbjct: 67  TCPFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKG 126

Query: 299 LTANLFKVVPSTAVSWLVYELTWD 322
           L  NL  V+P+ ++++  Y +T D
Sbjct: 127 LGPNLVGVIPARSINFFTYGVTKD 150

>Kwal_27.12081
          Length = 369

 Score = 93.6 bits (231), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 80/310 (25%), Positives = 137/310 (44%), Gaps = 47/310 (15%)

Query: 40  VVSPFERVKILLQ------------------VQSSTTAYNKGLFDAIGQVYKEENIKGLF 81
           V  PF+ VK  LQ                  V SS   + +  F  I  +YK E  + LF
Sbjct: 69  VTCPFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRETFGIISNLYKLEGFRSLF 128

Query: 82  RGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVAT 141
           +G G N + V P  ++ F  + G  K I+       GE+   W  L S A  G  +  AT
Sbjct: 129 KGLGPNLVGVIPARSINFFTY-GTTKQIYS-RAFNNGEEA-PWIHLISAATAGWATSTAT 185

Query: 142 YPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSL 201
            P+ L++TRL +  A  ++  K+           W  L     +E G  GLY+G+  + L
Sbjct: 186 NPIWLIKTRLQLDKAGHTRQYKNS----------WDCLKHIIQKE-GFFGLYKGLSASYL 234

Query: 202 GIVPYVALNFAVYEQLKEFMP------------SDENGNSSMRDSLYKLSMGAISGGVAQ 249
           G V  + L + +YEQ+K+ +              ++N +  +++   +     ++  +A 
Sbjct: 235 GSVEGI-LQWLLYEQMKQMIKMRSIEKFGHISEGEKNTSEKIKEWCQRSGSAGLAKFLAS 293

Query: 250 TITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPS 309
            +TYP +++R R +   +  ++L   Y  +  +   I K EG    Y GLT +L + VP+
Sbjct: 294 IVTYPHEVVRTRLRQAPLENDKL--KYTGLIQSFRVIIKEEGLASMYGGLTPHLLRTVPN 351

Query: 310 TAVSWLVYEL 319
           + + +  +EL
Sbjct: 352 SIIMFGTWEL 361

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 85/187 (45%), Gaps = 14/187 (7%)

Query: 139 VATYPLDLVRTRLSVQT-----ANLS--KLSKSRASDIAKPPGVWKLLSKAYAEEGGIMG 191
           + T P D+V+TRL         ANLS  K S   +S I      + ++S  Y  E G   
Sbjct: 68  IVTCPFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRETFGIISNLYKLE-GFRS 126

Query: 192 LYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTI 251
           L++G+ P  +G++P  ++NF  Y   K+        N+        L   A +G    T 
Sbjct: 127 LFKGLGPNLVGVIPARSINFFTYGTTKQIY--SRAFNNGEEAPWIHLISAATAGWATSTA 184

Query: 252 TYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTA 311
           T P  L++ R Q+   G       Y + WD L  I + EGF G YKGL+A+    V    
Sbjct: 185 TNPIWLIKTRLQLDKAGHTR---QYKNSWDCLKHIIQKEGFFGLYKGLSASYLGSVEGI- 240

Query: 312 VSWLVYE 318
           + WL+YE
Sbjct: 241 LQWLLYE 247

 Score = 36.6 bits (83), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 36/84 (42%), Gaps = 14/84 (16%)

Query: 251 ITYPFDLLRRRFQVLAMGGNELGF--------------HYNSVWDALVTIGKTEGFKGYY 296
           +T PFD+++ R Q                         H+   +  +  + K EGF+  +
Sbjct: 69  VTCPFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRETFGIISNLYKLEGFRSLF 128

Query: 297 KGLTANLFKVVPSTAVSWLVYELT 320
           KGL  NL  V+P+ ++++  Y  T
Sbjct: 129 KGLGPNLVGVIPARSINFFTYGTT 152

>Scas_640.25
          Length = 306

 Score = 92.4 bits (228), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 87/303 (28%), Positives = 132/303 (43%), Gaps = 39/303 (12%)

Query: 27  FLAGGIAGAISRTVVSPFERVKILLQVQSSTTA------YNKGLFDAIGQVYKEENIKGL 80
           F+AG IAG     V+ P + VK  +Q+Q ST A      + KG+ D + Q+ K+E    +
Sbjct: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHM 76

Query: 81  FRGNGLNCIRVFPYSAVQFVV---FEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCS 137
           ++G     +   P  AV+F     F    K +F        +QL     + SGA  G   
Sbjct: 77  YKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGT------KQLTQQISVLSGASAGITE 130

Query: 138 VVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVW 197
            +   P +LV+ RL  Q  N         S    P  V K + K    + G+ GLY GV 
Sbjct: 131 ALVIVPFELVKIRL--QDVN---------SKFKGPVEVLKHIIK----QDGLKGLYSGVE 175

Query: 198 PTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDL 257
            T      + A  F V  Q++E +P  ++     R+ L     G + G        PFD+
Sbjct: 176 STVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDL---CAGFVGGTFGVMFNTPFDV 232

Query: 258 LRRRFQVLAMGGNEL--GFH-YNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSW 314
           ++ R Q     GNE+  G   YN  W +++ I   EGF+  YKG    + ++ P  AV  
Sbjct: 233 VKSRIQ---SDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLL 289

Query: 315 LVY 317
           +V+
Sbjct: 290 VVF 292

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 84/180 (46%), Gaps = 15/180 (8%)

Query: 126 RLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAE 185
           +  +GA+ G   ++  YPLD+V+TR+ +Q +     + +  +      GV   LS+   +
Sbjct: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVS-----TGAAGASATHYKGVIDCLSQIVKK 70

Query: 186 EGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISG 245
           EG  M +Y+G+    L   P  A+ FA  ++  +   S   G   +   +  LS GA +G
Sbjct: 71  EGP-MHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKS-VFGTKQLTQQISVLS-GASAG 127

Query: 246 GVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFK 305
                +  PF+L++ R Q       ++   +    + L  I K +G KG Y G+ + +++
Sbjct: 128 ITEALVIVPFELVKIRLQ-------DVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWR 180

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 53/192 (27%), Positives = 87/192 (45%), Gaps = 17/192 (8%)

Query: 24  NVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRG 83
            ++ L+G  AG     V+ PFE VKI LQ      +  KG  + +  + K++ +KGL+ G
Sbjct: 117 QISVLSGASAGITEALVIVPFELVKIRLQ---DVNSKFKGPVEVLKHIIKQDGLKGLYSG 173

Query: 84  NGLNCIRVFPYSAVQF-VVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATY 142
                 R   ++A  F V+F+   + +  V  K K E+  N   L +G + G   V+   
Sbjct: 174 VESTVWRNAVWNAGYFGVIFQ--VRELLPV-AKSKQEKTRN--DLCAGFVGGTFGVMFNT 228

Query: 143 PLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLG 202
           P D+V++R+      +        + + K    W  + K Y EE G   LY+G  P  L 
Sbjct: 229 PFDVVKSRIQSDGNEI-------INGVRKYNWTWPSVMKIYHEE-GFRALYKGFVPKVLR 280

Query: 203 IVPYVALNFAVY 214
           + P  A+   V+
Sbjct: 281 LGPGGAVLLVVF 292

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 44/96 (45%), Gaps = 3/96 (3%)

Query: 221 MPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGG--NELGFHYNS 278
           M S+ N  + +    Y+   GAI+G     + YP D+++ R Q+    G       HY  
Sbjct: 1   MSSNHNTQAPL-PFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKG 59

Query: 279 VWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSW 314
           V D L  I K EG    YKG+++ +    P  AV +
Sbjct: 60  VIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKF 95

>Kwal_26.8669
          Length = 296

 Score = 91.7 bits (226), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 79/304 (25%), Positives = 133/304 (43%), Gaps = 36/304 (11%)

Query: 27  FLAGGIAGAISRTVVSPFERVKILLQVQSS--TTAYNKGLFDAIGQVYKEENIKGLFRGN 84
           F AG +AG     V+ P + VK  +Q+Q S       KG+ D I Q+  +E    L++G 
Sbjct: 13  FAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGI 72

Query: 85  GLNCIRVFPYSAVQFVV---FEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVAT 141
               +   P  A +F     F+   K  F V      E+L     + SGA  G C     
Sbjct: 73  SSPVLMEAPKRATKFACNDEFQKIYKREFGV------EKLTQSLSILSGASAGCCEAFVV 126

Query: 142 YPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSL 201
            P +LV+ RL   +++                G   ++ K  A+EG ++ +Y G+  T  
Sbjct: 127 VPFELVKIRLQDVSSSYK--------------GPIDVVRKIIAQEG-VLAMYNGLESTLW 171

Query: 202 GIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRR 261
               + A  F +  Q++  +P  ++ +   R+ L     G+I G +   ++ PFD+++ R
Sbjct: 172 RHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIA---GSIGGTIGSLMSTPFDVVKSR 228

Query: 262 FQ---VLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
            Q   V+A G  +    YN  W ++ TI K EGF+  YKG    + ++ P   +  +V+ 
Sbjct: 229 IQNTAVVAGGARK----YNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFT 284

Query: 319 LTWD 322
              D
Sbjct: 285 GCMD 288

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/206 (26%), Positives = 86/206 (41%), Gaps = 26/206 (12%)

Query: 20  KQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKG 79
           K   +++ L+G  AG     VV PFE VKI LQ  SS+    KG  D + ++  +E +  
Sbjct: 105 KLTQSLSILSGASAGCCEAFVVVPFELVKIRLQDVSSS---YKGPIDVVRKIIAQEGVLA 161

Query: 80  LFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHV-----DTKGKGEQLNNWQRLFSGALCG 134
           ++ G      R   ++A  F +       IF V     + K K +Q  N   L +G++ G
Sbjct: 162 MYNGLESTLWRHGVWNAGYFGI-------IFQVRALLPEAKSKSQQTRN--DLIAGSIGG 212

Query: 135 GCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYR 194
               + + P D+V++R+           K   S        W  +   Y EE G   LY+
Sbjct: 213 TIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWS--------WPSIFTIYKEE-GFRALYK 263

Query: 195 GVWPTSLGIVPYVALNFAVYEQLKEF 220
           G  P  L + P   +   V+    +F
Sbjct: 264 GFVPKVLRLGPGGGILLVVFTGCMDF 289

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 39/80 (48%), Gaps = 2/80 (2%)

Query: 235 LYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKG 294
            Y+ + GA++G     + YP D+++ R Q+   GG  LG  Y  V D +  I   EG   
Sbjct: 10  FYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGG--LGPQYKGVVDCIKQIVAKEGASR 67

Query: 295 YYKGLTANLFKVVPSTAVSW 314
            YKG+++ +    P  A  +
Sbjct: 68  LYKGISSPVLMEAPKRATKF 87

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 92.0 bits (227), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 97/358 (27%), Positives = 153/358 (42%), Gaps = 70/358 (19%)

Query: 3   EVILPAIEEENQ--LKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAY 60
            + LP I++++Q  +K +      V F+AGGI G     V  PF+ VK  LQ     T Y
Sbjct: 34  RISLPTIKDDSQPAVKPW------VHFVAGGIGGMAGAIVTCPFDVVKTRLQSDVFRTQY 87

Query: 61  N----------------------KGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQ 98
                                  K  F  IG VY++E  + LF+G G N + V P  ++ 
Sbjct: 88  KSAAMQNNGSSTLHFVSRSLLHFKETFGIIGNVYRQEGFRSLFKGLGPNLVGVIPARSIN 147

Query: 99  FVVFEGCKKHIFHVDTKGKGEQLNN-----WQRLFSGALCGGCSVVATYPLDLVRTRLSV 153
           F+ + G  K I+          LNN     W  L + A  G  +   T P+ LV+TRL +
Sbjct: 148 FLTY-GTTKDIY-------SRTLNNGQEAPWIHLLAAATAGWATSTVTNPIWLVKTRLQL 199

Query: 154 QTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAV 213
             A  +K  K+    I           K+  +  G++GLY+G+  + LG V  + L + +
Sbjct: 200 DKAG-TKTYKNSLDCI-----------KSVVKNEGVLGLYKGLSASYLGSVEGI-LQWIL 246

Query: 214 YEQLKEFMPSD--------ENGNSSMRDSLYKLSMGAISGG----VAQTITYPFDLLRRR 261
           YEQ+K  +                S  D + +    + S G    VA  +TYP +++R R
Sbjct: 247 YEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEWCQRSGSAGLAKFVASIVTYPHEVVRTR 306

Query: 262 FQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYEL 319
            +       +L   Y  +  +   I K EG    Y GLT +L + VP++ + +  +EL
Sbjct: 307 LRQAPTENGKL--KYTGLVQSFRVIIKEEGLVSMYSGLTPHLLRTVPNSIIMFGTWEL 362

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 44/90 (48%), Gaps = 18/90 (20%)

Query: 251 ITYPFDLLRRRFQV---------LAM---GGNELGF------HYNSVWDALVTIGKTEGF 292
           +T PFD+++ R Q           AM   G + L F      H+   +  +  + + EGF
Sbjct: 67  VTCPFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLLHFKETFGIIGNVYRQEGF 126

Query: 293 KGYYKGLTANLFKVVPSTAVSWLVYELTWD 322
           +  +KGL  NL  V+P+ ++++L Y  T D
Sbjct: 127 RSLFKGLGPNLVGVIPARSINFLTYGTTKD 156

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 90.9 bits (224), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 85/309 (27%), Positives = 146/309 (47%), Gaps = 35/309 (11%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQ-SSTTAYNKGLFDAIGQVYKEENIKG------L 80
           ++G  AG+++  VV P + +K+ LQ+  +S    + G F  I ++ +     G      L
Sbjct: 14  ISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHYGPFMVIKEIIRSSANSGRSVTNEL 73

Query: 81  FRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTK---------GKGEQLNNWQRLFSGA 131
           +RG  +N         V F ++   K+ I+    K         G   ++N+   L +GA
Sbjct: 74  YRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKMNSLIYLSAGA 133

Query: 132 LCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMG 191
             G  + + T P+ +++TR+      +S    ++ +  +   GV +LL        G  G
Sbjct: 134 SSGLMTAILTNPIWVIKTRI------MSTSKGAQGAYTSMYNGVQQLL-----RTDGFQG 182

Query: 192 LYRGVWPTSLGIVPYVALNFAVYEQLKE--FMPSDENGNSSMRDSLYKLSMGAISGGVAQ 249
           L++G+ P   G V   AL FAVY+ LK+       ENG      +L  + + ++   V+ 
Sbjct: 183 LWKGLVPALFG-VSQGALYFAVYDTLKQRKLRRKRENGLDIHLTNLETIEITSLGKMVSV 241

Query: 250 TITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPS 309
           T+ YPF LL+   Q  +   NE  F    ++  +  I   +GF G YKGL+ANL + +PS
Sbjct: 242 TLVYPFQLLKSNLQ--SFRANEQKFR---LFPLIKLIIANDGFVGLYKGLSANLVRAIPS 296

Query: 310 TAVSWLVYE 318
           T +++ VYE
Sbjct: 297 TCITFCVYE 305

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 57/206 (27%), Positives = 93/206 (45%), Gaps = 23/206 (11%)

Query: 125 QRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYA 184
           + + SG   G  + +  +PLDL++ RL      LS  S  +A     P  V K + ++ A
Sbjct: 11  KEVISGLSAGSVTTLVVHPLDLLKVRL-----QLSATSAQKAH--YGPFMVIKEIIRSSA 63

Query: 185 EEGGIMG--LYRGVWPTSLGIVPYVALNFAVYEQLKEFM------PSDEN----GNSSMR 232
             G  +   LYRG+     G      + F +Y   KE +      P +      GN    
Sbjct: 64  NSGRSVTNELYRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKM 123

Query: 233 DSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGF 292
           +SL  LS GA SG +   +T P  +++ R    + G       Y S+++ +  + +T+GF
Sbjct: 124 NSLIYLSAGASSGLMTAILTNPIWVIKTRIMSTSKGAQG---AYTSMYNGVQQLLRTDGF 180

Query: 293 KGYYKGLTANLFKVVPSTAVSWLVYE 318
           +G +KGL   LF  V   A+ + VY+
Sbjct: 181 QGLWKGLVPALFG-VSQGALYFAVYD 205

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/214 (22%), Positives = 94/214 (43%), Gaps = 21/214 (9%)

Query: 12  ENQLK---NFLKQDTNVAFLAGGIAGAISRTVVSPF--ERVKILLQVQSSTTAYNKGLFD 66
           E QLK   N  K ++ +   AG  +G ++  + +P    + +I+   + +  AY   +++
Sbjct: 111 ETQLKGVGNDHKMNSLIYLSAGASSGLMTAILTNPIWVIKTRIMSTSKGAQGAYTS-MYN 169

Query: 67  AIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTK-GKGEQLNNWQ 125
            + Q+ + +  +GL++G  +  +      A+ F V++  K+       + G    L N +
Sbjct: 170 GVQQLLRTDGFQGLWKGL-VPALFGVSQGALYFAVYDTLKQRKLRRKRENGLDIHLTNLE 228

Query: 126 RLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAE 185
            +   +L    SV   YP  L+++ L    AN  K              ++ L+    A 
Sbjct: 229 TIEITSLGKMVSVTLVYPFQLLKSNLQSFRANEQKFR------------LFPLIKLIIAN 276

Query: 186 EGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKE 219
           +G  +GLY+G+    +  +P   + F VYE LK 
Sbjct: 277 DG-FVGLYKGLSANLVRAIPSTCITFCVYENLKH 309

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 36/74 (48%), Gaps = 1/74 (1%)

Query: 36  ISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYS 95
           +S T+V PF+ +K  LQ   +     + LF  I  +   +   GL++G   N +R  P +
Sbjct: 239 VSVTLVYPFQLLKSNLQSFRANEQKFR-LFPLIKLIIANDGFVGLYKGLSANLVRAIPST 297

Query: 96  AVQFVVFEGCKKHI 109
            + F V+E  K  +
Sbjct: 298 CITFCVYENLKHRL 311

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 90.1 bits (222), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 74/300 (24%), Positives = 126/300 (42%), Gaps = 36/300 (12%)

Query: 29  AGGIAGAISRTVVSPFERVKILLQVQSST-----TAYNKGLFDAIGQVYKEENIKGLFRG 83
           AG  AG +  +++ P + +K  +Q  S+T     T     +   I ++   E    L++G
Sbjct: 23  AGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLAQIAKISTTEGSLALWKG 82

Query: 84  NGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYP 143
                +   P  AV F  +E CK  +   + +   + L   +   SG L    +     P
Sbjct: 83  VQSVVLGAGPAHAVYFATYEMCKSRLIDPEDRQTHQPL---KTALSGTLATVAADALMNP 139

Query: 144 LDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGI 203
            D ++ RL +  ++                 + K   + Y  EG     Y   +PT++ +
Sbjct: 140 FDTIKQRLQLHPSD----------------SMTKCAVRMYQREGIAAFFYS--YPTTIAM 181

Query: 204 -VPYVALNFAVYEQ-LKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRR 261
            +P+ ALNF +YE   K F PS+ N N  +         G ISG     IT P D ++  
Sbjct: 182 NIPFAALNFVIYESSTKIFNPSN-NYNPWIH-----CLCGGISGATCAAITTPLDCVKTV 235

Query: 262 FQVLAMGG--NELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYEL 319
            Q+       ++L    ++   A   I KT G+ G+++GL   +   +P+TA+SW  YE 
Sbjct: 236 LQIRGADSVQSQLFKEADTFRKAASAIHKTYGWSGFFRGLKPRIISNMPATAISWTSYEF 295

 Score = 67.8 bits (164), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/201 (23%), Positives = 89/201 (44%), Gaps = 17/201 (8%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLN 87
           L+G +A   +  +++PF+ +K  LQ+  S +     +     ++Y+ E I   F      
Sbjct: 124 LSGTLATVAADALMNPFDTIKQRLQLHPSDSMTKCAV-----RMYQREGIAAFFYSYPTT 178

Query: 88  CIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLV 147
                P++A+ FV++E   K IF+          N W     G + G      T PLD V
Sbjct: 179 IAMNIPFAALNFVIYESSTK-IFN-----PSNNYNPWIHCLCGGISGATCAAITTPLDCV 232

Query: 148 RTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYV 207
           +T L ++ A+      S  S + K    ++  + A  +  G  G +RG+ P  +  +P  
Sbjct: 233 KTVLQIRGAD------SVQSQLFKEADTFRKAASAIHKTYGWSGFFRGLKPRIISNMPAT 286

Query: 208 ALNFAVYEQLKEFMPSDENGN 228
           A+++  YE  K  + ++ N +
Sbjct: 287 AISWTSYEFAKHLLFTNSNAH 307

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 87/195 (44%), Gaps = 22/195 (11%)

Query: 126 RLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAE 185
           +L +GA  G       +P+D ++TR+      +S    S A+ +  P  +   ++K    
Sbjct: 20  QLAAGAFAGIMEHSIMFPIDAIKTRMQA----VSTTGSSAATRL--PSNMLAQIAKISTT 73

Query: 186 EGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFM--PSDENGNSSMRDSLYKLSMGAI 243
           EG  + L++GV    LG  P  A+ FA YE  K  +  P D   +  ++ +L     G +
Sbjct: 74  EGS-LALWKGVQSVVLGAGPAHAVYFATYEMCKSRLIDPEDRQTHQPLKTAL----SGTL 128

Query: 244 SGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANL 303
           +   A  +  PFD +++R Q+            +S+    V + + EG   ++      +
Sbjct: 129 ATVAADALMNPFDTIKQRLQL---------HPSDSMTKCAVRMYQREGIAAFFYSYPTTI 179

Query: 304 FKVVPSTAVSWLVYE 318
              +P  A+++++YE
Sbjct: 180 AMNIPFAALNFVIYE 194

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 44/86 (51%), Gaps = 1/86 (1%)

Query: 235 LYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNS-VWDALVTIGKTEGFK 293
           +Y+L+ GA +G +  +I +P D ++ R Q ++  G+       S +   +  I  TEG  
Sbjct: 18  VYQLAAGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLAQIAKISTTEGSL 77

Query: 294 GYYKGLTANLFKVVPSTAVSWLVYEL 319
             +KG+ + +    P+ AV +  YE+
Sbjct: 78  ALWKGVQSVVLGAGPAHAVYFATYEM 103

>Scas_721.27
          Length = 374

 Score = 90.9 bits (224), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 87/337 (25%), Positives = 143/337 (42%), Gaps = 64/337 (18%)

Query: 25  VAFLAGGIAGAISRTVVSPFERVKILLQ-----------VQSSTTAYN------------ 61
           V F+AGGI G     V  PF+ VK  LQ             + T A+N            
Sbjct: 54  VHFVAGGIGGMAGAVVTCPFDLVKTRLQSDIYQSVYKSKAATVTAAHNSKIANSLVQAGT 113

Query: 62  --KGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGE 119
             K  F  +G VYK E  + LF+G G N + V P  ++ F  + G  K I+        +
Sbjct: 114 HFKETFGILGNVYKREGFRSLFKGLGPNLVGVIPARSINFFTY-GTTKEIY-------SK 165

Query: 120 QLNNWQ-----RLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPG 174
             NN Q      L S A  G  +  AT P+ +++TR+ +  A  ++  K+          
Sbjct: 166 AFNNGQETPLIHLMSAATAGWATSTATNPIWMIKTRVQLDKAGTTRKYKNS--------- 216

Query: 175 VWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPS----------- 223
            W  L      E GI GLYRG+  + LG +  + L + +YEQ+K  +             
Sbjct: 217 -WDCLKTVLKSE-GIYGLYRGLSASYLGSIEGI-LQWLLYEQMKHLIKQRSIEKFGHEGQ 273

Query: 224 -DENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDA 282
             ++    +++   +     ++  +A  +TYP +++R R + + M   +    Y  +  +
Sbjct: 274 LTKSRTEKIKEWCQRSGSAGVAKFIASIVTYPHEVVRTRLRQMPMENGKP--KYTGLVQS 331

Query: 283 LVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYEL 319
              I K EG    Y GLT +L + VP++ + +  +EL
Sbjct: 332 FRVIIKEEGLASMYSGLTPHLMRTVPNSIIMFGTWEL 368

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 42/91 (46%), Gaps = 21/91 (23%)

Query: 251 ITYPFDLLRRRFQ--------------VLAMGGNEL-------GFHYNSVWDALVTIGKT 289
           +T PFDL++ R Q              V A   +++       G H+   +  L  + K 
Sbjct: 69  VTCPFDLVKTRLQSDIYQSVYKSKAATVTAAHNSKIANSLVQAGTHFKETFGILGNVYKR 128

Query: 290 EGFKGYYKGLTANLFKVVPSTAVSWLVYELT 320
           EGF+  +KGL  NL  V+P+ ++++  Y  T
Sbjct: 129 EGFRSLFKGLGPNLVGVIPARSINFFTYGTT 159

>Scas_379.2
          Length = 301

 Score = 89.7 bits (221), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 76/299 (25%), Positives = 128/299 (42%), Gaps = 39/299 (13%)

Query: 27  FLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGL 86
            LAG  AG +  +V+ P + +K   ++QS++      +   + ++   E    L++G   
Sbjct: 27  LLAGAFAGIMEHSVMFPIDALKT--RIQSTSAKSTSNMLSQMAKISTAEGSLALWKGVQS 84

Query: 87  NCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVAT----Y 142
             +   P  AV F  +E  KK++  +D K     +   Q L   AL G  + +A      
Sbjct: 85  VILGAGPAHAVYFATYEYTKKYL--IDEK----DMQTHQPL-KTALSGTVATIAADALMN 137

Query: 143 PLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLG 202
           P D ++ R+ + T                   VW +  + Y  EG     Y   +PT+L 
Sbjct: 138 PFDTLKQRMQLNTNTT----------------VWNVTKQIYKNEGFSAFYYS--YPTTLA 179

Query: 203 I-VPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRR 261
           + +P+ A NF +YE   +F     N  +     ++ LS G +SG     IT P D ++  
Sbjct: 180 MNIPFAAFNFMIYESATKFF----NPTNDYNPLVHCLS-GGLSGATCAAITTPLDCIKTV 234

Query: 262 FQVLAMGGNELGF--HYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
            QV       L      N+   A   I +  G KG+++GL   +F  +P+TA++W  YE
Sbjct: 235 LQVRGSESVSLQVMKEANTFQKATKAIYQVHGAKGFWRGLQPRVFANMPATAIAWTAYE 293

 Score = 70.1 bits (170), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 83/194 (42%), Gaps = 17/194 (8%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLN 87
           L+G +A   +  +++PF+ +K  +Q+ ++TT +N        Q+YK E     +      
Sbjct: 123 LSGTVATIAADALMNPFDTLKQRMQLNTNTTVWN-----VTKQIYKNEGFSAFYYSYPTT 177

Query: 88  CIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLV 147
                P++A  F+++E   K              N      SG L G      T PLD +
Sbjct: 178 LAMNIPFAAFNFMIYESATKFF------NPTNDYNPLVHCLSGGLSGATCAAITTPLDCI 231

Query: 148 RTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYV 207
           +T L V+       S+S +  + K    ++  +KA  +  G  G +RG+ P     +P  
Sbjct: 232 KTVLQVRG------SESVSLQVMKEANTFQKATKAIYQVHGAKGFWRGLQPRVFANMPAT 285

Query: 208 ALNFAVYEQLKEFM 221
           A+ +  YE  K F+
Sbjct: 286 AIAWTAYECAKHFL 299

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 89/194 (45%), Gaps = 25/194 (12%)

Query: 125 QRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYA 184
            +L +GA  G       +P+D ++TR+   +A   K + +  S +AK       +S A  
Sbjct: 25  HQLLAGAFAGIMEHSVMFPIDALKTRIQSTSA---KSTSNMLSQMAK-------ISTA-- 72

Query: 185 EEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAIS 244
              G + L++GV    LG  P  A+ FA YE  K+++  DE    + +     LS G ++
Sbjct: 73  --EGSLALWKGVQSVILGAGPAHAVYFATYEYTKKYL-IDEKDMQTHQPLKTALS-GTVA 128

Query: 245 GGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLF 304
              A  +  PFD L++R Q   +  N       +VW+    I K EGF  +Y      L 
Sbjct: 129 TIAADALMNPFDTLKQRMQ---LNTN------TTVWNVTKQIYKNEGFSAFYYSYPTTLA 179

Query: 305 KVVPSTAVSWLVYE 318
             +P  A ++++YE
Sbjct: 180 MNIPFAAFNFMIYE 193

 Score = 33.5 bits (75), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 47/105 (44%), Gaps = 9/105 (8%)

Query: 219 EFMPSDENGNSSMRDSL---YKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFH 275
           E   ++E    ++ DS    ++L  GA +G +  ++ +P D L+ R Q  +         
Sbjct: 5   EISTAEEIDYEALPDSAPLSHQLLAGAFAGIMEHSVMFPIDALKTRIQSTSAKST----- 59

Query: 276 YNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYELT 320
            +++   +  I   EG    +KG+ + +    P+ AV +  YE T
Sbjct: 60  -SNMLSQMAKISTAEGSLALWKGVQSVILGAGPAHAVYFATYEYT 103

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 89.7 bits (221), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 80/319 (25%), Positives = 136/319 (42%), Gaps = 55/319 (17%)

Query: 27  FLAGGIAGAISRTVVSPFERVKILLQVQSS-----------------TTAYNKGLFDAIG 69
            +AG  AG +  +++ P + +K  +Q  S                    A    L   I 
Sbjct: 24  LIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGAGTLLQQIS 83

Query: 70  QVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFS 129
           ++   E    L+RG     +   P  AV F  +E CK+ +  +D K      N  Q L  
Sbjct: 84  RISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKEQL--IDAK----DFNTHQPL-K 136

Query: 130 GALCGGCSVVAT----YPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAE 185
            A+ G  + VA      P D ++ RL +Q         S++SD      +W++    Y  
Sbjct: 137 TAVSGVAATVAADALMNPFDTIKQRLQLQ---------SKSSD----SSMWRMAFNIYKN 183

Query: 186 EGGIMGLYRGVWPTSLGI-VPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAIS 244
           EG +   Y   +PT+L + +P+ ALNF +YE   +F     N  ++    ++ L  G I+
Sbjct: 184 EGPMAFFYS--YPTTLAMNIPFAALNFVIYESSTKFF----NPTNAYNPWIHCLC-GGIA 236

Query: 245 GGVAQTITYPFDLLRRRFQVLAMGGNELGFHY----NSVWDALVTIGKTEGFKGYYKGLT 300
           G     +T P D ++   Q+   G + +        N+   A   I ++ G+KG+++GL 
Sbjct: 237 GATCAAVTTPLDCIKTVLQI--RGSDTVHVESFKTANTFKKAAQAIWQSYGWKGFWRGLQ 294

Query: 301 ANLFKVVPSTAVSWLVYEL 319
             +   +P+TA+SW  YE 
Sbjct: 295 PRVISNIPATAISWTSYEF 313

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 88/199 (44%), Gaps = 15/199 (7%)

Query: 126 RLFSGALCGGCSVVATYPLDLVRTRLSVQT------ANLSKLSKSRASDIAKPPGVWKLL 179
           +L +GA  G       +P+D ++TR+   +      +  +      AS  A    + + +
Sbjct: 23  QLIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGAGTLLQQI 82

Query: 180 SKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLS 239
           S+  + EG  + L+RGV    +G  P  A+ FA YE  KE +   ++ N+     L    
Sbjct: 83  SRISSTEGS-LALWRGVQSMVMGAGPAHAVYFATYEFCKEQLIDAKDFNT--HQPLKTAV 139

Query: 240 MGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGL 299
            G  +   A  +  PFD +++R Q+ +   +      +S+W     I K EG   ++   
Sbjct: 140 SGVAATVAADALMNPFDTIKQRLQLQSKSSD------SSMWRMAFNIYKNEGPMAFFYSY 193

Query: 300 TANLFKVVPSTAVSWLVYE 318
              L   +P  A+++++YE
Sbjct: 194 PTTLAMNIPFAALNFVIYE 212

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 43/89 (48%), Gaps = 6/89 (6%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGL-----FDAIGQ-VYKEENIKGLF 81
           L GGIAGA    V +P + +K +LQ++ S T + +       F    Q +++    KG +
Sbjct: 231 LCGGIAGATCAAVTTPLDCIKTVLQIRGSDTVHVESFKTANTFKKAAQAIWQSYGWKGFW 290

Query: 82  RGNGLNCIRVFPYSAVQFVVFEGCKKHIF 110
           RG     I   P +A+ +  +E  K  +F
Sbjct: 291 RGLQPRVISNIPATAISWTSYEFAKHLLF 319

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 41/97 (42%), Gaps = 13/97 (13%)

Query: 236 YKLSMGAISGGVAQTITYPFDLLRRRFQVLA-------------MGGNELGFHYNSVWDA 282
           Y+L  GA +G +  +I +P D L+ R Q ++              G    G    ++   
Sbjct: 22  YQLIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGAGTLLQQ 81

Query: 283 LVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYEL 319
           +  I  TEG    ++G+ + +    P+ AV +  YE 
Sbjct: 82  ISRISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEF 118

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 88.2 bits (217), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 74/294 (25%), Positives = 141/294 (47%), Gaps = 26/294 (8%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEEN--IKGLFRGNG 85
           ++G  AG+++  +V P +  K+ LQ+  ++T   KG  +   ++   +    + L+RG  
Sbjct: 13  ISGLTAGSVTTLIVHPLDLFKVRLQLLITSTT-KKGYRNLWSEIVGSDLSLTRELYRGLT 71

Query: 86  LNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQ-LNNWQRLFSGALCGGCSVVATYPL 144
           +N +       + F  +   K ++ + + + + ++ L++W  L + A  G  + V T PL
Sbjct: 72  VNLVGNTIAWGLYFASYRVAKDYLINYNHRIRNDKDLSSWMYLSASASSGMLTTVLTNPL 131

Query: 145 DLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIV 204
            +++TR+ +  AN    S     D+ K                G+ GL++G+ P  +G V
Sbjct: 132 WVIKTRM-MSKANSDLTSMKVLRDLIK--------------NDGVQGLWKGLVPALVG-V 175

Query: 205 PYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQV 264
              AL+F  Y+ LK  +   +N +S    +L  +++ ++S  ++ +  YPF LL+   Q 
Sbjct: 176 SQGALHFTCYDTLKHKLVL-KNRDSDEITNLETIAVTSVSKMLSTSAVYPFQLLKSNLQS 234

Query: 265 LAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
                N+      S       I    G  G+YKGL+ANL + VPST +++ +YE
Sbjct: 235 FQASENDFKLLPLSK-----MIYSRSGLLGFYKGLSANLLRSVPSTCITFCIYE 283

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 43/194 (22%), Positives = 81/194 (41%), Gaps = 21/194 (10%)

Query: 29  AGGIAGAISRTVVSPFERVKI-LLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLN 87
           A   +G ++  + +P   +K  ++   +S     K L D I    K + ++GL++G    
Sbjct: 116 ASASSGMLTTVLTNPLWVIKTRMMSKANSDLTSMKVLRDLI----KNDGVQGLWKGLVPA 171

Query: 88  CIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLV 147
            + V    A+ F  ++  K  +  V      +++ N + +   ++    S  A YP  L+
Sbjct: 172 LVGV-SQGALHFTCYDTLKHKL--VLKNRDSDEITNLETIAVTSVSKMLSTSAVYPFQLL 228

Query: 148 RTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYV 207
           ++ L    A+         +D    P     LSK      G++G Y+G+    L  VP  
Sbjct: 229 KSNLQSFQAS--------ENDFKLLP-----LSKMIYSRSGLLGFYKGLSANLLRSVPST 275

Query: 208 ALNFAVYEQLKEFM 221
            + F +YE  K F+
Sbjct: 276 CITFCIYENFKSFL 289

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score = 88.2 bits (217), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 76/306 (24%), Positives = 126/306 (41%), Gaps = 31/306 (10%)

Query: 25  VAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNK----GLFDAIGQVYKEENIKGL 80
           +  +AGG AG        P + +K+ +Q+             G       +Y++E    L
Sbjct: 12  INLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFLAL 71

Query: 81  FRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCS--V 138
           ++G G   I + P  A++F  +E      +      K   + +    F   +  G +  V
Sbjct: 72  YKGLGAVVIGIIPKMAIRFSSYE-----FYRTLLVNKESGIVSTGNTFVAGVGAGITEAV 126

Query: 139 VATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYA--EEGGIMGLYRGV 196
           +   P+++V+ RL  Q    S+ +          P     +  AY   +E G+  LYRGV
Sbjct: 127 LVVNPMEVVKIRLQAQHLTPSEPNAG--------PKYNNAIHAAYTIVKEEGVSALYRGV 178

Query: 197 WPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFD 256
             T+         NF VY +LKEF+ +    +  +  S     +G ISG +      P D
Sbjct: 179 SLTAARQATNQGANFTVYSKLKEFLQNYHQMD--VLPSWETSCIGLISGAIGPFSNAPLD 236

Query: 257 LLRRRFQVLAMGGNELGFHYNSVWDALVTIG----KTEGFKGYYKGLTANLFKVVPSTAV 312
            ++ R Q        +     S    ++TIG    K EGF+  YKG+T  + +V P  AV
Sbjct: 237 TIKTRLQ----KDKSISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAV 292

Query: 313 SWLVYE 318
           ++ VYE
Sbjct: 293 TFTVYE 298

 Score = 72.8 bits (177), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/211 (27%), Positives = 96/211 (45%), Gaps = 29/211 (13%)

Query: 22  DTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTA-------YNKGLFDAIGQVYKE 74
           +T VA +  GI  A+   VV+P E VKI LQ Q  T +       YN  +  A   + KE
Sbjct: 112 NTFVAGVGAGITEAV--LVVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAY-TIVKE 168

Query: 75  ENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHI--FHVDTKGKGEQLNNWQRLFSGAL 132
           E +  L+RG  L   R        F V+   K+ +  +H     + + L +W+    G +
Sbjct: 169 EGVSALYRGVSLTAARQATNQGANFTVYSKLKEFLQNYH-----QMDVLPSWETSCIGLI 223

Query: 133 CGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLS--KAYAEEGGIM 190
            G     +  PLD ++TRL           K ++  + K  G+ K+++      +E G  
Sbjct: 224 SGAIGPFSNAPLDTIKTRLQ----------KDKSISLEKQSGMKKIITIGAQLLKEEGFR 273

Query: 191 GLYRGVWPTSLGIVPYVALNFAVYEQLKEFM 221
            LY+G+ P  + + P  A+ F VYE ++E +
Sbjct: 274 ALYKGITPRVMRVAPGQAVTFTVYEYVREHL 304

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score = 87.4 bits (215), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 90/336 (26%), Positives = 146/336 (43%), Gaps = 38/336 (11%)

Query: 1   MSEVILPAIEEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAY 60
           MS    P   +E++     K     +F+AGG+A  I+ TV +PFE VK  +Q+Q   +A 
Sbjct: 1   MSSENKPVATKEHEKSAAQKVSKVGSFIAGGLAACIAVTVTNPFELVKTRMQLQGEMSAT 60

Query: 61  NKGL----FDAIGQVYKEENIKGLFRG--------NGLNCIRVFPYSAVQFVVFEGCKKH 108
           N+ +    F A+G ++K E +KGL RG         GLN  R+  Y  ++ V+     K 
Sbjct: 61  NQRIYRNPFQALGVIFKNEGVKGLQRGLVSAYVYQIGLNGSRLGFYEPIRTVL----NKT 116

Query: 109 IFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASD 168
            F      K +  N    + +GA  G    +   PL LV+TR+   +  +    ++  + 
Sbjct: 117 FFPESDPHKLQ--NVAVNVTAGATSGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTS 174

Query: 169 IAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGN 228
           ++   G+  +  K      G++GL+RGV    L      ++   +Y   K F+      N
Sbjct: 175 MSN--GLATIFKKE-----GVLGLFRGVDAAILRTGAGSSVQLPIYNTTKNFLLQ----N 223

Query: 229 SSMRD--SLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTI 286
             M++  +L+ LS      GV   +  P+D++  R        N+ G  Y    D +   
Sbjct: 224 DIMKEGTALHLLSSTVTGLGVG-IVMNPWDVVLTRVY------NQKGNTYKGPIDCMFKT 276

Query: 287 GKTEGFKGYYKGLTANLFKVVPSTAVSWLVYELTWD 322
            K EG    YKG  A LF++ P T +     E T  
Sbjct: 277 IKIEGIGALYKGFGAQLFRIAPHTILCLTFMEQTMK 312

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score = 87.0 bits (214), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 82/322 (25%), Positives = 137/322 (42%), Gaps = 38/322 (11%)

Query: 7   PAIEEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFD 66
           P +  E+ L+         A +AG ++G ++R+V +P + VKI  Q+Q ++     G+  
Sbjct: 8   PQLATEDHLRKGEAVSGLHAVVAGSVSGLVARSVTAPMDTVKIRRQLQLASEHKYHGILH 67

Query: 67  AIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQR 126
               V +EE ++ L++GN         Y ++QF  +           + G   Q ++   
Sbjct: 68  TFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNT---AAASAGLPPQAHS--- 121

Query: 127 LFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEE 186
           L  GAL G  S + TYPLDL+RTRL V   +    S  R + +     +W        + 
Sbjct: 122 LAVGALAGLVSSLLTYPLDLLRTRL-VANRSAHFFSLRRQARV-----IW--------DT 167

Query: 187 GGIMGLYR-GVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISG 245
            G  G +R G W  +   +    L F +YE     + +D  G   +       +    +G
Sbjct: 168 EGPAGFFRGGAWAIAATTL-TTGLIFGIYETCT--IAADTYGLPWL-----AAAASPTAG 219

Query: 246 GVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDAL---------VTIGKTEGFKGYY 296
            V++   +P D +RRR Q++              + AL         V + + EG    Y
Sbjct: 220 LVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLY 279

Query: 297 KGLTANLFKVVPSTAVSWLVYE 318
           KGLT  L K  P+T ++  VY+
Sbjct: 280 KGLTMALCKSTPTTVITLWVYQ 301

>Scas_582.7
          Length = 329

 Score = 86.3 bits (212), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 75/299 (25%), Positives = 129/299 (43%), Gaps = 33/299 (11%)

Query: 27  FLAGGIAGAISRTVVSPFERVKILLQVQSSTTA----YNKGLFDAIGQVYKEENIKGLFR 82
            LAG  AG +  + + P + +K   ++QS+TT      +  +   I ++   E    L++
Sbjct: 40  LLAGAFAGIMEHSTMFPIDALKT--RIQSTTTKGTEQTSTSIIKQISKISTMEGSLALWK 97

Query: 83  GNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATY 142
           G     +   P  AV F  +E  K H+       + E     +   SGA     S     
Sbjct: 98  GVQSVILGAGPAHAVYFATYEFTKAHLI---PDSQRETHQPIKVAVSGATATVASDFFMN 154

Query: 143 PLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLG 202
           P D ++ R+ +     S L K +  ++AK         K Y  EG  +  +   +PT++ 
Sbjct: 155 PFDTIKQRMQI-----SDLKKEKVYNVAK---------KIYNLEG--LSAFYYSYPTTIA 198

Query: 203 I-VPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRR 261
           + +P+ A NF +YE   +F     + N      L     G ISG +A  +T P D ++  
Sbjct: 199 MNIPFAAFNFMIYESASKFFNPLHHYNP-----LIHCLCGGISGAIAAAVTTPLDCIKTV 253

Query: 262 FQVL--AMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
            Q+   ++   E+    N+   A   I    G+KG+++GL   +   +P+TA+SW  YE
Sbjct: 254 IQIRGSSVVSLEVMKKANTFKKATSAILMVYGWKGFWRGLQPRILANMPATAISWTAYE 312

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/198 (21%), Positives = 86/198 (43%), Gaps = 23/198 (11%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLN 87
           ++G  A   S   ++PF+ +K  +Q+   +    + +++   ++Y  E +   +      
Sbjct: 140 VSGATATVASDFFMNPFDTIKQRMQI---SDLKKEKVYNVAKKIYNLEGLSAFYYSYPTT 196

Query: 88  CIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCS----VVATYP 143
                P++A  F+++E   K             L+++  L    LCGG S       T P
Sbjct: 197 IAMNIPFAAFNFMIYESASKFF---------NPLHHYNPLIH-CLCGGISGAIAAAVTTP 246

Query: 144 LDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGI 203
           LD ++T + ++ +++  L      ++ K    +K  + A     G  G +RG+ P  L  
Sbjct: 247 LDCIKTVIQIRGSSVVSL------EVMKKANTFKKATSAILMVYGWKGFWRGLQPRILAN 300

Query: 204 VPYVALNFAVYEQLKEFM 221
           +P  A+++  YE  K F+
Sbjct: 301 MPATAISWTAYECAKHFL 318

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 86/198 (43%), Gaps = 27/198 (13%)

Query: 125 QRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYA 184
            +L +GA  G       +P+D ++TR+   T   ++ + +          + K +SK   
Sbjct: 38  HQLLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTST---------SIIKQISKIST 88

Query: 185 EEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAIS 244
            EG  + L++GV    LG  P  A+ FA YE  K  +  D     S R++   + + A+S
Sbjct: 89  MEGS-LALWKGVQSVILGAGPAHAVYFATYEFTKAHLIPD-----SQRETHQPIKV-AVS 141

Query: 245 GGVAQTIT----YPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLT 300
           G  A   +     PFD +++R Q+  +   +       V++    I   EG   +Y    
Sbjct: 142 GATATVASDFFMNPFDTIKQRMQISDLKKEK-------VYNVAKKIYNLEGLSAFYYSYP 194

Query: 301 ANLFKVVPSTAVSWLVYE 318
             +   +P  A ++++YE
Sbjct: 195 TTIAMNIPFAAFNFMIYE 212

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 38/85 (44%), Gaps = 2/85 (2%)

Query: 236 YKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGY 295
           ++L  GA +G +  +  +P D L+ R Q     G E      S+   +  I   EG    
Sbjct: 38  HQLLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQT--STSIIKQISKISTMEGSLAL 95

Query: 296 YKGLTANLFKVVPSTAVSWLVYELT 320
           +KG+ + +    P+ AV +  YE T
Sbjct: 96  WKGVQSVILGAGPAHAVYFATYEFT 120

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score = 86.7 bits (213), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 84/333 (25%), Positives = 133/333 (39%), Gaps = 57/333 (17%)

Query: 25  VAFLAGGIAGAISRTVVSPFERVKILLQV-----------------------------QS 55
           V  +AGG AG        P + +K+ +Q+                               
Sbjct: 13  VNLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVGGGD 72

Query: 56  STTAYNKGLFDAIGQ-VYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDT 114
           +T A     F   G+ +Y +E    L++G G   I + P  A++F  +E      +    
Sbjct: 73  ATAAIKPPGFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYE-----FYRTLL 127

Query: 115 KGKGEQLNNWQRLFSGALCGGCS--VVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKP 172
             K   + +    F   +  G +  V+   P+++V+ RL  Q  N +        D+AKP
Sbjct: 128 ADKQTGVVSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNH-------DLAKP 180

Query: 173 PGVWKLLSKAYA--EEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSS 230
                 +   Y   +E GI  LYRGV  T+         NF VY +L+EF+  + +G  +
Sbjct: 181 -KYTNAVQAGYTIIKEEGISALYRGVSLTAARQATNQGANFTVYSKLREFL-QEYHGTET 238

Query: 231 MRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIG--- 287
           +  S     +G ISG +      P D ++ R Q          F   S W  +  IG   
Sbjct: 239 L-PSWETSCIGLISGAIGPFSNAPLDTIKTRLQ----KDKSTSFKGESGWKRIAHIGTQL 293

Query: 288 -KTEGFKGYYKGLTANLFKVVPSTAVSWLVYEL 319
            K EGF+  YKG+T  + +V P  AV++ VYE 
Sbjct: 294 LKEEGFRALYKGITPRVMRVAPGQAVTFTVYEF 326

 Score = 62.8 bits (151), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 57/210 (27%), Positives = 88/210 (41%), Gaps = 24/210 (11%)

Query: 22  DTNVAFLAGGIAGAISRT-VVSPFERVKILLQVQSSTTAYN------KGLFDAIGQVYKE 74
            T+  F+AG  AG      VV+P E VKI LQ Q     ++           A   + KE
Sbjct: 136 STSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGYTIIKE 195

Query: 75  ENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCG 134
           E I  L+RG  L   R        F V+   ++  F  +  G  E L +W+    G + G
Sbjct: 196 EGISALYRGVSLTAARQATNQGANFTVYSKLRE--FLQEYHGT-ETLPSWETSCIGLISG 252

Query: 135 GCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSK---AYAEEGGIMG 191
                +  PLD ++TRL           K +++      G WK ++       +E G   
Sbjct: 253 AIGPFSNAPLDTIKTRLQ----------KDKSTSFKGESG-WKRIAHIGTQLLKEEGFRA 301

Query: 192 LYRGVWPTSLGIVPYVALNFAVYEQLKEFM 221
           LY+G+ P  + + P  A+ F VYE ++  +
Sbjct: 302 LYKGITPRVMRVAPGQAVTFTVYEFVRRHL 331

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score = 84.7 bits (208), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 85/316 (26%), Positives = 144/316 (45%), Gaps = 39/316 (12%)

Query: 12  ENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQV 71
           E+  K  L +   +  + G IAGA  + +  PF+ VK+ LQ Q+S        +  I   
Sbjct: 2   EDSKKKGLIEGAILDIINGSIAGACGKVIEFPFDTVKVRLQTQASNVFPTT--WSCIKFT 59

Query: 72  YKEENI-KGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHI-FHVDTKGKGEQLNNWQRLFS 129
           Y+ E I +G F+G     +     +A  FV +  C K +  H +    G      Q L S
Sbjct: 60  YQNEGIARGFFQGIASPLVGACLENATLFVSYNQCSKFLEKHTNVFPLG------QILIS 113

Query: 130 GALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGI 189
           G + G C+ +   P++LV+ +L  Q ANL +++ ++       P +     KA   E G+
Sbjct: 114 GGVAGSCASLVLTPVELVKCKL--QVANL-QVASAKTKHTKVLPTI-----KAIITERGL 165

Query: 190 MGLYRGVWPT----SLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDS--LYKLSMGAI 243
            GL++G   T    S G V +    FA YE +K+ +    + +   RD   +++L +   
Sbjct: 166 AGLWQGQSGTFIRESFGGVAW----FATYEIVKKSLKDRHSLDDPKRDESKIWELLISGG 221

Query: 244 SGGVA-QTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTAN 302
           S G+A     +P D ++   Q            + S+ +A+  I    G KG+Y+GL   
Sbjct: 222 SAGLAFNASIFPADTVKSVMQT----------EHISLTNAVKKIFGKFGLKGFYRGLGIT 271

Query: 303 LFKVVPSTAVSWLVYE 318
           LF+ VP+ A  + ++E
Sbjct: 272 LFRAVPANAAVFYIFE 287

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 59/217 (27%), Positives = 93/217 (42%), Gaps = 31/217 (14%)

Query: 13  NQLKNFLKQDTNV-----AFLAGGIAGAISRTVVSPFERVKILLQVQ-----SSTTAYNK 62
           NQ   FL++ TNV       ++GG+AG+ +  V++P E VK  LQV      S+ T + K
Sbjct: 92  NQCSKFLEKHTNVFPLGQILISGGVAGSCASLVLTPVELVKCKLQVANLQVASAKTKHTK 151

Query: 63  GLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHI--FHVDTKGKGEQ 120
            +   I  +  E  + GL++G     IR        F  +E  KK +   H     K ++
Sbjct: 152 -VLPTIKAIITERGLAGLWQGQSGTFIRESFGGVAWFATYEIVKKSLKDRHSLDDPKRDE 210

Query: 121 LNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLS 180
              W+ L SG   G     + +P D V++ +  +  +L+   K             K+  
Sbjct: 211 SKIWELLISGGSAGLAFNASIFPADTVKSVMQTEHISLTNAVK-------------KIFG 257

Query: 181 KAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQL 217
           K      G+ G YRG+  T    VP  A  F ++E L
Sbjct: 258 KF-----GLKGFYRGLGITLFRAVPANAAVFYIFETL 289

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/103 (22%), Positives = 54/103 (52%), Gaps = 8/103 (7%)

Query: 3   EVILPAIEEENQLKNFLKQDTNV--AFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAY 60
           E++  ++++ + L +  + ++ +    ++GG AG      + P + VK ++Q +  +   
Sbjct: 191 EIVKKSLKDRHSLDDPKRDESKIWELLISGGSAGLAFNASIFPADTVKSVMQTEHIS--- 247

Query: 61  NKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFE 103
              L +A+ +++ +  +KG +RG G+   R  P +A  F +FE
Sbjct: 248 ---LTNAVKKIFGKFGLKGFYRGLGITLFRAVPANAAVFYIFE 287

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score = 85.1 bits (209), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 84/308 (27%), Positives = 130/308 (42%), Gaps = 36/308 (11%)

Query: 26  AFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYN----KGLFDAIGQVYKEENIKGLF 81
           +F+AGG+A  I+ TV +P E +KI +Q+Q   +A      K     +  ++K E IKGL 
Sbjct: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQ 84

Query: 82  RG--------NGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALC 133
           +G         GLN  R+  Y  ++          +F  D +    Q +    +FSGA  
Sbjct: 85  KGLNAAYIYQIGLNGSRLGFYEPIR-----SSLNQLFFPDQEPHKVQ-SVGVNVFSGAAS 138

Query: 134 GGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLY 193
           G    V   PL LV+TRL   +  +    ++  +      GVW  L   +  E G+ GL+
Sbjct: 139 GIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYT------GVWNGLVTIFKTE-GVKGLF 191

Query: 194 RGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDS-LYKLSMGAISGGVAQTIT 252
           RG+    L      ++   +Y   K  +      N  M+D     L+   ISG     + 
Sbjct: 192 RGIDAAILRTGAGSSVQLPIYNTAKNILVK----NDLMKDGPALHLTASTISGLGVAVVM 247

Query: 253 YPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAV 312
            P+D++  R        N+ G  Y    D LV   + EG    YKG  A +F++ P T +
Sbjct: 248 NPWDVILTRIY------NQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIM 301

Query: 313 SWLVYELT 320
                E T
Sbjct: 302 CLTFMEQT 309

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 97/212 (45%), Gaps = 22/212 (10%)

Query: 115 KGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPG 174
           K   ++++ +    +G L    +V  T P++L++ R+ +Q     ++S S A+ + K P 
Sbjct: 14  KTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQ----GEMSAS-AAKVYKNP- 67

Query: 175 VWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKE-----FMPSDENGNS 229
             + ++  +  EG I GL +G+    +  +         YE ++      F P  E    
Sbjct: 68  -IQGMAVIFKNEG-IKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEP--H 123

Query: 230 SMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQ----VLAMGGNELGFHYNSVWDALVT 285
            ++     +  GA SG +   I  P  L++ R Q     + +G      HY  VW+ LVT
Sbjct: 124 KVQSVGVNVFSGAASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQT---HYTGVWNGLVT 180

Query: 286 IGKTEGFKGYYKGLTANLFKVVPSTAVSWLVY 317
           I KTEG KG ++G+ A + +    ++V   +Y
Sbjct: 181 IFKTEGVKGLFRGIDAAILRTGAGSSVQLPIY 212

>Kwal_47.18216
          Length = 333

 Score = 84.7 bits (208), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 78/323 (24%), Positives = 126/323 (39%), Gaps = 41/323 (12%)

Query: 25  VAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYN---KGLFDAIGQVYKEENIKGLF 81
           +  +AGG AG        P + +K+ +Q+ S         +G       +  +E    L+
Sbjct: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALY 71

Query: 82  RGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCS--VV 139
           +G G   I + P  A++F  +E      F      +   + +    F   +  G +  V+
Sbjct: 72  KGLGAVVIGIIPKMAIRFTSYE-----FFRTLLADRQTGVVSTGNTFVAGVGAGITEAVM 126

Query: 140 ATYPLDLVRTRLSVQTANLSKLSKSRA-----------------SDIAKPPGVWKLLSKA 182
              P+++V+ RL  Q      L    A                  ++A  P     +  A
Sbjct: 127 VVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAATPKYRNAIQAA 186

Query: 183 YA--EEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSM 240
           Y   +E G   LYRGV  T+         NF VY  LK  +   E   + M  S     +
Sbjct: 187 YVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRL--QEYHQTDMLPSWETSLI 244

Query: 241 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKT----EGFKGYY 296
           G ISG +      P D ++ R Q       +     +S W  ++ IG+     EGF+  Y
Sbjct: 245 GLISGALGPFSNAPLDTIKTRLQ------KDKSTSKDSGWSRILAIGRQLIREEGFRALY 298

Query: 297 KGLTANLFKVVPSTAVSWLVYEL 319
           KG+T  + +V P  AV++ VYEL
Sbjct: 299 KGITPRVMRVAPGQAVTFTVYEL 321

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 55/233 (23%), Positives = 89/233 (38%), Gaps = 54/233 (23%)

Query: 22  DTNVAFLAGGIAGAISRTVVSPFERVKILLQVQS-------------------------- 55
           +T VA +  GI  A+   VV+P E VKI LQ Q                           
Sbjct: 111 NTFVAGVGAGITEAV--MVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATT 168

Query: 56  -----STTAYNKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHI- 109
                + T   +    A   + KEE  + L+RG  L   R        F V+   K  + 
Sbjct: 169 ATENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQ 228

Query: 110 -FHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASD 168
            +H     + + L +W+    G + G     +  PLD ++TRL             +   
Sbjct: 229 EYH-----QTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQ------------KDKS 271

Query: 169 IAKPPGVWKLLS--KAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKE 219
            +K  G  ++L+  +    E G   LY+G+ P  + + P  A+ F VYE +++
Sbjct: 272 TSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRK 324

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 44/84 (52%), Gaps = 2/84 (2%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNK-GLFDAIG-QVYKEENIKGLFRGNG 85
           L G I+GA+     +P + +K  LQ   ST+  +      AIG Q+ +EE  + L++G  
Sbjct: 243 LIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGIT 302

Query: 86  LNCIRVFPYSAVQFVVFEGCKKHI 109
              +RV P  AV F V+E  +K +
Sbjct: 303 PRVMRVAPGQAVTFTVYELIRKKL 326

>Scas_645.9
          Length = 391

 Score = 85.1 bits (209), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 74/281 (26%), Positives = 131/281 (46%), Gaps = 26/281 (9%)

Query: 51  LQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIF 110
           L  ++S+  +N G  +A  +++K E I  L+RG  +N +   P + V F  +E      +
Sbjct: 120 LNCKNSSVRFN-GTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFTGYE------Y 172

Query: 111 HVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIA 170
             D          +  L  GA+    +     PL+L++T+L     ++ ++SKS  S + 
Sbjct: 173 LRDNSPLATSSPTFNPLMCGAIARILAASTVAPLELLKTKLQ----SIPRVSKSTTSWMM 228

Query: 171 KPPGVWKLLSKAYAE---EGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDEN- 226
               V +LL +   E    G    L++G+  T    VP+ A+ +  YE  K  +  D + 
Sbjct: 229 ----VKELLKETRQEMRISGASNALFKGLEITLWRDVPFSAIYWGSYEFCKTHLWMDTSK 284

Query: 227 GNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGF-------HYNSV 279
            +S++   +     G+ISG +A  +T+PFD+ + R+Q+  MG N+             ++
Sbjct: 285 SHSNLTFFINSFIGGSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNM 344

Query: 280 WDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYELT 320
           +  L  I K EG+   Y GL   + K+ PS A+    YEL+
Sbjct: 345 FKFLRNIWKLEGWGALYTGLVPRMVKIAPSCAIMISSYELS 385

 Score = 68.9 bits (167), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 93/202 (46%), Gaps = 10/202 (4%)

Query: 27  FLAGGIAGAISRTVVSPFERVKILLQ----VQSSTTAYNKGLFDAIGQVYKEENIKG--- 79
            + G IA  ++ + V+P E +K  LQ    V  STT++   + + + +  +E  I G   
Sbjct: 189 LMCGAIARILAASTVAPLELLKTKLQSIPRVSKSTTSW-MMVKELLKETRQEMRISGASN 247

Query: 80  -LFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSV 138
            LF+G  +   R  P+SA+ +  +E CK H++   +K              G++ G  + 
Sbjct: 248 ALFKGLEITLWRDVPFSAIYWGSYEFCKTHLWMDTSKSHSNLTFFINSFIGGSISGTIAA 307

Query: 139 VATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWP 198
           + T+P D+ +TR  +     +  S  ++ DI +   ++K L   +  EG    LY G+ P
Sbjct: 308 LVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNIWKLEGW-GALYTGLVP 366

Query: 199 TSLGIVPYVALNFAVYEQLKEF 220
             + I P  A+  + YE  K  
Sbjct: 367 RMVKIAPSCAIMISSYELSKRL 388

 Score = 32.7 bits (73), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 39/93 (41%), Gaps = 11/93 (11%)

Query: 26  AFLAGGIAGAISRTVVSPFERVKILLQ-----------VQSSTTAYNKGLFDAIGQVYKE 74
           +F+ G I+G I+  V  PF+  K   Q           V+S      K +F  +  ++K 
Sbjct: 295 SFIGGSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNIWKL 354

Query: 75  ENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKK 107
           E    L+ G     +++ P  A+    +E  K+
Sbjct: 355 EGWGALYTGLVPRMVKIAPSCAIMISSYELSKR 387

 Score = 28.9 bits (63), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 53/132 (40%), Gaps = 22/132 (16%)

Query: 199 TSLGIVPYVALNFAVYEQ------------LKEFMPSDENGNSSMRDSLYKLSMGAISGG 246
           TSL + P   +   + +Q            +K+F+P  +   SS++ S        IS G
Sbjct: 50  TSLTLTPMDVVRIRLQQQELLPDCSCETIAVKDFLPKAKTDLSSVQVS----RAATISTG 105

Query: 247 VAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKV 306
               + +        FQ L    + + F  N   +A   I K EG    ++G++ NL   
Sbjct: 106 NKNKVFWDNPC----FQELNCKNSSVRF--NGTLEAFNKIWKLEGITTLWRGISINLLMA 159

Query: 307 VPSTAVSWLVYE 318
           +P+  V +  YE
Sbjct: 160 IPANIVYFTGYE 171

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score = 83.2 bits (204), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 82/305 (26%), Positives = 150/305 (49%), Gaps = 34/305 (11%)

Query: 19  LKQDTNVAF---LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEE 75
           + +D + A+   L GG+AG++ + V  PF+ VK+ LQ QS+  A     +  +   YK+E
Sbjct: 1   MSEDADKAYKDLLYGGVAGSLGKLVEYPFDTVKVRLQTQSA--ALFPTTWSCVSHTYKQE 58

Query: 76  NI-KGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCG 134
            + +G ++G        F   AV FV F   +  + +  + G  E++     +F+GA+ G
Sbjct: 59  GLWRGFYQGMASPVFGAFLEHAVLFVSFNRAQAVLENCYSCGPLEKV-----VFAGAIAG 113

Query: 135 GCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYR 194
            C+     P++LV+ +L  Q +NL+ +S  R + +   P +     +A  ++ G+ GL++
Sbjct: 114 ACTSYVLTPVELVKCKL--QVSNLTGVSGPRYTAVL--PTL-----RAIVKQNGLGGLWQ 164

Query: 195 GVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYK-LSMGAISGGVAQTITY 253
           G   T +      A+ F  YE LK ++        S  +++++ L+ GA +G       +
Sbjct: 165 GQSGTFIRESAGGAVWFTAYEVLKGWLARRRG---STENTVWELLASGAGAGAAFHASIF 221

Query: 254 PFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVS 313
           P D ++   Q   +G   LG        A+ T+ K  G  G+Y+G+   L + +P+ AV 
Sbjct: 222 PADTVKSTMQTEHLG---LG-------PAVRTVLKKHGPTGFYRGVGITLLRALPANAVI 271

Query: 314 WLVYE 318
           + VYE
Sbjct: 272 FYVYE 276

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 81/197 (41%), Gaps = 20/197 (10%)

Query: 124 WQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAY 183
           ++ L  G + G    +  YP D V+ RL  Q+A L              P  W  +S  Y
Sbjct: 9   YKDLLYGGVAGSLGKLVEYPFDTVKVRLQTQSAALF-------------PTTWSCVSHTY 55

Query: 184 AEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSM-GA 242
            +EG   G Y+G+     G     A+ F  + + +  +   EN  S     L K+   GA
Sbjct: 56  KQEGLWRGFYQGMASPVFGAFLEHAVLFVSFNRAQAVL---ENCYSC--GPLEKVVFAGA 110

Query: 243 ISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTAN 302
           I+G     +  P +L++ + QV  + G   G  Y +V   L  I K  G  G ++G +  
Sbjct: 111 IAGACTSYVLTPVELVKCKLQVSNLTGVS-GPRYTAVLPTLRAIVKQNGLGGLWQGQSGT 169

Query: 303 LFKVVPSTAVSWLVYEL 319
             +     AV +  YE+
Sbjct: 170 FIRESAGGAVWFTAYEV 186

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 82/194 (42%), Gaps = 26/194 (13%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYN---KGLFDAIGQVYKEENIKGLFRGN 84
            AG IAGA +  V++P E VK  LQV + T         +   +  + K+  + GL++G 
Sbjct: 107 FAGAIAGACTSYVLTPVELVKCKLQVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLWQGQ 166

Query: 85  GLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNN-WQRLFSGALCGGCSVVATYP 143
               IR     AV F  +E  K  +     + +G   N  W+ L SGA  G     + +P
Sbjct: 167 SGTFIRESAGGAVWFTAYEVLKGWL----ARRRGSTENTVWELLASGAGAGAAFHASIFP 222

Query: 144 LDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGI 203
            D V++ +  +   L              P V  +L K      G  G YRGV  T L  
Sbjct: 223 ADTVKSTMQTEHLGLG-------------PAVRTVLKKH-----GPTGFYRGVGITLLRA 264

Query: 204 VPYVALNFAVYEQL 217
           +P  A+ F VYE L
Sbjct: 265 LPANAVIFYVYESL 278

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 83.6 bits (205), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 76/281 (27%), Positives = 129/281 (45%), Gaps = 28/281 (9%)

Query: 51  LQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIF 110
           L  ++S+  +N G  +A  ++   E I  L+RG  L  +   P + V F  +E      +
Sbjct: 93  LHCKNSSLKFN-GTLEAFTKIASVEGITSLWRGISLTLLMAIPANMVYFSGYE------Y 145

Query: 111 HVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIA 170
             D             LF GA+    +  +  PL+LV+T+L          S  R+S   
Sbjct: 146 IRDVSPIASTYPTLNPLFCGAIARVFAATSIAPLELVKTKLQ---------SIPRSSKST 196

Query: 171 KPPGVWKLLSKAYAEEGGIMG----LYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDEN 226
           K   + K L     +E  ++G    L++G+  T    VP+ A+ ++ YE  KE +  D  
Sbjct: 197 KTWMMVKDLLNETRQEMKMVGPSRALFKGLEITLWRDVPFSAIYWSSYELCKERLWLDST 256

Query: 227 GNSSMRDS-----LYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNEL--GFHYNSV 279
             +S +D+     +   + G ISG +A   T+PFD+ + R+Q+  M  ++   G    ++
Sbjct: 257 RFAS-KDANWVHFINSFASGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNM 315

Query: 280 WDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYELT 320
           +  L TI +TEG    Y GL A + K+ PS A+    YE++
Sbjct: 316 FKFLETIWRTEGLAALYTGLAARVIKIRPSCAIMISSYEIS 356

 Score = 35.8 bits (81), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 39/88 (44%), Gaps = 6/88 (6%)

Query: 26  AFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKG------LFDAIGQVYKEENIKG 79
           +F +G I+G I+     PF+  K   Q+     +  KG      +F  +  +++ E +  
Sbjct: 271 SFASGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLETIWRTEGLAA 330

Query: 80  LFRGNGLNCIRVFPYSAVQFVVFEGCKK 107
           L+ G     I++ P  A+    +E  KK
Sbjct: 331 LYTGLAARVIKIRPSCAIMISSYEISKK 358

 Score = 28.9 bits (63), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 26/61 (42%), Gaps = 2/61 (3%)

Query: 262 FQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYELTW 321
           FQ L    + L F  N   +A   I   EG    ++G++  L   +P+  V +  YE   
Sbjct: 90  FQELHCKNSSLKF--NGTLEAFTKIASVEGITSLWRGISLTLLMAIPANMVYFSGYEYIR 147

Query: 322 D 322
           D
Sbjct: 148 D 148

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 82.4 bits (202), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 75/306 (24%), Positives = 145/306 (47%), Gaps = 34/306 (11%)

Query: 27  FLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYK-----EENIKGLF 81
            ++G  AG I+  V  P + +K+ LQ+ ++        ++ + ++ K     ++ +K  +
Sbjct: 16  IISGLTAGTITTIVTHPLDLIKLRLQL-AAIDLKPSSYYNQVQRIIKDGSGTQQLLKEAY 74

Query: 82  RGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKG-------KGEQLNNWQRLFSGALCG 134
           RG G+N I       + F ++   K  ++ + ++           ++ +   L S    G
Sbjct: 75  RGLGINIIGNAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDRKMTSSMYLVSAGASG 134

Query: 135 GCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYR 194
             + + T P+ +++TR+       +K S+   S       +   +++ Y EEG +   +R
Sbjct: 135 LATALLTNPMWVIKTRIMS-----TKSSQGYTS-------ILNAITRIYTEEG-LKTFWR 181

Query: 195 GVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMR-DSLYKLSMGAISGGVAQTITY 253
           G+ P+  G V   AL FA+Y+ LK     D N     R +++  + + ++S  ++ +  Y
Sbjct: 182 GLVPSLFG-VTQGALYFAIYDTLKLKYLHDRNDIQERRLNAVETIGIISLSKMISVSSVY 240

Query: 254 PFDLLRRRFQVLAMGGNELGFHYNSVWDALV-TIGKTEGFKGYYKGLTANLFKVVPSTAV 312
           P  LL+   Q      NE     NS  ++L+ +I  T G  G+YKGL ANL + +PST +
Sbjct: 241 PLQLLKTNLQTFRTEHNE-----NSKMNSLIRSIWHTNGIAGFYKGLFANLVRAIPSTCI 295

Query: 313 SWLVYE 318
           ++ VYE
Sbjct: 296 TFGVYE 301

 Score = 63.2 bits (152), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 50/214 (23%), Positives = 95/214 (44%), Gaps = 16/214 (7%)

Query: 7   PAIEEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFD 66
           PA++  N+  N  K  +++  ++ G +G  +  + +P   +K  +    S+  Y   + +
Sbjct: 109 PALQ--NKFMNDRKMTSSMYLVSAGASGLATALLTNPMWVIKTRIMSTKSSQGYT-SILN 165

Query: 67  AIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQR 126
           AI ++Y EE +K  +RG   +   V    A+ F +++  K    H     +  +LN  + 
Sbjct: 166 AITRIYTEEGLKTFWRGLVPSLFGV-TQGALYFAIYDTLKLKYLHDRNDIQERRLNAVET 224

Query: 127 LFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEE 186
           +   +L    SV + YPL L++T L  QT        S+ + + +   +W          
Sbjct: 225 IGIISLSKMISVSSVYPLQLLKTNL--QTFRTEHNENSKMNSLIR--SIW--------HT 272

Query: 187 GGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEF 220
            GI G Y+G++   +  +P   + F VYE  K  
Sbjct: 273 NGIAGFYKGLFANLVRAIPSTCITFGVYEHFKHI 306

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 87/195 (44%), Gaps = 31/195 (15%)

Query: 125 QRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYA 184
           + + SG   G  + + T+PLDL++ RL +   +L            KP   +  + +   
Sbjct: 14  KEIISGLTAGTITTIVTHPLDLIKLRLQLAAIDL------------KPSSYYNQVQRIIK 61

Query: 185 EEGGIMGL----YRGVWPTSLGIVPYVALNFAVYEQLKEFM------PSDEN---GNSSM 231
           +  G   L    YRG+    +G      L F +Y   K+ +      P+ +N    +  M
Sbjct: 62  DGSGTQQLLKEAYRGLGINIIGNAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDRKM 121

Query: 232 RDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEG 291
             S+Y +S GA SG     +T P  +++ R  +++   ++    Y S+ +A+  I   EG
Sbjct: 122 TSSMYLVSAGA-SGLATALLTNPMWVIKTR--IMSTKSSQ---GYTSILNAITRIYTEEG 175

Query: 292 FKGYYKGLTANLFKV 306
            K +++GL  +LF V
Sbjct: 176 LKTFWRGLVPSLFGV 190

 Score = 32.7 bits (73), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 43/95 (45%), Gaps = 6/95 (6%)

Query: 224 DENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDAL 283
           D   NS +     ++  G  +G +   +T+P DL++ R Q+ A+      + YN V   +
Sbjct: 2   DATSNSVLSPLQKEIISGLTAGTITTIVTHPLDLIKLRLQLAAIDLKPSSY-YNQVQRII 60

Query: 284 VT-IGKTEGFKGYYKGLTANLFKVVPSTAVSWLVY 317
               G  +  K  Y+GL  N+       AV+W +Y
Sbjct: 61  KDGSGTQQLLKEAYRGLGINII----GNAVAWGLY 91

>Scas_662.12
          Length = 308

 Score = 82.4 bits (202), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 80/314 (25%), Positives = 147/314 (46%), Gaps = 44/314 (14%)

Query: 27  FLAGGIAGAISRTVVSPFERVKILLQVQSSTTA--YNKGLFDAIGQVYKEEN-------- 76
            ++G  AG+++  +V P + +K+ LQ+ ++TT   + KG    I ++             
Sbjct: 11  IISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNSKKMGSQGPI 70

Query: 77  ---IKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLF--SGA 131
              IK  +RG  +N +      ++ F ++   K ++F           NN   +F  SG 
Sbjct: 71  YNLIKESYRGLPINLLGNAVAWSLYFTIYNSTKDYMFQ-----NNYLHNNNTTIFLTSGL 125

Query: 132 LCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMG 191
           + G  + + T PL +++TR+     + S+  K     I    G   LL+K      G   
Sbjct: 126 ISGISTTLLTNPLWVIKTRI----MSTSRHHKDSYKSIRH--GFKSLLTKE-----GPKA 174

Query: 192 LYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDS----LYKLSMGAISGGV 247
           ++ G+ P+ LG V   A+ F +Y+ LK  +  + N N S +D+    L  + + ++S  +
Sbjct: 175 IWMGLLPSLLG-VSQGAIYFMIYDNLK--LHFNVNLNKSKKDNANANLKIVLISSLSKML 231

Query: 248 AQTITYPFDLLRRRFQVLAMGGNEL---GFHYNSVWDALVTIGKTEGFKGYYKGLTANLF 304
           +    YPF LL+   Q      N +    +H+ ++   +  I +  G KG YKGL+ANL 
Sbjct: 232 SVMSVYPFQLLKSNLQTFRSVTNNIPQNDYHFITL---IRKIYRDNGIKGLYKGLSANLL 288

Query: 305 KVVPSTAVSWLVYE 318
           + +PST +++ +YE
Sbjct: 289 RAIPSTCITFCIYE 302

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 99/210 (47%), Gaps = 20/210 (9%)

Query: 17  NFLKQDTNVAFLAGGIAGAISRTVVS-PFERVKILLQVQSSTTAYNKGLFDAIGQVYK-- 73
           N+L  +    FL  G+   IS T+++ P   +K  +    ST+ ++K  + +I   +K  
Sbjct: 110 NYLHNNNTTIFLTSGLISGISTTLLTNPLWVIKTRIM---STSRHHKDSYKSIRHGFKSL 166

Query: 74  --EENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVD-TKGKGEQLN-NWQRLFS 129
             +E  K ++ G  L  +      A+ F++++  K H F+V+  K K +  N N + +  
Sbjct: 167 LTKEGPKAIWMG-LLPSLLGVSQGAIYFMIYDNLKLH-FNVNLNKSKKDNANANLKIVLI 224

Query: 130 GALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGI 189
            +L    SV++ YP  L+++ L  QT       +S  ++I +    +  L +    + GI
Sbjct: 225 SSLSKMLSVMSVYPFQLLKSNL--QTF------RSVTNNIPQNDYHFITLIRKIYRDNGI 276

Query: 190 MGLYRGVWPTSLGIVPYVALNFAVYEQLKE 219
            GLY+G+    L  +P   + F +YE  K 
Sbjct: 277 KGLYKGLSANLLRAIPSTCITFCIYENFKS 306

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/203 (22%), Positives = 89/203 (43%), Gaps = 23/203 (11%)

Query: 125 QRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLL--SKA 182
           + + SG   G  + +  +PLDL++ RL +     ++  +   + +     + +L+  SK 
Sbjct: 9   KEIISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYL-----INELINNSKK 63

Query: 183 YAEEGGIMGL----YRGVWPTSLGIVPYVALNFAVYEQLKEFMPSD---ENGNSSMRDSL 235
              +G I  L    YRG+    LG     +L F +Y   K++M  +    N N+++    
Sbjct: 64  MGSQGPIYNLIKESYRGLPINLLGNAVAWSLYFTIYNSTKDYMFQNNYLHNNNTTIF--- 120

Query: 236 YKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGY 295
             L+ G ISG     +T P  +++ R    +    +    Y S+     ++   EG K  
Sbjct: 121 --LTSGLISGISTTLLTNPLWVIKTRIMSTSRHHKD---SYKSIRHGFKSLLTKEGPKAI 175

Query: 296 YKGLTANLFKVVPSTAVSWLVYE 318
           + GL  +L   V   A+ +++Y+
Sbjct: 176 WMGLLPSLLG-VSQGAIYFMIYD 197

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 82.0 bits (201), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 75/304 (24%), Positives = 129/304 (42%), Gaps = 39/304 (12%)

Query: 27  FLAGGIAGAISRTVVSPFERVKILLQVQSSTTA----------YNKGLFDAIGQVYKEEN 76
           F++G +AG    TV+ P + VK   Q++ +T            YN G+ D + ++ K+E 
Sbjct: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYN-GVIDCLKKIVKKEG 74

Query: 77  IKGLFRGNGLNCIRVFPYSAVQFVV---FEGCKKHIFHVDTKGKGEQLNNWQRLFSGALC 133
              L+RG     +   P  A +F     ++   K++F+ +      +      + +GA  
Sbjct: 75  FSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTN------ETTQKISIAAGASA 128

Query: 134 GGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLY 193
           G        P +L++ R+  Q    S L            G    L K    EG IMGLY
Sbjct: 129 GMTEAAVIVPFELIKIRM--QDVKSSYL------------GPMDCLKKTIKNEG-IMGLY 173

Query: 194 RGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITY 253
           +G+  T      +    F V  Q++  MP  +      R+ L     GAI G V   +  
Sbjct: 174 KGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIA---GAIGGTVGTMLNT 230

Query: 254 PFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVS 313
           PFD+++ R Q +    + +   YN    +L+ I + EGF+  YKG    + ++ P  ++ 
Sbjct: 231 PFDVVKSRIQSVDAVSSAVK-KYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLM 289

Query: 314 WLVY 317
            +V+
Sbjct: 290 LVVF 293

 Score = 62.8 bits (151), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 81/180 (45%), Gaps = 12/180 (6%)

Query: 126 RLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAE 185
           +  SGA+ G   +   YPLD+V+TR  ++    +  + +    + +  GV   L K   +
Sbjct: 15  QFISGAVAGISELTVMYPLDVVKTRFQLEVT--TPTAAAVGKQVERYNGVIDCLKKIVKK 72

Query: 186 EGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISG 245
           E G   LYRG+    L   P  A  FA  +Q ++   +  N N + +     ++ GA +G
Sbjct: 73  E-GFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQK--ISIAAGASAG 129

Query: 246 GVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFK 305
                +  PF+L++ R Q       ++   Y    D L    K EG  G YKG+ + +++
Sbjct: 130 MTEAAVIVPFELIKIRMQ-------DVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWR 182

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 83/199 (41%), Gaps = 22/199 (11%)

Query: 25  VAFLAGGIAGAISRTVVSPFERVKILLQ-VQSSTTAYNKGLFDAIGQVYKEENIKGLFRG 83
           ++  AG  AG     V+ PFE +KI +Q V+SS      G  D + +  K E I GL++G
Sbjct: 120 ISIAAGASAGMTEAAVIVPFELIKIRMQDVKSSYL----GPMDCLKKTIKNEGIMGLYKG 175

Query: 84  NGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYP 143
                 R   ++   F V    +  +    TKG+  +      L +GA+ G    +   P
Sbjct: 176 IESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTR----NDLIAGAIGGTVGTMLNTP 231

Query: 144 LDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKL--LSKAYAEEGGIMGLYRGVWPTSL 201
            D+V++R+    A  S + K            W L  L   Y EE G   LY+G  P   
Sbjct: 232 FDVVKSRIQSVDAVSSAVKKYN----------WCLPSLLVIYREE-GFRALYKGFVPKVC 280

Query: 202 GIVPYVALNFAVYEQLKEF 220
            + P  +L   V+  +  F
Sbjct: 281 RLAPGGSLMLVVFTGMMNF 299

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 48/100 (48%), Gaps = 9/100 (9%)

Query: 221 MPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQV------LAMGGNELGF 274
           M SD N        +Y+   GA++G    T+ YP D+++ RFQ+       A  G ++  
Sbjct: 1   MSSDSNAKP--LPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVE- 57

Query: 275 HYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSW 314
            YN V D L  I K EGF   Y+G+++ +    P  A  +
Sbjct: 58  RYNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKF 97

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 44/88 (50%), Gaps = 5/88 (5%)

Query: 21  QDTNVAFLAGGIAGAISRTVVSPFERVKILLQ----VQSSTTAYNKGLFDAIGQVYKEEN 76
           Q T    +AG I G +   + +PF+ VK  +Q    V S+   YN  L  ++  +Y+EE 
Sbjct: 209 QKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCL-PSLLVIYREEG 267

Query: 77  IKGLFRGNGLNCIRVFPYSAVQFVVFEG 104
            + L++G      R+ P  ++  VVF G
Sbjct: 268 FRALYKGFVPKVCRLAPGGSLMLVVFTG 295

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score = 81.6 bits (200), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 76/294 (25%), Positives = 132/294 (44%), Gaps = 34/294 (11%)

Query: 30  GGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENI-KGLFRGNGLNC 88
           G +AGAI + +  PF+ VK+ LQ Q +        +  I   Y +E I KG ++G     
Sbjct: 14  GSVAGAIGKVIEYPFDTVKVRLQTQPA--HLYPTTWSCIRSTYTDEGIWKGFYQGIASPL 71

Query: 89  IRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVR 148
                 +AV FV F  C   +   D   + + L   + ++SGA  G C+     P++LV+
Sbjct: 72  FGAALENAVLFVSFNQCTNFL---DEFTQLKPLT--KTIYSGAFAGACASFILTPVELVK 126

Query: 149 TRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVA 208
            +L  Q +N+S    +  S   +   VW  + K+  +E G++GL++G   T +      A
Sbjct: 127 CKL--QVSNIS----NSLSQTTRHTSVWPTI-KSVIKEKGLLGLWQGQLSTFVRECLGGA 179

Query: 209 LNFAVYEQLK----EFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQV 264
           + F  YE +K       P+++  ++        L  GA +G +     +P D ++   Q 
Sbjct: 180 VWFTTYEIMKMKFASLHPAEKENHT-----WELLVSGASAGVLFNASVFPADTVKSVCQT 234

Query: 265 LAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
                      + S+ +AL  + +T G  G+Y+GL   L +  P+ A  +  YE
Sbjct: 235 ----------EHVSIVNALKKVLRTHGITGFYRGLGITLIRAAPANATVFYTYE 278

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 62/217 (28%), Positives = 96/217 (44%), Gaps = 30/217 (13%)

Query: 13  NQLKNFLKQDTNVAFL-----AGGIAGAISRTVVSPFERVKILLQVQS-----STTAYNK 62
           NQ  NFL + T +  L     +G  AGA +  +++P E VK  LQV +     S T  + 
Sbjct: 86  NQCTNFLDEFTQLKPLTKTIYSGAFAGACASFILTPVELVKCKLQVSNISNSLSQTTRHT 145

Query: 63  GLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLN 122
            ++  I  V KE+ + GL++G     +R     AV F  +E  K     +    K  + +
Sbjct: 146 SVWPTIKSVIKEKGLLGLWQGQLSTFVRECLGGAVWFTTYEIMKMKFASLHPAEK--ENH 203

Query: 123 NWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKA 182
            W+ L SGA  G     + +P D V++    QT ++S ++  +           K+L   
Sbjct: 204 TWELLVSGASAGVLFNASVFPADTVKS--VCQTEHVSIVNALK-----------KVL--- 247

Query: 183 YAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKE 219
                GI G YRG+  T +   P  A  F  YE LK+
Sbjct: 248 --RTHGITGFYRGLGITLIRAAPANATVFYTYETLKK 282

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 81/192 (42%), Gaps = 20/192 (10%)

Query: 130 GALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGI 189
           G++ G    V  YP D V+ RL  Q A+L              P  W  +   Y +EG  
Sbjct: 14  GSVAGAIGKVIEYPFDTVKVRLQTQPAHLY-------------PTTWSCIRSTYTDEGIW 60

Query: 190 MGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQ 249
            G Y+G+     G     A+ F  + Q   F+  DE   + ++     +  GA +G  A 
Sbjct: 61  KGFYQGIASPLFGAALENAVLFVSFNQCTNFL--DEF--TQLKPLTKTIYSGAFAGACAS 116

Query: 250 TITYPFDLLRRRFQVLAMGGNELG--FHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVV 307
            I  P +L++ + QV  +  N L     + SVW  + ++ K +G  G ++G  +   +  
Sbjct: 117 FILTPVELVKCKLQVSNIS-NSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVREC 175

Query: 308 PSTAVSWLVYEL 319
              AV +  YE+
Sbjct: 176 LGGAVWFTTYEI 187

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 43/85 (50%), Gaps = 7/85 (8%)

Query: 229 SSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGK 288
           S +  +L  ++ G+++G + + I YPFD ++ R Q       +    Y + W  + +   
Sbjct: 2   SDLESALKDIAYGSVAGAIGKVIEYPFDTVKVRLQ------TQPAHLYPTTWSCIRSTYT 55

Query: 289 TEG-FKGYYKGLTANLFKVVPSTAV 312
            EG +KG+Y+G+ + LF      AV
Sbjct: 56  DEGIWKGFYQGIASPLFGAALENAV 80

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 81.3 bits (199), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 70/300 (23%), Positives = 124/300 (41%), Gaps = 33/300 (11%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQS--STTA---YNKGLFDAIGQVYKEENIKGLFR 82
           +AG  AG    +V+ P + +K  LQ     STT        +   +  +  +E    L++
Sbjct: 23  MAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIPSTMLRQLSSISAQEGSMVLWK 82

Query: 83  GNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATY 142
           G     +   P  AV F  +E  K   F +D      + + ++  FSGA     +     
Sbjct: 83  GVQSVLLGAGPAHAVYFATYEMVKS--FLIDEATSTSKYHFFKTAFSGATATIAADALMN 140

Query: 143 PLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLG 202
           P D+++ R+ + T N+S               VW    + Y++EG     +   +PT+L 
Sbjct: 141 PFDVIKQRIQLNT-NIS---------------VWDTAKRIYSKEG--FQAFYSSYPTTLA 182

Query: 203 I-VPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRR 261
           I +P+ A NF +Y+    +        S + +       G ISG     +T P D ++  
Sbjct: 183 INIPFAAFNFGIYDTATRYF-----NPSGVYNPFIHCLCGGISGAACAGLTTPLDCIKTA 237

Query: 262 FQVLAMG--GNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYEL 319
            QV        E+    ++   A   I +  G++G++ G+   +   +P+TA+SW  YE 
Sbjct: 238 LQVRGSEKVSMEVFKQADTFKKATRAIYQVYGWRGFWSGVKPRILANMPATAISWTAYEF 297

 Score = 71.2 bits (173), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 58/194 (29%), Positives = 89/194 (45%), Gaps = 17/194 (8%)

Query: 125 QRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYA 184
            +L +GA  G       +PLD ++TRL    A    +S +    I  P  + + LS   A
Sbjct: 20  HQLMAGAFAGIAEHSVIFPLDALKTRLQAMHA----ISTTGGQPI--PSTMLRQLSSISA 73

Query: 185 EEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAIS 244
           +EG  M L++GV    LG  P  A+ FA YE +K F+  DE  ++S          GA +
Sbjct: 74  QEGS-MVLWKGVQSVLLGAGPAHAVYFATYEMVKSFL-IDEATSTSKYHFFKTAFSGATA 131

Query: 245 GGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLF 304
              A  +  PFD++++R Q   +  N       SVWD    I   EGF+ +Y      L 
Sbjct: 132 TIAADALMNPFDVIKQRIQ---LNTN------ISVWDTAKRIYSKEGFQAFYSSYPTTLA 182

Query: 305 KVVPSTAVSWLVYE 318
             +P  A ++ +Y+
Sbjct: 183 INIPFAAFNFGIYD 196

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 85/198 (42%), Gaps = 25/198 (12%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLN 87
            +G  A   +  +++PF+ +K  +Q+ +     N  ++D   ++Y +E  +  +      
Sbjct: 126 FSGATATIAADALMNPFDVIKQRIQLNT-----NISVWDTAKRIYSKEGFQAFYSSYPTT 180

Query: 88  CIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVA----TYP 143
                P++A  F ++          DT  +    +     F   LCGG S  A    T P
Sbjct: 181 LAINIPFAAFNFGIY----------DTATRYFNPSGVYNPFIHCLCGGISGAACAGLTTP 230

Query: 144 LDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGI 203
           LD ++T L V+       S+  + ++ K    +K  ++A  +  G  G + GV P  L  
Sbjct: 231 LDCIKTALQVRG------SEKVSMEVFKQADTFKKATRAIYQVYGWRGFWSGVKPRILAN 284

Query: 204 VPYVALNFAVYEQLKEFM 221
           +P  A+++  YE  K F+
Sbjct: 285 MPATAISWTAYEFAKHFL 302

 Score = 35.8 bits (81), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 42/88 (47%), Gaps = 7/88 (7%)

Query: 236 YKLSMGAISGGVAQTITYPFDLLRRRFQVL----AMGGNELGFHYNSVWDALVTIGKTEG 291
           ++L  GA +G    ++ +P D L+ R Q +      GG  +    +++   L +I   EG
Sbjct: 20  HQLMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIP---STMLRQLSSISAQEG 76

Query: 292 FKGYYKGLTANLFKVVPSTAVSWLVYEL 319
               +KG+ + L    P+ AV +  YE+
Sbjct: 77  SMVLWKGVQSVLLGAGPAHAVYFATYEM 104

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 41/94 (43%), Gaps = 14/94 (14%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSS----------TTAYNKGLFDAIGQVYKEENI 77
           L GGI+GA    + +P + +K  LQV+ S             + K    AI QVY     
Sbjct: 215 LCGGISGAACAGLTTPLDCIKTALQVRGSEKVSMEVFKQADTFKKAT-RAIYQVY---GW 270

Query: 78  KGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFH 111
           +G + G     +   P +A+ +  +E  K  +FH
Sbjct: 271 RGFWSGVKPRILANMPATAISWTAYEFAKHFLFH 304

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score = 82.0 bits (201), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 86/304 (28%), Positives = 135/304 (44%), Gaps = 37/304 (12%)

Query: 26  AFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNG 85
           +FLAG IAGAI  ++  PFE  K  LQ+    +  ++     I    K   I  ++ G  
Sbjct: 93  SFLAGSIAGAIEASITYPFEFAKTRLQLVDKASKASRNPLVLIYNTGKNYGISSIYVGCP 152

Query: 86  LNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGC-SVVATYPL 144
              +     + ++F+ F+  K  +     K  GE L+ ++ + +G   G   SVVA  P 
Sbjct: 153 AFIVGNTAKAGIRFLGFDTIKNLL---RDKKTGE-LSGFRGVVAGLGAGLLESVVAVTPF 208

Query: 145 DLVRTRL-SVQTANLSKLS---KSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTS 200
           + ++T L   + A + K     K   S+ A      KLLS     + G  GLYRGV P S
Sbjct: 209 EAIKTALIDDKQAAVPKYQNNGKGMVSNYA------KLLS-----DQGFSGLYRGVLPVS 257

Query: 201 LGIVPYVALNFAVYEQLKEF------MPSDENGNSSMRDSLYKLSMGAISGGVAQTITYP 254
           +      A+    Y ++K        +P D+  +S +        +GA SG V    T P
Sbjct: 258 MRQAANQAVRLGCYNKIKTLVQDYTNVPKDKPLSSGL-----TFIVGAFSGIVTVYTTMP 312

Query: 255 FDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSW 314
            D ++ R Q L  G       Y+S  +   TI K EG K ++KG T  L +++ S  + +
Sbjct: 313 IDTVKTRMQSLNAG------QYSSTINCFATIFKEEGLKTFWKGATPRLGRLILSGGIVF 366

Query: 315 LVYE 318
            +YE
Sbjct: 367 TIYE 370

 Score = 34.7 bits (78), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 34/83 (40%), Gaps = 12/83 (14%)

Query: 223 SDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGG----NELGFHYNS 278
           S  + N    D  +    G+I+G +  +ITYPF+  + R Q++        N L   YN+
Sbjct: 79  STMSSNKPAVDPFHSFLAGSIAGAIEASITYPFEFAKTRLQLVDKASKASRNPLVLIYNT 138

Query: 279 VWDALVTIGKTEGFKGYYKGLTA 301
                   GK  G    Y G  A
Sbjct: 139 --------GKNYGISSIYVGCPA 153

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score = 80.5 bits (197), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 78/318 (24%), Positives = 130/318 (40%), Gaps = 33/318 (10%)

Query: 12  ENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNK--GLFDAIG 69
           +N + +    +  V  +AGG AG        P + +K+ +Q+        K  G      
Sbjct: 46  DNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGA 105

Query: 70  QVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFS 129
            +Y  E +   ++G G   I + P  A++F  +E  +  +    T      ++      +
Sbjct: 106 NIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTG----VVSTGNTFLA 161

Query: 130 GALCGGC-SVVATYPLDLVRTRLSVQTAN-LSKLSKSRASDIAKPPGVWKLLSKAY--AE 185
           G   G   +V+   P+++V+ RL  Q  +  ++  K R +           +  AY   +
Sbjct: 162 GVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNA-----------IQAAYLIVK 210

Query: 186 EGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISG 245
           E GI  LYRGV  T+         NF VY +L E +   E   S    S     +G +SG
Sbjct: 211 EEGIGALYRGVSLTAARQATNQGANFTVYSKLMERL--QEYHGSQNLPSWETSLIGLVSG 268

Query: 246 GVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKT----EGFKGYYKGLTA 301
            +      P D ++ R Q       +      S W  + TIG+     EGF+  YKG+T 
Sbjct: 269 AIGPFSNAPLDTIKTRLQ------KDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITP 322

Query: 302 NLFKVVPSTAVSWLVYEL 319
            + +V P  AV++ VYE 
Sbjct: 323 RVMRVAPGQAVTFTVYEF 340

 Score = 65.1 bits (157), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 59/207 (28%), Positives = 86/207 (41%), Gaps = 22/207 (10%)

Query: 22  DTNVAFLAGGIAGAISRT-VVSPFERVKILLQVQSSTTAYNKGLF-DAIGQVY---KEEN 76
            T   FLAG  AG      VV+P E VKI LQ Q    A  +  + +AI   Y   KEE 
Sbjct: 154 STGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEG 213

Query: 77  IKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGC 136
           I  L+RG  L   R        F V+    K +  +      + L +W+    G + G  
Sbjct: 214 IGALYRGVSLTAARQATNQGANFTVYS---KLMERLQEYHGSQNLPSWETSLIGLVSGAI 270

Query: 137 SVVATYPLDLVRTRLSVQ--TANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYR 194
              +  PLD ++TRL     T NLS   +               + +   +E G   LY+
Sbjct: 271 GPFSNAPLDTIKTRLQKDKSTRNLSNWVR------------ITTIGRQLVQEEGFRALYK 318

Query: 195 GVWPTSLGIVPYVALNFAVYEQLKEFM 221
           G+ P  + + P  A+ F VYE ++  +
Sbjct: 319 GITPRVMRVAPGQAVTFTVYEFVRRHL 345

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score = 79.3 bits (194), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 75/311 (24%), Positives = 130/311 (41%), Gaps = 41/311 (13%)

Query: 27  FLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYN------------KGLFDAIGQVYKE 74
           F AG IAG     V+ P + VK  +Q+Q +T  +              G+ D + ++ K+
Sbjct: 15  FTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMDCLTKIVKK 74

Query: 75  ENIKGLFRGNGLNCIRVFPYSAVQFV---VFEGCKKHIFHVDTKGKGEQLNNWQRLFSGA 131
           E    L++G     +   P  A++F     F+   K IF        +++     ++SGA
Sbjct: 75  EGFSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIFPTPNGEMTQKIA----IYSGA 130

Query: 132 LCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMG 191
             G        P +LV+ RL  Q  N         S    P  V     K    +GG++ 
Sbjct: 131 SAGAVEAFVVAPFELVKIRL--QDVN---------SQFKTPIEV----VKNSVVKGGVLS 175

Query: 192 LYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTI 251
           L+ G+  T    V + A  F +  Q+++ +P+ +      R+ L     GAI G V   +
Sbjct: 176 LFNGLEATIWRHVLWNAGYFGIIFQIRKLLPAAKTSTEKTRNDLIA---GAIGGTVGCLL 232

Query: 252 TYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTA 311
             PFD+++ R Q  +    +    YN    +++ + + EGFK  YKG    + ++ P   
Sbjct: 233 NTPFDVVKSRIQRSSGPLRK----YNWSLPSVLLVYREEGFKALYKGFAPKVMRLAPGGG 288

Query: 312 VSWLVYELTWD 322
           +  +V+    D
Sbjct: 289 LLLVVFTNVMD 299

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 43/88 (48%), Gaps = 8/88 (9%)

Query: 235 LYKLSMGAISGGVAQTITYPFDLLRRRFQV-LAMGGNELGF-------HYNSVWDALVTI 286
           +Y+ + GAI+G     + YP D+++ R Q+ +   G+           HY  V D L  I
Sbjct: 12  IYQFTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMDCLTKI 71

Query: 287 GKTEGFKGYYKGLTANLFKVVPSTAVSW 314
            K EGF   YKG+T+ +    P  A+ +
Sbjct: 72  VKKEGFSHLYKGITSPILMEAPKRAIKF 99

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 84/201 (41%), Gaps = 27/201 (13%)

Query: 24  NVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKG---- 79
            +A  +G  AGA+   VV+PFE VKI LQ  +S        F    +V K   +KG    
Sbjct: 123 KIAIYSGASAGAVEAFVVAPFELVKIRLQDVNSQ-------FKTPIEVVKNSVVKGGVLS 175

Query: 80  LFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVV 139
           LF G      R   ++A  F +    +K +     K   E+  N   L +GA+ G    +
Sbjct: 176 LFNGLEATIWRHVLWNAGYFGIIFQIRKLL--PAAKTSTEKTRN--DLIAGAIGGTVGCL 231

Query: 140 ATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPT 199
              P D+V++R+   +  L K + S  S +             Y EE G   LY+G  P 
Sbjct: 232 LNTPFDVVKSRIQRSSGPLRKYNWSLPSVLL-----------VYREE-GFKALYKGFAPK 279

Query: 200 SLGIVPYVALNFAVYEQLKEF 220
            + + P   L   V+  + +F
Sbjct: 280 VMRLAPGGGLLLVVFTNVMDF 300

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 38/82 (46%)

Query: 21  QDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGL 80
           + T    +AG I G +   + +PF+ VK  +Q  S           ++  VY+EE  K L
Sbjct: 213 EKTRNDLIAGAIGGTVGCLLNTPFDVVKSRIQRSSGPLRKYNWSLPSVLLVYREEGFKAL 272

Query: 81  FRGNGLNCIRVFPYSAVQFVVF 102
           ++G     +R+ P   +  VVF
Sbjct: 273 YKGFAPKVMRLAPGGGLLLVVF 294

>Kwal_23.4354
          Length = 343

 Score = 79.7 bits (195), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 67/276 (24%), Positives = 120/276 (43%), Gaps = 21/276 (7%)

Query: 51  LQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIF 110
           ++ ++S   YN   +DA G++ K E ++ L+RG  +  +   P + V F+ +E  +    
Sbjct: 75  VRCKTSPVRYN-STWDAFGKIAKIEGVQSLWRGLSITLLMAAPANMVYFIGYESLR---- 129

Query: 111 HVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRL-SVQTANLSKLSKSRASDI 169
             D     ++      L  GAL    +     PL+L RTRL S+  ++    +     D+
Sbjct: 130 --DKSRLQDKYPTLNPLMCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAMMIKDL 187

Query: 170 AKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDE---- 225
            K        S+    + G   L+RG+  T    VP+ ++ +  YE  K  +  D     
Sbjct: 188 IKE-------SRYEISKVGYKALFRGLEITLWRDVPFSSIYWGCYEFYKSNVSIDSEKSI 240

Query: 226 --NGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDAL 283
             + NS+    +     G+  G VA  +T+PFD+ + R Q+  +          +++  L
Sbjct: 241 VNSSNSNWNHFVNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYL 300

Query: 284 VTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYEL 319
             + K+EG    Y GL   + K+ PS A+    YE+
Sbjct: 301 NQMRKSEGLAALYTGLVPRVIKIAPSCAIMISTYEV 336

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 54/227 (23%), Positives = 101/227 (44%), Gaps = 27/227 (11%)

Query: 8   AIEEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQV------QSSTTAYN 61
           ++ ++++L++  K  T    + G +A  ++ T V+P E  +  LQ       +S+T    
Sbjct: 127 SLRDKSRLQD--KYPTLNPLMCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAMMI 184

Query: 62  KGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGK--GE 119
           K L         +   K LFRG  +   R  P+S++ +  +E  K ++  +D++      
Sbjct: 185 KDLIKESRYEISKVGYKALFRGLEITLWRDVPFSSIYWGCYEFYKSNV-SIDSEKSIVNS 243

Query: 120 QLNNWQRLFS----GALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPG- 174
             +NW    +    G+  G  + V T+P D+ +TR+ +   N         S + K P  
Sbjct: 244 SNSNWNHFVNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLN---------STLEKKPSK 294

Query: 175 -VWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEF 220
            ++K L++    EG +  LY G+ P  + I P  A+  + YE  K  
Sbjct: 295 NMFKYLNQMRKSEG-LAALYTGLVPRVIKIAPSCAIMISTYEVCKRL 340

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score = 79.0 bits (193), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 81/302 (26%), Positives = 130/302 (43%), Gaps = 34/302 (11%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENI-KGLFRGNGL 86
           L G IAGA+ + +  PF+ VK+ LQ Q      +   +  I   YK E I KG F+G   
Sbjct: 18  LYGSIAGALGKVIEYPFDTVKVRLQTQGRHVFPDT--WSCITYTYKNEGIIKGFFQGIAS 75

Query: 87  NCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDL 146
                   +A  F+ +  C K + H         L N   L SGA  G C+     P++L
Sbjct: 76  PLAGAAIENAALFLSYNQCSKFLQHYTNV---SDLTNI--LISGAFAGSCASFVLTPVEL 130

Query: 147 VRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLS--KAYAEEGGIMGLYRGVWPT----S 200
           ++ +L  Q +NL  L    A          +++   +A  +  G +GL++G   T    S
Sbjct: 131 IKCKL--QVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGTFIRES 188

Query: 201 LGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYK----LSMGAISGGVAQTITYPFD 256
            G V +    FA YE +K+++ S  N       +  K    L+ GA +G       +P D
Sbjct: 189 FGGVAW----FATYELMKKYLKSRHNIEDPSLPNDNKTWELLASGASAGLAFNASIFPAD 244

Query: 257 LLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLV 316
            ++   Q   +G          +  A+  I   +G +G+Y+GL   L + +P+ A  + V
Sbjct: 245 TVKSMMQTEHLG----------LKTAIKKIFVEKGLRGFYRGLGITLIRAIPANATVFYV 294

Query: 317 YE 318
           YE
Sbjct: 295 YE 296

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 95/228 (41%), Gaps = 38/228 (16%)

Query: 13  NQLKNFLKQDTNVA-----FLAGGIAGAISRTVVSPFERVKILLQVQS------------ 55
           NQ   FL+  TNV+      ++G  AG+ +  V++P E +K  LQV +            
Sbjct: 92  NQCSKFLQHYTNVSDLTNILISGAFAGSCASFVLTPVELIKCKLQVSNLQSLPLGVAGGN 151

Query: 56  STTAYNKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHI---FHV 112
           + T  +  +   I  V K     GL++G     IR        F  +E  KK++    ++
Sbjct: 152 TVTERHTRIIPTIQAVIKNRGFIGLWQGQSGTFIRESFGGVAWFATYELMKKYLKSRHNI 211

Query: 113 DTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKP 172
           +          W+ L SGA  G     + +P D V++ +  QT +L              
Sbjct: 212 EDPSLPNDNKTWELLASGASAGLAFNASIFPADTVKSMM--QTEHL-------------- 255

Query: 173 PGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEF 220
            G+   + K + E+G + G YRG+  T +  +P  A  F VYE L + 
Sbjct: 256 -GLKTAIKKIFVEKG-LRGFYRGLGITLIRAIPANATVFYVYETLSKL 301

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/204 (22%), Positives = 79/204 (38%), Gaps = 25/204 (12%)

Query: 124 WQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAY 183
           ++ +  G++ G    V  YP D V+ RL  Q  ++              P  W  ++  Y
Sbjct: 14  FRDILYGSIAGALGKVIEYPFDTVKVRLQTQGRHVF-------------PDTWSCITYTY 60

Query: 184 AEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAI 243
             EG I G ++G+     G     A  F  Y Q  +F+    N    + D    L  GA 
Sbjct: 61  KNEGIIKGFFQGIASPLAGAAIENAALFLSYNQCSKFLQHYTN----VSDLTNILISGAF 116

Query: 244 SGGVAQTITYPFDLLRRRFQVLAM--------GGNELGFHYNSVWDALVTIGKTEGFKGY 295
           +G  A  +  P +L++ + QV  +        GGN +   +  +   +  + K  GF G 
Sbjct: 117 AGSCASFVLTPVELIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGL 176

Query: 296 YKGLTANLFKVVPSTAVSWLVYEL 319
           ++G +    +        +  YEL
Sbjct: 177 WQGQSGTFIRESFGGVAWFATYEL 200

>Scas_489.4
          Length = 297

 Score = 78.6 bits (192), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 75/300 (25%), Positives = 127/300 (42%), Gaps = 29/300 (9%)

Query: 26  AFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNG 85
           +F+AG +AGAI  ++  PFE  K  LQ+   T+  ++     I    K +    ++ G  
Sbjct: 13  SFIAGALAGAIEASITYPFEFAKTRLQLIDKTSTASRNPLVLIYNTAKTQGTGAIYVGCP 72

Query: 86  LNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGC-SVVATYPL 144
              +     + ++F+ F+  K  +    T     +L+  + + +G   G   SVVA  P 
Sbjct: 73  AFIVGNTAKAGIRFLGFDTIKNMLRDPVTG----ELSGPRGVVAGLGAGLLESVVAVTPF 128

Query: 145 DLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIV 204
           + ++T L      L    ++    + +  G       +   + GIMGLYRGV P S+   
Sbjct: 129 EAIKTALIDDKQALKPKYQNNGRGMLRNYG-------SLVRDQGIMGLYRGVLPVSMRQA 181

Query: 205 PYVALNFAVYEQLKEFM------PSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLL 258
              A+    Y ++K  +      P D   +S +        +GA SG V    T P D +
Sbjct: 182 ANQAVRLGCYNKIKTMVQDYTNAPKDRPLSSGL-----TFIVGAFSGVVTVYTTMPIDTV 236

Query: 259 RRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
           + R Q L          Y S  +    I K EG K ++KG T  L +++ S  + + +YE
Sbjct: 237 KTRMQSLD------ATKYTSTVNCFAKIFKEEGLKTFWKGATPRLGRLILSGGIVFTIYE 290

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 83/200 (41%), Gaps = 20/200 (10%)

Query: 28  LAGGIAGAISRTV-VSPFERVKILL--QVQSSTTAYN---KGLFDAIGQVYKEENIKGLF 81
           +AG  AG +   V V+PFE +K  L    Q+    Y    +G+    G + +++ I GL+
Sbjct: 111 VAGLGAGLLESVVAVTPFEAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIMGLY 170

Query: 82  RGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVAT 141
           RG     +R     AV+   +   K  +       K   L++      GA  G  +V  T
Sbjct: 171 RGVLPVSMRQAANQAVRLGCYNKIKTMVQDYTNAPKDRPLSSGLTFIVGAFSGVVTVYTT 230

Query: 142 YPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSL 201
            P+D V+TR+             ++ D  K        +K + EE G+   ++G  P   
Sbjct: 231 MPIDTVKTRM-------------QSLDATKYTSTVNCFAKIFKEE-GLKTFWKGATPRLG 276

Query: 202 GIVPYVALNFAVYEQLKEFM 221
            ++    + F +YE +  F+
Sbjct: 277 RLILSGGIVFTIYENVLVFL 296

 Score = 35.4 bits (80), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 39/90 (43%), Gaps = 12/90 (13%)

Query: 233 DSLYKLSMGAISGGVAQTITYPFDLLRRRFQVL----AMGGNELGFHYNSVWDALVTIGK 288
           D L+    GA++G +  +ITYPF+  + R Q++        N L   YN+         K
Sbjct: 9   DPLHSFIAGALAGAIEASITYPFEFAKTRLQLIDKTSTASRNPLVLIYNT--------AK 60

Query: 289 TEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
           T+G    Y G  A +        + +L ++
Sbjct: 61  TQGTGAIYVGCPAFIVGNTAKAGIRFLGFD 90

>Scas_589.10
          Length = 316

 Score = 78.6 bits (192), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 74/309 (23%), Positives = 134/309 (43%), Gaps = 45/309 (14%)

Query: 27  FLAGGIAGAISRTVVSPFERVKILLQVQ-------SSTTAYNK-----GLFDAIGQVYKE 74
           F++G +AG     ++ P + VK   Q+Q       +S+ A  K      +   + ++ KE
Sbjct: 17  FISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKILKE 76

Query: 75  ENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCG 134
           E  K L++G     +   P  AV+F   E  ++ +     K K +++ +   L +G   G
Sbjct: 77  EGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMK---KFKLKEVTSTVTLLAGTFAG 133

Query: 135 GCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYR 194
               +   P +LV+ RL  Q A     S  R +             +   E  G+ G+Y 
Sbjct: 134 ITESLIVVPFELVKIRL--QDAQSDYRSPIRCT-------------RTIIENQGLFGIYA 178

Query: 195 G----VWPTSLGIVPYVALNFAVYEQLKEFMPSDENGN--SSMRDSLYKLSMGAISGGVA 248
           G    +W  ++    Y  L F    Q+K+F+P  ++      +R+      +GAI+G ++
Sbjct: 179 GFESTIWRNTIWNASYFGLIF----QVKKFIPRAKSTTKFQGIRNDFL---VGAIAGCMS 231

Query: 249 QTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVP 308
             ++ PFD+++ R Q         G  Y   W ++  I +TEG KG YKG+   + +  P
Sbjct: 232 CFLSVPFDVVKTRMQ--GSKKTSSGMCYGWAWQSVFLIYRTEGIKGIYKGILPIICRYGP 289

Query: 309 STAVSWLVY 317
              +  +V+
Sbjct: 290 GGGLLLVVF 298

 Score = 63.2 bits (152), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 79/182 (43%), Gaps = 13/182 (7%)

Query: 126 RLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKP--PGVWKLLSKAY 183
           +  SGA+ G    +  YPLD+V+TR  +Q  N   L+ S  +   +P    +   LSK  
Sbjct: 16  QFISGAVAGMSETIMMYPLDVVKTRFQLQI-NKKALATSSVAVPKQPEHSSILSCLSKIL 74

Query: 184 AEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAI 243
            EE G   LY+G+ P  L  VP  A+ FA  EQ ++ M            S   L  G  
Sbjct: 75  KEE-GFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKFKLKEV--TSTVTLLAGTF 131

Query: 244 SGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANL 303
           +G     I  PF+L++ R Q       +    Y S      TI + +G  G Y G  + +
Sbjct: 132 AGITESLIVVPFELVKIRLQ-------DAQSDYRSPIRCTRTIIENQGLFGIYAGFESTI 184

Query: 304 FK 305
           ++
Sbjct: 185 WR 186

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 58/218 (26%), Positives = 92/218 (42%), Gaps = 18/218 (8%)

Query: 11  EENQLKNF-LKQDTN-VAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAI 68
           ++  +K F LK+ T+ V  LAG  AG     +V PFE VKI L  Q + + Y   +    
Sbjct: 108 QQIMMKKFKLKEVTSTVTLLAGTFAGITESLIVVPFELVKIRL--QDAQSDYRSPI-RCT 164

Query: 69  GQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLF 128
             + + + + G++ G      R   ++A  F +    KK I    +  K + + N     
Sbjct: 165 RTIIENQGLFGIYAGFESTIWRNTIWNASYFGLIFQVKKFIPRAKSTTKFQGIRN--DFL 222

Query: 129 SGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGG 188
            GA+ G  S   + P D+V+TR+       S +    A         W+ +   Y  E G
Sbjct: 223 VGAIAGCMSCFLSVPFDVVKTRMQGSKKTSSGMCYGWA---------WQSVFLIYRTE-G 272

Query: 189 IMGLYRGVWPTSLGIVPYVALNFAVYEQLKE-FMPSDE 225
           I G+Y+G+ P      P   L   V+  + E F  SD 
Sbjct: 273 IKGIYKGILPIICRYGPGGGLLLVVFNGVNELFRMSDH 310

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 45/88 (51%), Gaps = 8/88 (9%)

Query: 235 LYKLSMGAISGGVAQTITYPFDLLRRRFQVL----AMGGNELGF----HYNSVWDALVTI 286
           +Y+   GA++G     + YP D+++ RFQ+     A+  + +       ++S+   L  I
Sbjct: 14  IYQFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKI 73

Query: 287 GKTEGFKGYYKGLTANLFKVVPSTAVSW 314
            K EGFK  YKG++  L   VP  AV +
Sbjct: 74  LKEEGFKNLYKGMSPPLLMEVPKRAVKF 101

>Kwal_26.7653
          Length = 325

 Score = 78.6 bits (192), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 83/311 (26%), Positives = 130/311 (41%), Gaps = 42/311 (13%)

Query: 26  AFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLF----DAIGQVYKEENIKGLF 81
           +F+AGG+A  I+ TV +P E VK  +Q+Q   +A  + ++     A+  ++K E I+GL 
Sbjct: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86

Query: 82  RG--------NGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALC 133
           +G         GLN  R+  Y  ++ V+     K  +      K +  N    + SGA  
Sbjct: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVL----NKTFYPAMDPHKVQ--NVAVNVVSGATS 140

Query: 134 GGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKP---PGVWKLLSKAYAEEGGIM 190
           G    +   PL L++TR+          S S A  I +      +W  LS  Y  E G  
Sbjct: 141 GIIGAIMGSPLFLIKTRMQ---------SYSNAIQIGQQTHYTSIWNGLSSIYRAE-GFK 190

Query: 191 GLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSL-YKLSMGAISGGVAQ 249
           GLYRGV    L      ++   +Y   K F+   +     M++     L    +SG    
Sbjct: 191 GLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHD----LMKEGTGLHLVASTVSGFGVG 246

Query: 250 TITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPS 309
            +  P+D++  R        N+ G  Y    D  V   + EG    YKG  A +F++ P 
Sbjct: 247 VVMNPWDVILTRVY------NQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPH 300

Query: 310 TAVSWLVYELT 320
           T +     E T
Sbjct: 301 TILCLTFMEQT 311

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 55/213 (25%), Positives = 101/213 (47%), Gaps = 24/213 (11%)

Query: 115 KGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPG 174
           K   ++++      +G +    +V  T P++LV+TR+ +Q     ++S + A  I K P 
Sbjct: 16  KPAAQKVSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQ----GEMS-ADAQRIYKNP- 69

Query: 175 VWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALN---FAVYEQL-----KEFMPSDEN 226
             + L   +  EG I GL +G+   S   +  + LN      YE +     K F P+ + 
Sbjct: 70  -MQALKVIFKNEG-IRGLQKGL---SCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDP 124

Query: 227 GNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELG--FHYNSVWDALV 284
               +++    +  GA SG +   +  P  L++ R Q  +    ++G   HY S+W+ L 
Sbjct: 125 --HKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYS-NAIQIGQQTHYTSIWNGLS 181

Query: 285 TIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVY 317
           +I + EGFKG Y+G+ A + +    ++V   +Y
Sbjct: 182 SIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIY 214

>Scas_632.9
          Length = 292

 Score = 78.2 bits (191), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 85/328 (25%), Positives = 141/328 (42%), Gaps = 51/328 (15%)

Query: 1   MSEVILPAIEEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAY 60
           MSE I   IE+ + ++N L    N     G IAGA  + +  PF+ VK+ LQ Q S    
Sbjct: 1   MSESIDHPIEKSS-VQNALSDIVN-----GSIAGAFGKIIEYPFDTVKVRLQTQGSHIFP 54

Query: 61  NKGLFDAIGQVYKEENI-KGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGE 119
               +  I   Y  E + +G F+G G         +A  FV +  C   +         E
Sbjct: 55  TT--WSCIKYTYHNEGVWRGFFQGIGSPLFGAALENATLFVSYNQCSNVL---------E 103

Query: 120 QLNNWQRL----FSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGV 175
           +  N   L     SGA  G C+     P++L++ +L  Q +NL    + +       P +
Sbjct: 104 KFTNVSPLSNILLSGAFAGSCASFVLTPVELIKCKL--QVSNLQTAVEGQIKHTKIIPTL 161

Query: 176 WKLLSKAYAEEGGIMGLYRGVWPT----SLGIVPYVALNFAVYEQLKEFMPSDENGNSSM 231
             +L      E GI+GL++G   T    SLG V +    FA YE +K+ +   ++     
Sbjct: 162 MYVL-----REKGILGLWQGQSSTFIRESLGGVAW----FATYEVMKQGL---KDRRKDT 209

Query: 232 RDSLYKLSMGAISGGVA-QTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTE 290
            +  ++L +   S G+A     +P D ++   Q            + ++ +A+  +  T 
Sbjct: 210 ENKTWELLVSGASAGLAFNASIFPADTVKSMMQT----------EHITLINAVKKVLTTY 259

Query: 291 GFKGYYKGLTANLFKVVPSTAVSWLVYE 318
           G  G+Y+GL   L + VP+ A  + +YE
Sbjct: 260 GITGFYRGLGITLIRAVPANATVFYMYE 287

 Score = 62.4 bits (150), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 60/218 (27%), Positives = 99/218 (45%), Gaps = 31/218 (14%)

Query: 13  NQLKNFLKQDTNVA-----FLAGGIAGAISRTVVSPFERVKILLQVQSSTTAY-----NK 62
           NQ  N L++ TNV+      L+G  AG+ +  V++P E +K  LQV +  TA      + 
Sbjct: 96  NQCSNVLEKFTNVSPLSNILLSGAFAGSCASFVLTPVELIKCKLQVSNLQTAVEGQIKHT 155

Query: 63  GLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLN 122
            +   +  V +E+ I GL++G     IR        F  +E  K+ +     + K  +  
Sbjct: 156 KIIPTLMYVLREKGILGLWQGQSSTFIRESLGGVAWFATYEVMKQGL---KDRRKDTENK 212

Query: 123 NWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKA 182
            W+ L SGA  G     + +P D V++ +  QT +++ ++            V K+L+  
Sbjct: 213 TWELLVSGASAGLAFNASIFPADTVKSMM--QTEHITLIN-----------AVKKVLTTY 259

Query: 183 YAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEF 220
                GI G YRG+  T +  VP  A  F +YE L + 
Sbjct: 260 -----GITGFYRGLGITLIRAVPANATVFYMYETLSKM 292

>Kwal_26.7967
          Length = 297

 Score = 78.2 bits (191), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 77/300 (25%), Positives = 136/300 (45%), Gaps = 29/300 (9%)

Query: 26  AFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNG 85
           +FLAG +AGA+  ++  PFE  K  LQ+   ++  ++     I +  K + +  ++ G  
Sbjct: 12  SFLAGSLAGAVEASITYPFEFAKTRLQLVDKSSTASRNPLTLIYRTAKVQGLGAVYVGCP 71

Query: 86  LNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGC-SVVATYPL 144
              +     + V+F+ F+   K+I    T G   +L+  + + +G   G   SVVA  P 
Sbjct: 72  AFIVGNTAKAGVRFLGFDAI-KNILRDPTTG---ELSGPRGIVAGLGAGLLESVVAVTPF 127

Query: 145 DLVRTRL--SVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLG 202
           + ++T L    Q+A+    +  R        G+ +  S    ++ G  GLYRGV P S+ 
Sbjct: 128 EAIKTALIDDKQSASPKYHNNGR--------GMLRNYSSLVYDK-GFSGLYRGVLPVSMR 178

Query: 203 IVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSM----GAISGGVAQTITYPFDLL 258
                A+    Y ++K  +   ++  +S +D      M    GA SG V    T P D +
Sbjct: 179 QAANQAVRLGCYNKIKTMI---QDYTNSAKDKPLSSGMTFVVGAFSGIVTVYTTMPIDTV 235

Query: 259 RRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
           + R Q L          Y+S  +   T+ + EG K ++KG T  L +++ S  + + +YE
Sbjct: 236 KTRMQSLDSS------KYSSTINCFATVFREEGLKTFWKGATPRLGRLILSGGIVFTIYE 289

 Score = 32.3 bits (72), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 21/33 (63%)

Query: 233 DSLYKLSMGAISGGVAQTITYPFDLLRRRFQVL 265
           D L+    G+++G V  +ITYPF+  + R Q++
Sbjct: 8   DPLHSFLAGSLAGAVEASITYPFEFAKTRLQLV 40

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score = 78.2 bits (191), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 81/298 (27%), Positives = 131/298 (43%), Gaps = 25/298 (8%)

Query: 26  AFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNG 85
           +FLAG +AGA    +  PFE  K  LQ+    +  ++     I +  K + I  ++ G  
Sbjct: 15  SFLAGSLAGAAEACITYPFEFAKTRLQLIDKASKASRNPLVLIYKTAKTQGIGSIYVGCP 74

Query: 86  LNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGC-SVVATYPL 144
              I     + ++F+ F+  K  +   +T   GE L+  + + +G   G   SV A  P 
Sbjct: 75  AFIIGNTAKAGIRFLGFDTIKDMLRDSET---GE-LSGTRGVIAGLGAGLLESVAAVTPF 130

Query: 145 DLVRTRL--SVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLG 202
           + ++T L    Q+A     +  R        GV +  S +   + G  GLYRGV P S+ 
Sbjct: 131 EAIKTALIDDKQSATPKYHNNGR--------GVVRNYS-SLVRDKGFSGLYRGVLPVSMR 181

Query: 203 IVPYVALNFAVYEQLKEFMP--SDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRR 260
                A+    Y ++K  +   +D   +  +   L  L +GA SG V    T P D ++ 
Sbjct: 182 QAANQAVRLGCYNKIKTLIQDYTDSPKDKPLSSGLTFL-VGAFSGIVTVYSTMPLDTVKT 240

Query: 261 RFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
           R Q L          Y+S  +   TI K EG K ++KG T  L ++V S  + + +YE
Sbjct: 241 RMQSLD------STKYSSTMNCFATIFKEEGLKTFWKGATPRLGRLVLSGGIVFTIYE 292

 Score = 37.0 bits (84), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 42/191 (21%), Positives = 77/191 (40%), Gaps = 19/191 (9%)

Query: 112 VDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAK 171
           + +K     ++      +G+L G      TYP +  +TRL +           +AS  ++
Sbjct: 1   MSSKATKSDVDPLHSFLAGSLAGAAEACITYPFEFAKTRLQLI---------DKASKASR 51

Query: 172 PPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGN-SS 230
            P V  L+ K  A+  GI  +Y G     +G      + F  ++ +K+ +   E G  S 
Sbjct: 52  NPLV--LIYKT-AKTQGIGSIYVGCPAFIIGNTAKAGIRFLGFDTIKDMLRDSETGELSG 108

Query: 231 MRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYN--SVWDALVTIGK 288
            R  +  L  G +    A T   PF+ ++    +         +H N   V     ++ +
Sbjct: 109 TRGVIAGLGAGLLESVAAVT---PFEAIKTAL-IDDKQSATPKYHNNGRGVVRNYSSLVR 164

Query: 289 TEGFKGYYKGL 299
            +GF G Y+G+
Sbjct: 165 DKGFSGLYRGV 175

 Score = 32.0 bits (71), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 37/94 (39%), Gaps = 12/94 (12%)

Query: 233 DSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGG----NELGFHYNSVWDALVTIGK 288
           D L+    G+++G     ITYPF+  + R Q++        N L   Y +         K
Sbjct: 11  DPLHSFLAGSLAGAAEACITYPFEFAKTRLQLIDKASKASRNPLVLIYKT--------AK 62

Query: 289 TEGFKGYYKGLTANLFKVVPSTAVSWLVYELTWD 322
           T+G    Y G  A +        + +L ++   D
Sbjct: 63  TQGIGSIYVGCPAFIIGNTAKAGIRFLGFDTIKD 96

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score = 77.8 bits (190), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 72/300 (24%), Positives = 121/300 (40%), Gaps = 22/300 (7%)

Query: 25  VAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYN---KGLFDAIGQVYKEENIKGLF 81
           V  +AGG AG +      P + +K+ +Q+  +         G     G++Y+ E     +
Sbjct: 12  VNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFY 71

Query: 82  RGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVAT 141
           +G G   I + P  A++F  +E  +  +   +T GK    N     F   +  G +    
Sbjct: 72  KGLGAVVIGITPKMAIRFSSYEFYRTLLADKET-GKVSTGNT----FIAGVGAGITEAVV 126

Query: 142 YPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYA--EEGGIMGLYRGVWPT 199
               +   ++ +Q  +L+ +  +        P     +   Y   +E G   LYRGV  T
Sbjct: 127 VVNPMEVVKIRLQAQHLNPVEGA--------PKYKNAVQACYTIVKEEGFSALYRGVSLT 178

Query: 200 SLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLR 259
           +         NF VY +LKEF+    N    M  S     +G ISG +      P D ++
Sbjct: 179 AARQATNQGANFTVYSKLKEFLQGYHN--QEMLPSWETSLIGLISGAIGPFSNAPLDTIK 236

Query: 260 RRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYEL 319
            R Q      N  G    ++    +   + EGF+  YKG+T  + +V P  AV++  YE 
Sbjct: 237 TRLQKDKSTKNMSGLKRITIIGKQLI--QEEGFRALYKGITPRVMRVAPGQAVTFTAYEF 294

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 64/153 (41%), Gaps = 21/153 (13%)

Query: 71  VYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHI--FHVDTKGKGEQLNNWQRLF 128
           + KEE    L+RG  L   R        F V+   K+ +  +H       E L +W+   
Sbjct: 162 IVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQ-----EMLPSWETSL 216

Query: 129 SGALCGGCSVVATYPLDLVRTRLSVQ--TANLSKLSKSRASDIAKPPGVWKLLSKAYAEE 186
            G + G     +  PLD ++TRL     T N+S L +              ++ K   +E
Sbjct: 217 IGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKR------------ITIIGKQLIQE 264

Query: 187 GGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKE 219
            G   LY+G+ P  + + P  A+ F  YE +++
Sbjct: 265 EGFRALYKGITPRVMRVAPGQAVTFTAYEFIRK 297

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 51/107 (47%), Gaps = 11/107 (10%)

Query: 13  NQLKNFLKQDTNVAFLA-------GGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGL- 64
           ++LK FL+   N   L        G I+GAI     +P + +K  LQ   ST   + GL 
Sbjct: 194 SKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMS-GLK 252

Query: 65  -FDAIG-QVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHI 109
               IG Q+ +EE  + L++G     +RV P  AV F  +E  +K +
Sbjct: 253 RITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 77.0 bits (188), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 70/284 (24%), Positives = 120/284 (42%), Gaps = 29/284 (10%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLN 87
           +AG + GA S  V  P   +   LQ + +     +   + I ++Y +  I G F G    
Sbjct: 16  IAGSLGGAASIAVTYPLVTITTNLQTKENEA---RPKLETIKEIYNKNGIIGYFLGLESA 72

Query: 88  CIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLV 147
              +   + V +  +E C K    + TK   + L+ W+ + +  + G  + VA+ P+ + 
Sbjct: 73  VYGMATTNFVYYYFYEWCAKTARTLTTK---QYLSTWESILASTIAGSMTAVASNPIWVA 129

Query: 148 RTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYV 207
            TR++V  +N S L      DI K  G   LL+              G+ P +L +V   
Sbjct: 130 NTRMTVAKSNHSTL--RTVIDIVKTDGPLTLLN--------------GLKP-ALVLVSNP 172

Query: 208 ALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAM 267
            + + VYEQLK  +   +     +    +   +GAI    A   TYP+  L+ R  ++  
Sbjct: 173 IIQYTVYEQLKNLVLRLQ--RKKVLSPSWAFLLGAIGKLAATGTTYPYITLKTRMHLMQN 230

Query: 268 GGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTA 311
                  H  S+W  +V I K +G  G Y G+   L + + + A
Sbjct: 231 DPK----HQKSMWSLIVEIVKKDGVSGLYNGVAVKLVQSIMTAA 270

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score = 76.3 bits (186), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 72/301 (23%), Positives = 126/301 (41%), Gaps = 30/301 (9%)

Query: 27  FLAGGIAGAISRTVVSPFERVK--ILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGN 84
           F AG +AG     V+ P + VK  + LQVQ     +  G+ D + ++   E +  L++G 
Sbjct: 15  FFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGI 74

Query: 85  GLNCIRVFPYSAVQFVV---FEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVAT 141
               +   P  A +F     F+   K  F V      E+L+    + +GA  G       
Sbjct: 75  SSPILMEAPKRATKFACNDEFQKLYKQAFGV------EKLSQPLSMLAGASAGCVEAFVV 128

Query: 142 YPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSL 201
            P +LV+ RL   +++                G   ++ K  A EG ++ +Y G+  T  
Sbjct: 129 VPFELVKIRLQDASSSYK--------------GPVDVVRKIVAREG-VLAMYNGLESTLW 173

Query: 202 GIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRR 261
               +    F +  Q +  +P+  N    + + L   S+G   G +  T   PFD+++ R
Sbjct: 174 RHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLST---PFDVVKSR 230

Query: 262 FQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYELTW 321
            Q  A+    +   YN    +L+TI + EGF+  YKG    + ++ P   +  +V+    
Sbjct: 231 IQNTAVIPGVVR-KYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVL 289

Query: 322 D 322
           D
Sbjct: 290 D 290

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 78/180 (43%), Gaps = 19/180 (10%)

Query: 126 RLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAE 185
           + F+GA+ G   ++  YPLD+V+TR+ +Q    +    +         GV   L K  A 
Sbjct: 14  QFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYT---------GVVDCLKKIVAG 64

Query: 186 EGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISG 245
           E G+  LY+G+    L   P  A  FA  ++ ++       G   +   L  L+ GA +G
Sbjct: 65  E-GVGRLYKGISSPILMEAPKRATKFACNDEFQKLY-KQAFGVEKLSQPLSMLA-GASAG 121

Query: 246 GVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFK 305
            V   +  PF+L++ R Q       +    Y    D +  I   EG    Y GL + L++
Sbjct: 122 CVEAFVVVPFELVKIRLQ-------DASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWR 174

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 2/80 (2%)

Query: 235 LYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKG 294
           LY+   GA++G     + YP D+++ R Q+   GG   G HY  V D L  I   EG   
Sbjct: 12  LYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGA--GPHYTGVVDCLKKIVAGEGVGR 69

Query: 295 YYKGLTANLFKVVPSTAVSW 314
            YKG+++ +    P  A  +
Sbjct: 70  LYKGISSPILMEAPKRATKF 89

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 59/219 (26%), Positives = 90/219 (41%), Gaps = 36/219 (16%)

Query: 20  KQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKG 79
           K    ++ LAG  AG +   VV PFE VKI LQ  SS+    KG  D + ++   E +  
Sbjct: 107 KLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQDASSSY---KGPVDVVRKIVAREGVLA 163

Query: 80  LFRGNGLNCIRVFPYSAVQF-VVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSV 138
           ++ G      R   ++   F ++F+             K + + N   L S ++  GCS+
Sbjct: 164 MYNGLESTLWRHALWNGGYFGIIFQA---RALLPAAHNKTQCITN--DLISDSI--GCSI 216

Query: 139 --VATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGV-----WKL--LSKAYAEEGGI 189
             + + P D+V               KSR  + A  PGV     W L  L   Y EE G 
Sbjct: 217 GCMLSTPFDVV---------------KSRIQNTAVIPGVVRKYNWSLPSLLTIYREE-GF 260

Query: 190 MGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGN 228
             LY+G  P  L + P   +   V+  + +F  +   G 
Sbjct: 261 RALYKGFVPKVLRLGPGGGILLVVFTGVLDFCRAIHYGK 299

>Scas_667.22
          Length = 306

 Score = 76.6 bits (187), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 88/327 (26%), Positives = 141/327 (43%), Gaps = 35/327 (10%)

Query: 1   MSEVILPAIEEENQLKNFLKQDTN--VAFLAGGIAGAISRTVV-SPFERVKILLQVQSST 57
           MSE   P  +  + L+N  K D    +  L  G AG I++ +V  PF+  K+ LQ  S+ 
Sbjct: 1   MSEE-FPTPQLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP 59

Query: 58  TAYNKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGK 117
           T       + I ++ K E  KG ++G     I V    ++QF V E  K+  FH      
Sbjct: 60  TTA----MEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKR-FFHSRNPDS 114

Query: 118 GEQLNNWQRLFSGALCGGC--SVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGV 175
             Q+ +  + +   L GG   S +A+ P++ VR RL  QT +   +      D      +
Sbjct: 115 TSQILSLPQYYICGLTGGITNSFLAS-PIEHVRIRLQTQTGSGPNVEFKGPLDC-----I 168

Query: 176 WKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSL 235
            KL +     +GG M   RG+ PT L         F VYE     M ++E      R  +
Sbjct: 169 RKLRA-----QGGFM---RGLTPTMLREGHGCGTYFLVYEA----MVANEINKGFKRTEV 216

Query: 236 --YKLSM-GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGF 292
             +KL + GA+SG     + YP D+++   Q   +   + G   +SV   L   G   G 
Sbjct: 217 PAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTLYAKG---GL 273

Query: 293 KGYYKGLTANLFKVVPSTAVSWLVYEL 319
             ++KG    + +  P+   ++  +EL
Sbjct: 274 GAFFKGFGPTMLRAAPANGATFATFEL 300

>Scas_721.129
          Length = 323

 Score = 76.6 bits (187), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 83/315 (26%), Positives = 131/315 (41%), Gaps = 50/315 (15%)

Query: 26  AFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLF----DAIGQVYKEENIKGLF 81
           +F+AGG+A  I+ T  +P E VKI +Q+Q    A  + ++      +G +++ E I+GL 
Sbjct: 24  SFIAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNPIQGMGVIFRNEGIRGLQ 83

Query: 82  RG--------NGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQR----LFS 129
           +G         GLN  R+  Y  ++  +        F+ +     E+ +  Q+    + +
Sbjct: 84  KGLVAAYIYQIGLNGSRLGFYEPIRNAL-----NSTFYPN-----EESHKIQKVSINVAA 133

Query: 130 GALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPP---GVWKLLSKAYAEE 186
           GA  G    V   PL LV+TR+          S S A  I +      VW  LS   A  
Sbjct: 134 GASSGIIGAVIGSPLFLVKTRMQ---------SYSDAIKIGEQTHYRNVWNGLS-TIART 183

Query: 187 GGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSL-YKLSMGAISG 245
            G  GL+RG+    L      ++   +Y   K F+      N  M+D     L+   ISG
Sbjct: 184 EGFKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLK----NDLMKDGPGLHLTASTISG 239

Query: 246 GVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFK 305
                +  P+D++  R        N+ G  Y    D  V   +TEG    YKG  A + +
Sbjct: 240 LGVAVVMNPWDVILTRIY------NQKGNLYKGPVDCFVKTVRTEGISALYKGFQAQILR 293

Query: 306 VVPSTAVSWLVYELT 320
           + P T +     E T
Sbjct: 294 IAPHTIICLTFMEQT 308

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 98/212 (46%), Gaps = 22/212 (10%)

Query: 115 KGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPG 174
           K   ++++ +    +G +    +V  T P++LV+ R+ +Q   L+ + +    +  +  G
Sbjct: 13  KTAAQKVSKFGSFIAGGMAACIAVTFTNPIELVKIRMQLQ-GELAAVGQKVYRNPIQGMG 71

Query: 175 VWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKE-----FMPSDENGNS 229
           V       +  EG I GL +G+    +  +         YE ++      F P++E+   
Sbjct: 72  VI------FRNEG-IRGLQKGLVAAYIYQIGLNGSRLGFYEPIRNALNSTFYPNEES--H 122

Query: 230 SMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQ----VLAMGGNELGFHYNSVWDALVT 285
            ++     ++ GA SG +   I  P  L++ R Q     + +G      HY +VW+ L T
Sbjct: 123 KIQKVSINVAAGASSGIIGAVIGSPLFLVKTRMQSYSDAIKIGEQT---HYRNVWNGLST 179

Query: 286 IGKTEGFKGYYKGLTANLFKVVPSTAVSWLVY 317
           I +TEGFKG ++G+ A + +    ++V   +Y
Sbjct: 180 IARTEGFKGLFRGIDAAILRTGAGSSVQLPIY 211

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 91/222 (40%), Gaps = 28/222 (12%)

Query: 10  EEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQ-----VQSSTTAYNKGL 64
           EE ++++   K   NVA  AG  +G I   + SP   VK  +Q     ++     + + +
Sbjct: 119 EESHKIQ---KVSINVA--AGASSGIIGAVIGSPLFLVKTRMQSYSDAIKIGEQTHYRNV 173

Query: 65  FDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNW 124
           ++ +  + + E  KGLFRG     +R    S+VQ  ++   K  +   D    G  L+  
Sbjct: 174 WNGLSTIARTEGFKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLKNDLMKDGPGLHLT 233

Query: 125 QRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYA 184
               SG    G +VV   P D++ TR+  Q  NL K             G      K   
Sbjct: 234 ASTISGL---GVAVVMN-PWDVILTRIYNQKGNLYK-------------GPVDCFVKTVR 276

Query: 185 EEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDEN 226
            EG I  LY+G     L I P+  +     EQ  + + S E+
Sbjct: 277 TEG-ISALYKGFQAQILRIAPHTIICLTFMEQTMKLVYSVES 317

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score = 75.1 bits (183), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 75/292 (25%), Positives = 126/292 (43%), Gaps = 30/292 (10%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENI-KGLFRGNGL 86
           L G IAGA+ + +  PF+ VK+ LQ Q +        +  I   Y  E + +G ++G G 
Sbjct: 11  LYGSIAGAVGKVIEYPFDTVKVRLQTQPAHMFPTT--WSCIKFTYDNEGLWRGFYQGIGS 68

Query: 87  NCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDL 146
                   +AV FV F   K+ +   D +     L+  + +++GA  G C+     P++L
Sbjct: 69  PLAGAALENAVLFVSFNQAKRLL---DVESLLSPLS--KTVWAGAFAGACASFVLTPVEL 123

Query: 147 VRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPY 206
           ++ +L V     S LS ++ S     P +  +LS     E G +GL++G   T +     
Sbjct: 124 IKCKLQV-----SNLSTTKTSHTKILPTIKSVLS-----ERGFLGLWQGQSGTFIRESGG 173

Query: 207 VALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLA 266
            A  F  YE +K ++ S      +    L  L+ GA +G       +P D ++   Q   
Sbjct: 174 GAAWFTTYEVVKNYLASRRQAEQNTTWEL--LASGASAGLAFNASIFPADTIKSTMQT-- 229

Query: 267 MGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
                    +  +  A   I   +G  G+Y+GL   L + VP+ A  +  YE
Sbjct: 230 --------DHIDLSSATRKIYARQGIAGFYRGLGITLIRAVPANAAIFYTYE 273

 Score = 68.2 bits (165), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 60/212 (28%), Positives = 92/212 (43%), Gaps = 28/212 (13%)

Query: 13  NQLKNFLKQDTNVAFL-----AGGIAGAISRTVVSPFERVKILLQVQ--SSTTAYNKGLF 65
           NQ K  L  ++ ++ L     AG  AGA +  V++P E +K  LQV   S+T   +  + 
Sbjct: 85  NQAKRLLDVESLLSPLSKTVWAGAFAGACASFVLTPVELIKCKLQVSNLSTTKTSHTKIL 144

Query: 66  DAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQ 125
             I  V  E    GL++G     IR     A  F  +E  K ++    ++ + EQ   W+
Sbjct: 145 PTIKSVLSERGFLGLWQGQSGTFIRESGGGAAWFTTYEVVKNYL---ASRRQAEQNTTWE 201

Query: 126 RLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAE 185
            L SGA  G     + +P D +++ +     +LS  ++                 K YA 
Sbjct: 202 LLASGASAGLAFNASIFPADTIKSTMQTDHIDLSSATR-----------------KIYAR 244

Query: 186 EGGIMGLYRGVWPTSLGIVPYVALNFAVYEQL 217
           +G I G YRG+  T +  VP  A  F  YE L
Sbjct: 245 QG-IAGFYRGLGITLIRAVPANAAIFYTYETL 275

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 75.9 bits (185), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 92/361 (25%), Positives = 147/361 (40%), Gaps = 71/361 (19%)

Query: 2   SEVILPAIEEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYN 61
           S+++ P +E    +K +      V FLAGGI G     V  PF+ VK  LQ       Y 
Sbjct: 41  SKIVQPKLEVHKTVKPW------VHFLAGGIGGMAGAVVTCPFDLVKTRLQSDIYQNMYK 94

Query: 62  --------------------------KGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYS 95
                                     K     IG VY++E  + LF+G G N + V P  
Sbjct: 95  SQAEALMMNTTRPRIVNLTLQAATHFKETVSIIGNVYRQEGFRSLFKGLGPNLVGVIPAR 154

Query: 96  AVQFVVFEGCKKHIFHVDTKGKGEQLNN-----WQRLFSGALCGGCSVVATYPLDLVRTR 150
           ++ F  + G  K I+        +  NN     W  L + A  G  +  AT P+ +V+TR
Sbjct: 155 SINFFTY-GTTKDIY-------SKAFNNGQEAPWIHLMAAATAGWATATATNPIWMVKTR 206

Query: 151 LSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALN 210
           + +  A  ++  K+    +           K+     GI GLYRG+  + LG V  + L 
Sbjct: 207 VQLDKAGKTRTYKNSYDCL-----------KSILRNEGIYGLYRGLSASYLGSVEGI-LQ 254

Query: 211 FAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAI------SGG------VAQTITYPFDLL 258
           + +YEQLK  +           D     +   I      SGG      +A  +TYP +++
Sbjct: 255 WLLYEQLKHLIKKRSIEKFGAHDESTMTTTDKIKQWCQRSGGAGLAKFMASIVTYPHEVV 314

Query: 259 RRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
           R R +   +   ++   Y  +  +   I K EG    Y GLT +L + VP++ + +  +E
Sbjct: 315 RTRLRQSPLENGKV--KYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVPNSIIMFGTWE 372

Query: 319 L 319
           +
Sbjct: 373 V 373

 Score = 36.2 bits (82), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 39/94 (41%), Gaps = 22/94 (23%)

Query: 251 ITYPFDLLRRRFQ-------------VLAMGGN---------ELGFHYNSVWDALVTIGK 288
           +T PFDL++ R Q              L M            +   H+      +  + +
Sbjct: 73  VTCPFDLVKTRLQSDIYQNMYKSQAEALMMNTTRPRIVNLTLQAATHFKETVSIIGNVYR 132

Query: 289 TEGFKGYYKGLTANLFKVVPSTAVSWLVYELTWD 322
            EGF+  +KGL  NL  V+P+ ++++  Y  T D
Sbjct: 133 QEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKD 166

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 75.1 bits (183), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 81/306 (26%), Positives = 134/306 (43%), Gaps = 33/306 (10%)

Query: 22  DTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLF 81
           D + +F+AG +AGA+  +V  PFE  K  LQ+    +  ++     I    K + I  ++
Sbjct: 8   DPSKSFIAGCLAGAVEASVTYPFEFAKTRLQLLDKASKASRNPLVLIYNTAKTQGIGSVY 67

Query: 82  RGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGC-SVVA 140
            G     +     + V+F+ F+  K  +    T   GE L+  + + +G   G   SVVA
Sbjct: 68  VGCPAFIVGNTAKAGVRFLGFDTIKNLLRDPKT---GE-LSGPRGVIAGLGAGLLESVVA 123

Query: 141 TYPLDLVRTRL--SVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWP 198
             P + ++T L    Q+A     +  +        G+ +  + A   + G+ GLYRGV P
Sbjct: 124 VTPFEAIKTALIDDKQSATPKYHNNGK--------GMLRNYT-ALVRKQGLSGLYRGVLP 174

Query: 199 TSLGIVPYVALNFAVYEQLKEFM------PSDENGNSSMRDSLYKLSMGAISGGVAQTIT 252
            S+      A+    Y ++K  +      P D+  +S +        +GA SG V    T
Sbjct: 175 VSMRQAANQAVRLGCYNKIKVMVQDYTNAPKDKPLSSGL-----TFVVGAFSGIVTVYTT 229

Query: 253 YPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAV 312
            P D ++ R Q L          Y+S  +   TI K EG K ++KG T  L ++  S  +
Sbjct: 230 MPIDTVKTRMQSLDSK------RYSSTINCFTTIFKEEGLKAFWKGATPRLGRLFLSGGI 283

Query: 313 SWLVYE 318
            + VYE
Sbjct: 284 VFTVYE 289

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 43/190 (22%), Positives = 77/190 (40%), Gaps = 27/190 (14%)

Query: 117 KGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVW 176
           + +Q++  +   +G L G      TYP +  +TRL +    L K SK+  + +       
Sbjct: 3   QSKQVDPSKSFIAGCLAGAVEASVTYPFEFAKTRLQL----LDKASKASRNPL------- 51

Query: 177 KLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGN-SSMRDSL 235
            +L    A+  GI  +Y G     +G      + F  ++ +K  +   + G  S  R  +
Sbjct: 52  -VLIYNTAKTQGIGSVYVGCPAFIVGNTAKAGVRFLGFDTIKNLLRDPKTGELSGPRGVI 110

Query: 236 YKLSMGAISGGVAQTITYPFDLLR------RRFQVLAMGGNELGFHYNSVWDALVTIGKT 289
             L  G +   VA T   PF+ ++      ++        N  G   N  + ALV   + 
Sbjct: 111 AGLGAGLLESVVAVT---PFEAIKTALIDDKQSATPKYHNNGKGMLRN--YTALV---RK 162

Query: 290 EGFKGYYKGL 299
           +G  G Y+G+
Sbjct: 163 QGLSGLYRGV 172

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 74.7 bits (182), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 66/252 (26%), Positives = 119/252 (47%), Gaps = 38/252 (15%)

Query: 78  KGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQ---------LNNWQRLF 128
           + L+RG G+N +     ++V + ++ GC +    +  +  G +         L     + 
Sbjct: 63  RELYRGLGVNLLG----NSVAWALYFGCYRCAKDIALRHLGNESATGIMDRRLPAHAYML 118

Query: 129 SGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKP-PGVWKLLSKAYAEEG 187
           +    G  + V T P+ +++TR+         ++ SRA        GV+KL    Y  EG
Sbjct: 119 AAGSSGIATAVLTNPIWVIKTRI---------MATSRAGPYKSTFDGVYKL----YQTEG 165

Query: 188 GIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKL-SMGAISGG 246
            ++  +RGV P+ LG V   A+ FA+Y+ LK          +  R S+ ++  +  IS  
Sbjct: 166 -VLAFWRGVVPSLLG-VSQGAIYFALYDTLKFHYLHSSTDKAERRLSVSEIIGITCISKM 223

Query: 247 VAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKV 306
           ++ T  YPF LL+ + Q             + +   + T+   EG +G+Y+GL+ANL + 
Sbjct: 224 ISVTSVYPFQLLKSKLQDFGAP--------SGITQLVQTVYSREGIRGFYRGLSANLLRA 275

Query: 307 VPSTAVSWLVYE 318
           VP+T +++ VYE
Sbjct: 276 VPATCITFFVYE 287

 Score = 66.2 bits (160), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 83/192 (43%), Gaps = 18/192 (9%)

Query: 27  FLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGL 86
            LA G +G  +  + +P   +K  +   S    Y K  FD + ++Y+ E +   +RG   
Sbjct: 117 MLAAGSSGIATAVLTNPIWVIKTRIMATSRAGPY-KSTFDGVYKLYQTEGVLAFWRGVVP 175

Query: 87  NCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDL 146
           + + V    A+ F +++  K H  H  T     +L+  + +    +    SV + YP  L
Sbjct: 176 SLLGV-SQGAIYFALYDTLKFHYLHSSTDKAERRLSVSEIIGITCISKMISVTSVYPFQL 234

Query: 147 VRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPY 206
           +               KS+  D   P G+ +L+   Y+ EG I G YRG+    L  VP 
Sbjct: 235 L---------------KSKLQDFGAPSGITQLVQTVYSREG-IRGFYRGLSANLLRAVPA 278

Query: 207 VALNFAVYEQLK 218
             + F VYE +K
Sbjct: 279 TCITFFVYENIK 290

 Score = 32.7 bits (73), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 81/196 (41%), Gaps = 24/196 (12%)

Query: 118 GEQLNNWQR-LFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVW 176
           G +L + QR + SG   G  + +A++PLDL++ RL +   N +  + +            
Sbjct: 2   GHELTSLQREVISGLTAGTITTIASHPLDLLKLRLQLSAGNRANTTYT------------ 49

Query: 177 KLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYE-----QLKEFMPSDENGNSSM 231
            L+   +  +     LYRG+    LG     AL F  Y       L+        G    
Sbjct: 50  GLIRDIFERQQWGRELYRGLGVNLLGNSVAWALYFGCYRCAKDIALRHLGNESATGIMDR 109

Query: 232 RDSLYKLSMGAISGGVAQTI-TYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTE 290
           R   +   + A S G+A  + T P  +++ R    +  G      Y S +D +  + +TE
Sbjct: 110 RLPAHAYMLAAGSSGIATAVLTNPIWVIKTRIMATSRAGP-----YKSTFDGVYKLYQTE 164

Query: 291 GFKGYYKGLTANLFKV 306
           G   +++G+  +L  V
Sbjct: 165 GVLAFWRGVVPSLLGV 180

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score = 74.7 bits (182), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 77/298 (25%), Positives = 130/298 (43%), Gaps = 31/298 (10%)

Query: 28  LAGGIAGAISRTVV-SPFERVKILLQVQS-STTAYNKGLFDAIGQVYKEENIKGLFRGNG 85
           +  G +G I++ +V  PF+  K+ +Q  S S TA      + I  + K E +   ++G  
Sbjct: 27  IISGTSGGIAQVLVGQPFDITKVRMQTSSGSPTA-----IEVIKNLVKNEGLLAFYKGTL 81

Query: 86  LNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLD 145
           +  I V    + QF V E  K++   V+   K + L+  Q    G + G  +     P++
Sbjct: 82  VPLIGVGACVSCQFGVNEAMKRYFLRVNGY-KDQHLSLLQYYTCGFVSGSANAFLATPIE 140

Query: 146 LVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVP 205
            VR RL +QT  L+K     + D  K     KLL +     G    L R    TS G   
Sbjct: 141 HVRIRLQLQTKALAKAEYRGSLDCMK-----KLLKQKALMRGFTATLMR----TSHG--- 188

Query: 206 YVALNFAVYEQLKEFMPSDENGNSSMRDSL--YKLSM-GAISGGVAQTITYPFDLLRRRF 262
                F VY    E +  ++N N  +R  +  +K+ + GA SG     +TYPFD+++   
Sbjct: 189 -----FGVYFLTYEALIMNQNKNGVLRKDIPPWKVCVFGAFSGAFFWAMTYPFDVVKSIM 243

Query: 263 QVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYELT 320
           Q   +       H  +V+    +I  T G+  + KG    + + +P    ++  +E+T
Sbjct: 244 QADRLVSP---VHGKNVFQVAKSIHATRGWGAFVKGFVPTMLRSLPVNGATFATFEVT 298

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 80/200 (40%), Gaps = 20/200 (10%)

Query: 27  FLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYN--KGLFDAIGQVYKEENIKGLFRGN 84
           +  G ++G+ +  + +P E V+I LQ+Q+   A    +G  D + ++ K+   K L RG 
Sbjct: 122 YTCGFVSGSANAFLATPIEHVRIRLQLQTKALAKAEYRGSLDCMKKLLKQ---KALMRGF 178

Query: 85  GLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGK-GEQLNNWQRLFSGALCGGCSVVATYP 143
               +R      V F+ +E     I + +  G   + +  W+    GA  G      TYP
Sbjct: 179 TATLMRTSHGFGVYFLTYEAL---IMNQNKNGVLRKDIPPWKVCVFGAFSGAFFWAMTYP 235

Query: 144 LDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGI 203
            D+V+          S +   R         V+++    +A  G      +G  PT L  
Sbjct: 236 FDVVK----------SIMQADRLVSPVHGKNVFQVAKSIHATRGW-GAFVKGFVPTMLRS 284

Query: 204 VPYVALNFAVYEQLKEFMPS 223
           +P     FA +E     + S
Sbjct: 285 LPVNGATFATFEVTMRLLES 304

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 74.7 bits (182), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 70/273 (25%), Positives = 116/273 (42%), Gaps = 29/273 (10%)

Query: 62  KGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQL 121
           +G  + + ++ + E +  L+RG G+  +   P + V F  +E  +      D      +L
Sbjct: 81  QGTLEGLRKIAQLEGLPTLWRGLGITLVMAVPANVVYFSGYEALR------DNSPLASRL 134

Query: 122 NNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSK 181
                L  GA     +     PL+L+RTRL          S  RA D  +   +   L +
Sbjct: 135 PVANPLVCGAFARILAATTIAPLELLRTRLQ---------SVPRARDTERTIYLIGDLLR 185

Query: 182 AYAEEGGIMG---LYRGVWPTSLGIVPYVALNFAVYEQLKE--FMPSDENGNSSMRDSLY 236
               E  +MG   L++G+  T    VP+ A+ +  YE  K   +       N+S  D   
Sbjct: 186 EMRHEVSVMGYRALFKGLEITLWRDVPFSAIYWGTYEFCKTQFWARHAATHNASNWDHFI 245

Query: 237 -KLSMGAISGGVAQTITYPFDLLRRRFQV-------LAMGGNELGFH-YNSVWDALVTIG 287
              + G++ G VA  +T+PFD+ + R Q+       L +GG          ++  L  I 
Sbjct: 246 GSFACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNAIR 305

Query: 288 KTEGFKGYYKGLTANLFKVVPSTAVSWLVYELT 320
           K+EG +  Y GL   + K+ PS A+    YEL+
Sbjct: 306 KSEGIRALYTGLLPRVMKIAPSCAIMISTYELS 338

 Score = 67.8 bits (164), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/212 (25%), Positives = 99/212 (46%), Gaps = 22/212 (10%)

Query: 27  FLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLF---DAIGQVYKEENIKG---L 80
            + G  A  ++ T ++P E ++  LQ         + ++   D + ++  E ++ G   L
Sbjct: 140 LVCGAFARILAATTIAPLELLRTRLQSVPRARDTERTIYLIGDLLREMRHEVSVMGYRAL 199

Query: 81  FRGNGLNCIRVFPYSAVQFVVFEGCKKHIF--HVDTKGKGEQLNNWQRLFSGALCG--GC 136
           F+G  +   R  P+SA+ +  +E CK   +  H  T       +NW        CG  G 
Sbjct: 200 FKGLEITLWRDVPFSAIYWGTYEFCKTQFWARHAAT----HNASNWDHFIGSFACGSMGG 255

Query: 137 SVVA--TYPLDLVRTRLSVQTANLSKLS---KSRASDIAKPPGVWKLLSKAYAEEGGIMG 191
           +V A  T+P D+ +TR+ +  A+  +L+   K+  +D ++  G++  L+     EG I  
Sbjct: 256 AVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSR--GMFSFLNAIRKSEG-IRA 312

Query: 192 LYRGVWPTSLGIVPYVALNFAVYEQLKEFMPS 223
           LY G+ P  + I P  A+  + YE  K+F  S
Sbjct: 313 LYTGLLPRVMKIAPSCAIMISTYELSKKFFTS 344

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 44/94 (46%), Gaps = 12/94 (12%)

Query: 26  AFLAGGIAGAISRTVVSPFERVKILLQV------------QSSTTAYNKGLFDAIGQVYK 73
           +F  G + GA++  +  PF+  K  +Q+            +++ T  ++G+F  +  + K
Sbjct: 247 SFACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNAIRK 306

Query: 74  EENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKK 107
            E I+ L+ G     +++ P  A+    +E  KK
Sbjct: 307 SEGIRALYTGLLPRVMKIAPSCAIMISTYELSKK 340

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 73.9 bits (180), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 77/318 (24%), Positives = 125/318 (39%), Gaps = 52/318 (16%)

Query: 23  TNVAFLAGGIAGAISRTV-VSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLF 81
           ++   L GG AG +S  V + P + +K   Q     T +          V   +    L+
Sbjct: 3   SSTGHLIGGFAGGLSSAVALQPLDLLKTRFQQTKGGTLWQT--------VKSLDTPWQLW 54

Query: 82  RGNGLNCIRVFPYSAVQFVVFE------GCKKHIFHVDTKGKGE-----QLNNWQRLFSG 130
           RG   + IR    SA+              +K     D+   G+     QL+ ++ L +G
Sbjct: 55  RGTLPSAIRTSVGSALYLSSLNLMRTALAKRKQFDTADSVVTGKSSNLPQLSMYENLVTG 114

Query: 131 ALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIM 190
           A   G     T P+ +++ R      N   ++++               +K+ A + GI 
Sbjct: 115 AFARGTVGYITMPITIIKVRYESTLYNYKSIAEA---------------AKSIAAQEGIR 159

Query: 191 GLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPS---------DENGNSSMRDSLYKLSMG 241
           G +RG  PT L   PY  L   +YE+LK  +P+         D  G  +   S    S  
Sbjct: 160 GFFRGFGPTCLRDAPYSGLYVLLYEKLKHTLPTILPKSLLQLDSEGRYTAYTSTAINSTS 219

Query: 242 AI-SGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLT 300
           AI S  +A T+T PFD ++ R Q+           + + W  L TI   E     + GL+
Sbjct: 220 AILSASMATTVTAPFDTIKTRMQLEPT-------KFKTFWSTLTTIVTQEHPIKIFSGLS 272

Query: 301 ANLFKVVPSTAVSWLVYE 318
             L +   S  ++W +YE
Sbjct: 273 MRLTRKALSAGIAWGIYE 290

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 73.6 bits (179), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 75/319 (23%), Positives = 134/319 (42%), Gaps = 54/319 (16%)

Query: 20  KQDTNVAFLAGGIAGA-ISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIK 78
           +Q      L GG +G  +S  ++ PF+ +K  LQ   ++T     L+  +  +   E   
Sbjct: 3   EQRRATTHLIGGFSGGLVSAIILQPFDLLKTRLQQDKTST-----LWKTLKSI---ETPS 54

Query: 79  GLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGE---------QLNNWQRLFS 129
            L+RG   +CIR    SA+   +    ++ I    +KGK           QLN ++ +FS
Sbjct: 55  QLWRGALPSCIRTSVGSAMYLTMLNSIRQAI----SKGKNTGSTGSSYLPQLNMYENMFS 110

Query: 130 GALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGI 189
           GA+    + + T P+ +++ R     + L + +  R +            S  +  EG +
Sbjct: 111 GAVTRALTGLITMPITVIKVRYE---STLYQYTSLRYAT-----------SHIFRTEG-L 155

Query: 190 MGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPS----------DENGNSSMRDSLYKLS 239
            G +RG   T+L   PY  L    Y+++K  +P+           +N  S+   +L   S
Sbjct: 156 RGFFRGFGATALRDAPYAGLYMLFYDRMKVLVPTLLPSNVVKLNSDNRYSTYASTLINGS 215

Query: 240 MGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGL 299
               +  +A +IT PFD ++ R Q+         FH  S       I   E  +  + G+
Sbjct: 216 SAFSAAVIATSITAPFDTVKTRMQL-----EPAKFH--SFTSTFWHIATKESVRNLFAGI 268

Query: 300 TANLFKVVPSTAVSWLVYE 318
           +  L +   S  ++W +YE
Sbjct: 269 SLRLTRKAFSAGIAWGIYE 287

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score = 73.6 bits (179), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 74/310 (23%), Positives = 134/310 (43%), Gaps = 29/310 (9%)

Query: 16  KNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEE 75
           K+  K D   +F+AG +AGA+  ++  PFE  K  LQ+   ++  ++     I    K +
Sbjct: 3   KDSKKVDPTKSFVAGALAGAVEASITYPFEFAKTRLQLIDKSSKASRNPLVLIYNTAKTQ 62

Query: 76  NIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGG 135
            +  ++ G     +     +A +F+ ++  +  +     K  GE L+  + + +G   G 
Sbjct: 63  GVGAIYVGCPAFIVGNTAKAATRFLGYDTIRNLL---KDKKTGE-LSGPRGVLAGLGAGL 118

Query: 136 C-SVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYR 194
             SVVA  P + ++T L     ++    ++    +A+          +  ++ G  GLY 
Sbjct: 119 LESVVAVTPFEAIKTVLIDDKQSVRPKYQNNGRSMARN-------YISLVKDEGFRGLYG 171

Query: 195 GVWPTSLGIVPYVALNFAVYEQLKEFM------PSDENGNSSMRDSLYKLSMGAISGGVA 248
           GV P S+      A+    Y ++K  +      P D+   S +        +GA SG V 
Sbjct: 172 GVLPVSMRQAANQAVRLGCYNKIKVLVQDYTGAPKDKPLTSGL-----TFIVGAFSGVVT 226

Query: 249 QTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVP 308
              T P D ++ R Q L          Y+S  +   TI K EG K ++KG T  L +++ 
Sbjct: 227 VYATMPIDTVKTRMQSLTAS------KYSSTLNCFTTIYKEEGLKTFWKGATPRLGRLIL 280

Query: 309 STAVSWLVYE 318
           S  + + +YE
Sbjct: 281 SGGIVFTIYE 290

>Kwal_55.21335
          Length = 317

 Score = 73.6 bits (179), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 74/292 (25%), Positives = 122/292 (41%), Gaps = 30/292 (10%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEEN-IKGLFRGNGL 86
           L G IAGA  + +  P + +K+ LQ Q +        +  I   Y++E  +KG ++G   
Sbjct: 50  LYGSIAGAAGKVIEYPLDTIKVRLQTQPAHVFPTS--WSCIKYTYQKEGFVKGFYQGVAS 107

Query: 87  NCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDL 146
             +     +AV FV F   +  +   ++     Q      + SGA  G C+     P++L
Sbjct: 108 PLVGAALENAVLFVTFNRAQNFLQQYESVSPLSQT-----VLSGAFAGACTSYVLTPVEL 162

Query: 147 VRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPY 206
           ++  L  Q +NL   + +R S I      W  + K   +  GI GL++G   T +     
Sbjct: 163 IKCTL--QVSNLEG-ATTRHSKI------WPTV-KHIVQHKGIGGLWQGQSSTFIRECAG 212

Query: 207 VALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLA 266
            A+ F  YE LK ++    N   +    L  L+ GA +G       +P D ++   Q   
Sbjct: 213 GAVWFTTYESLKSYLARRRNDTENHTWEL--LASGASAGVAFNASIFPADTIKSTAQTQH 270

Query: 267 MGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
           +G          + DA   I    G  G Y+GL   L +  P+ A+ +  YE
Sbjct: 271 LG----------IVDATKRILARSGPAGLYRGLGITLIRAAPANAIVFYTYE 312

 Score = 68.2 bits (165), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 104/216 (48%), Gaps = 30/216 (13%)

Query: 13  NQLKNFLKQDTNVA-----FLAGGIAGAISRTVVSPFERVKILLQV---QSSTTAYNKGL 64
           N+ +NFL+Q  +V+      L+G  AGA +  V++P E +K  LQV   + +TT ++K +
Sbjct: 124 NRAQNFLQQYESVSPLSQTVLSGAFAGACTSYVLTPVELIKCTLQVSNLEGATTRHSK-I 182

Query: 65  FDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNW 124
           +  +  + + + I GL++G     IR     AV F  +E  K ++     +    + + W
Sbjct: 183 WPTVKHIVQHKGIGGLWQGQSSTFIRECAGGAVWFTTYESLKSYLAR---RRNDTENHTW 239

Query: 125 QRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYA 184
           + L SGA  G     + +P D +++  + QT +L  +  ++           ++L+++  
Sbjct: 240 ELLASGASAGVAFNASIFPADTIKS--TAQTQHLGIVDATK-----------RILARS-- 284

Query: 185 EEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEF 220
              G  GLYRG+  T +   P  A+ F  YE L   
Sbjct: 285 ---GPAGLYRGLGITLIRAAPANAIVFYTYETLSNL 317

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 43/92 (46%), Gaps = 7/92 (7%)

Query: 227 GNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTI 286
           G    +D+L  +  G+I+G   + I YP D ++ R Q       +    + + W  +   
Sbjct: 38  GIMDFKDALKDILYGSIAGAAGKVIEYPLDTIKVRLQ------TQPAHVFPTSWSCIKYT 91

Query: 287 GKTEGF-KGYYKGLTANLFKVVPSTAVSWLVY 317
            + EGF KG+Y+G+ + L       AV ++ +
Sbjct: 92  YQKEGFVKGFYQGVASPLVGAALENAVLFVTF 123

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score = 73.2 bits (178), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 80/300 (26%), Positives = 125/300 (41%), Gaps = 31/300 (10%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLN 87
            AG + G     V  PF+  K+ LQ    T+    G+ + +  + + E     ++G    
Sbjct: 31  FAGTMGGVAQVLVGQPFDTTKVRLQ----TSKTKIGVIEVVQNLLRNEGALAFYKGMLTP 86

Query: 88  CIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCS-VVATY---P 143
            + V    +VQF V E  K+     +      Q +    L    LCG    VV ++   P
Sbjct: 87  LLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAP 146

Query: 144 LDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGI 203
           ++ VR RL  QT      S+        P    K L+KA A       L RG+ PT +  
Sbjct: 147 IEHVRIRLQTQT------SQGNERQFKGPFDCIKKLAKAKA-------LMRGLLPTMIRA 193

Query: 204 VPYVALNFAVYEQL--KEFMPSDENGNSSMRDSLYKL-SMGAISGGVAQTITYPFDLLRR 260
              +   FA YE L  KEF    E G    +   +KL S GA+SG +     YP D+++ 
Sbjct: 194 GHGLGTYFAAYEALVVKEF----EKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVK- 248

Query: 261 RFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYELT 320
              VL     E   + NS+  A   + K  G   ++KG    + +  P+ A +++ +E+T
Sbjct: 249 --SVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFEMT 306

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 43/197 (21%), Positives = 80/197 (40%), Gaps = 26/197 (13%)

Query: 127 LFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEE 186
           +F+G + G   V+   P D  + RL        + SK++        GV +++      E
Sbjct: 30  IFAGTMGGVAQVLVGQPFDTTKVRL--------QTSKTKI-------GVIEVVQNLLRNE 74

Query: 187 GGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDE----NGNSSMRDSLYKLSMGA 242
           G  +  Y+G+    LG+   V++ F V E +K F  +      +    +   L++  +  
Sbjct: 75  GA-LAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCG 133

Query: 243 ISGGVAQT-ITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTA 301
           ++GGV  + +  P + +R R Q     GNE  F     +D +  + K    K   +GL  
Sbjct: 134 LTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQF--KGPFDCIKKLAKA---KALMRGLLP 188

Query: 302 NLFKVVPSTAVSWLVYE 318
            + +        +  YE
Sbjct: 189 TMIRAGHGLGTYFAAYE 205

>Scas_669.6
          Length = 373

 Score = 73.6 bits (179), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 55/197 (27%), Positives = 94/197 (47%), Gaps = 21/197 (10%)

Query: 22  DTNVAFLAGGIAGA-ISRTVVSPFERVKILLQVQSST------TAYN-KGLFDAIGQVYK 73
           +  V+ L+ G+ G  +S  V  P E +K  LQ+Q         + YN + L  AI  +  
Sbjct: 144 NDTVSHLSAGLLGDFVSSFVYVPSEVLKTRLQLQGRVNNPFFQSGYNYRSLRTAIRIIVN 203

Query: 74  EENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKG-KGEQLNNWQRLFSGAL 132
            E +K LF G      R  P+SA+QF  +E  ++  F ++ K      L+    +F+GA+
Sbjct: 204 TEGVKALFFGYKATLARDLPFSALQFGFYEKFRQTAFKLEKKDITKHNLSIPNEIFTGAI 263

Query: 133 CGGCSVVATYPLDLVRTRLSVQTAN-----------LSKLSKSRASDIAKPPGVWKLLSK 181
            GG + + T P+D+++TRL  Q A+           +S  +  ++  I     +++ L  
Sbjct: 264 AGGLAGIITTPMDVIKTRLQTQQADINPNSATTVGAISAKTNKKSRPIVLSNSIFRSLKL 323

Query: 182 AYAEEGGIMGLYRGVWP 198
            Y  E G++G + GV P
Sbjct: 324 VYQSE-GVIGFFSGVGP 339

 Score = 60.5 bits (145), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 71/150 (47%), Gaps = 11/150 (7%)

Query: 176 WKLLSKAYA----EEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSM 231
           +K ++ AY     EEG   GLY G +   LG  P  A+ F  YE  K  M  D   N   
Sbjct: 88  YKNMTTAYRTIFLEEGIARGLYGGYFAAMLGSFPSAAIFFGTYEWCKRKMIGDLGFN--- 144

Query: 232 RDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNEL---GFHYNSVWDALVTIGK 288
            D++  LS G +   V+  +  P ++L+ R Q+     N     G++Y S+  A+  I  
Sbjct: 145 -DTVSHLSAGLLGDFVSSFVYVPSEVLKTRLQLQGRVNNPFFQSGYNYRSLRTAIRIIVN 203

Query: 289 TEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
           TEG K  + G  A L + +P +A+ +  YE
Sbjct: 204 TEGVKALFFGYKATLARDLPFSALQFGFYE 233

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 67/301 (22%), Positives = 129/301 (42%), Gaps = 38/301 (12%)

Query: 44  FERVKILLQVQSSTTAYNKGLFDAIGQVYKEENI-KGLFRGNGLNCIRVFPYSAVQFVVF 102
            + VK   Q    T  Y K +  A   ++ EE I +GL+ G     +  FP +A+ F  +
Sbjct: 72  LDTVKTRQQGAPMTPKY-KNMTTAYRTIFLEEGIARGLYGGYFAAMLGSFPSAAIFFGTY 130

Query: 103 EGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLS 162
           E CK+ +  +   G  + +++   L +G L    S     P ++++TRL +Q    +   
Sbjct: 131 EWCKRKM--IGDLGFNDTVSH---LSAGLLGDFVSSFVYVPSEVLKTRLQLQGRVNNPFF 185

Query: 163 KSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMP 222
           +S  +  +    +  +++       G+  L+ G   T    +P+ AL F  YE+ ++   
Sbjct: 186 QSGYNYRSLRTAIRIIVNTE-----GVKALFFGYKATLARDLPFSALQFGFYEKFRQTAF 240

Query: 223 SDEN-----GNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHY- 276
             E       N S+ + ++    GAI+GG+A  IT P D+++ R Q      N       
Sbjct: 241 KLEKKDITKHNLSIPNEIFT---GAIAGGLAGIITTPMDVIKTRLQTQQADINPNSATTV 297

Query: 277 -----------------NSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYEL 319
                            NS++ +L  + ++EG  G++ G+          +++  L+Y++
Sbjct: 298 GAISAKTNKKSRPIVLSNSIFRSLKLVYQSEGVIGFFSGVGPRFVWTSVQSSIMLLLYQM 357

Query: 320 T 320
           T
Sbjct: 358 T 358

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score = 72.0 bits (175), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 84/329 (25%), Positives = 133/329 (40%), Gaps = 40/329 (12%)

Query: 7   PAIEEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLF- 65
           P  E+ NQ     K     +F+AGG+A  I+ TV +PF+ VK  +Q+Q    A    ++ 
Sbjct: 4   PQEEKHNQKTAAHKVSKFGSFVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYT 63

Query: 66  ---DAIGQVYKEENIKGLFRG--------NGLNCIRVFPYSAVQFVVFEGCKKHIFHVDT 114
               A G ++K E I GL +G          LN  R+  Y  ++     G   ++F+ + 
Sbjct: 64  NPIQAFGVIFKNEGIAGLQKGLASAYLYQIALNGSRLGFYEPIR-----GILNNVFYPNV 118

Query: 115 KGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKP-- 172
           +    Q +    + +GA  G        PL LV+TR+          S S A  I +   
Sbjct: 119 ESHKVQ-HIGINVAAGATSGVVGAFIGSPLFLVKTRMQ---------SYSNAIHIGQQTH 168

Query: 173 -PGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSM 231
               +  L+  +  E GI GL+RGV    L      A+   +Y   K F+   +  N   
Sbjct: 169 YTSAFNGLATIFRSE-GIKGLFRGVDAAMLRTGIGSAVQLPIYNICKNFLLKHDLMNDGT 227

Query: 232 RDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEG 291
              L   ++     GVA     P+D++  R        N+ G  Y+   D  +   + EG
Sbjct: 228 GLHLLSSTIAGFGVGVAMN---PWDVVLTRVY------NQKGNLYSGPIDCFIKTVRNEG 278

Query: 292 FKGYYKGLTANLFKVVPSTAVSWLVYELT 320
               YKG  A + ++ P T +     E T
Sbjct: 279 LSALYKGFGAQILRIGPHTVLCLTFMEQT 307

 Score = 59.7 bits (143), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 62/232 (26%), Positives = 90/232 (38%), Gaps = 31/232 (13%)

Query: 1   MSEVILPAIEEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSST--- 57
           ++ V  P +E          Q   +   AG  +G +   + SP   VK  +Q  S+    
Sbjct: 110 LNNVFYPNVESHK------VQHIGINVAAGATSGVVGAFIGSPLFLVKTRMQSYSNAIHI 163

Query: 58  ---TAYNKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDT 114
              T Y    F+ +  +++ E IKGLFRG     +R    SAVQ  ++  CK  +   D 
Sbjct: 164 GQQTHYTSA-FNGLATIFRSEGIKGLFRGVDAAMLRTGIGSAVQLPIYNICKNFLLKHDL 222

Query: 115 KGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPG 174
              G  L+    L S  + G    VA  P D+V TR+  Q  NL               G
Sbjct: 223 MNDGTGLH----LLSSTIAGFGVGVAMNPWDVVLTRVYNQKGNLYS-------------G 265

Query: 175 VWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDEN 226
                 K    E G+  LY+G     L I P+  L     EQ  + + S E+
Sbjct: 266 PIDCFIKTVRNE-GLSALYKGFGAQILRIGPHTVLCLTFMEQTLKLVYSVES 316

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score = 71.6 bits (174), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 75/296 (25%), Positives = 117/296 (39%), Gaps = 27/296 (9%)

Query: 28  LAGGIAGAISRTVV-SPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGL 86
           L  G AG +S+ ++  PF+  K+ LQ  S  T       D + ++ K E  +G ++G   
Sbjct: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA----LDVVKKLVKNEGFRGFYKGTLT 82

Query: 87  NCIRVFPYSAVQFVVFEGCKKHIFHV--DTKGKGEQLNNWQRLFSGALCGGCSVVATYPL 144
             + V    +VQF V E  K+  FH      G  E L   Q    G   G  +     P+
Sbjct: 83  PLVGVGACVSVQFGVNEAMKR-FFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASPI 141

Query: 145 DLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIV 204
           + VR RL  QT          A+    P    K L+   +       L RG+ PT L   
Sbjct: 142 EHVRIRLQTQTGT------GAAAQFHGPLDCIKKLTANNS-------LMRGLTPTMLRES 188

Query: 205 PYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSM-GAISGGVAQTITYPFDLLRRRFQ 263
               + F  YE L         G S      +KL + GA SG     + YP D+++   Q
Sbjct: 189 HGCGVYFLTYEAL--IANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQ 246

Query: 264 VLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYEL 319
             ++   + G    ++     TI  T G   ++KG    + +  P+   ++  +EL
Sbjct: 247 TDSLLQPKQG---KNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFEL 299

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 85/209 (40%), Gaps = 25/209 (11%)

Query: 113 DTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKP 172
           D  G  +    ++ L +G   G   V+   P D  + RL  QT+++     + A D+ K 
Sbjct: 13  DLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRL--QTSSV----PTTALDVVK- 65

Query: 173 PGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMR 232
               KL+        G  G Y+G     +G+   V++ F V E +K F  S  NGNS   
Sbjct: 66  ----KLVKNE-----GFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHS-RNGNSGPN 115

Query: 233 DSLYKLS--MGAISGGVAQT-ITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKT 289
           ++L  L   +   +GG A + +  P + +R R Q     G    FH       L  I K 
Sbjct: 116 ETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFH-----GPLDCIKKL 170

Query: 290 EGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
                  +GLT  + +      V +L YE
Sbjct: 171 TANNSLMRGLTPTMLRESHGCGVYFLTYE 199

>Scas_697.47
          Length = 328

 Score = 72.0 bits (175), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 76/324 (23%), Positives = 138/324 (42%), Gaps = 39/324 (12%)

Query: 7   PAIEEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQV-QSSTTAYNKGLF 65
           P     N +++ LK     + +AGG+ G  +     PF+ +K+  Q  Q+S+T +   + 
Sbjct: 25  PVTPPANAIRDNLK-----SLVAGGVGGVCAVLTGHPFDLIKVRCQSGQASSTIHAIKII 79

Query: 66  DAIGQVYKEEN-----IKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQ 120
               +     N     +KG ++G     + V P  AV F  ++  KK +   D+     Q
Sbjct: 80  LKDARAIPTSNMLVNSVKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKIVTRSDSSS--AQ 137

Query: 121 LNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLS 180
           L   Q   +G +    + + T P + ++  L    AN      S+ S I          +
Sbjct: 138 LTMGQMAAAGFISAIPTTLVTAPTERIKVVLQTAGAN------SKTSFIGA--------A 183

Query: 181 KAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSM 240
           K   ++GG+  L++G   T     P  AL FA YE  K+F+ +D N  +  +     ++ 
Sbjct: 184 KNIVKDGGVKSLFKGSLATLARDGPGSALYFASYEISKKFL-NDRNATAESKTGEVNIAN 242

Query: 241 GAISGGVAQT----ITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYY 296
             ++GG+A      + +P D ++ + Q  + G   +      ++       K  G KG++
Sbjct: 243 VCLAGGIAGMSMWLVVFPIDTIKTKLQS-SSGSQSMVAATREIYV------KRGGIKGFF 295

Query: 297 KGLTANLFKVVPSTAVSWLVYELT 320
            GL   L +  P+ A ++L  ELT
Sbjct: 296 PGLGPALLRSFPANAATFLGVELT 319

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 71.2 bits (173), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 89/192 (46%), Gaps = 15/192 (7%)

Query: 22  DTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSS------TTAYN-KGLFDAIGQVYKE 74
           DT     AG +   IS  V  P E +K  LQ+Q         + YN   L +AI  V KE
Sbjct: 147 DTITHLSAGFLGDFISSFVYVPSEVLKTRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKE 206

Query: 75  ENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTK-GKGEQLNNWQRLFSGALC 133
           E  + LF G      R  P+SA+QF  +E  ++  F ++ K G+  +L+    + +GA  
Sbjct: 207 EGFRSLFFGYKATLARDLPFSALQFAFYEKFRQLAFKIEQKDGRDGELSIPNEILTGACA 266

Query: 134 GGCSVVATYPLDLVRTRLSVQ----TANLSKLSKSRASDIAKPPGVWKLLS---KAYAEE 186
           GG + + T P+D+V+TR+  Q     +N S           +P  +   +S   +   + 
Sbjct: 267 GGLAGIITTPMDVVKTRVQTQQPPSQSNKSYSVTHPHVTNGRPAALSNSISLSLRTVYQS 326

Query: 187 GGIMGLYRGVWP 198
            G++G + GV P
Sbjct: 327 EGVLGFFSGVGP 338

 Score = 70.1 bits (170), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 89/198 (44%), Gaps = 19/198 (9%)

Query: 124 WQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAY 183
           W  + SG + G     A + LD V+TR            +  A ++ K   +       +
Sbjct: 54  WHCVVSGGIGGKIGDSAMHSLDTVKTR------------QQGAPNVKKYRNMISAYRTIW 101

Query: 184 AEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAI 243
            EEG   GLY G     LG  P  A+ F  YE  K  M  D   N    D++  LS G +
Sbjct: 102 LEEGVRRGLYGGYMAAMLGSFPSAAIFFGTYEYTKRTMIEDWQIN----DTITHLSAGFL 157

Query: 244 SGGVAQTITYPFDLLRRRFQVLAMGGNEL---GFHYNSVWDALVTIGKTEGFKGYYKGLT 300
              ++  +  P ++L+ R Q+     N     G++Y+++ +A+ T+ K EGF+  + G  
Sbjct: 158 GDFISSFVYVPSEVLKTRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGFRSLFFGYK 217

Query: 301 ANLFKVVPSTAVSWLVYE 318
           A L + +P +A+ +  YE
Sbjct: 218 ATLARDLPFSALQFAFYE 235

 Score = 62.4 bits (150), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 72/320 (22%), Positives = 134/320 (41%), Gaps = 47/320 (14%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIK-GLFRGNGL 86
           ++GGI G I  + +   + VK   Q   +   Y + +  A   ++ EE ++ GL+ G   
Sbjct: 58  VSGGIGGKIGDSAMHSLDTVKTRQQGAPNVKKY-RNMISAYRTIWLEEGVRRGLYGGYMA 116

Query: 87  NCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQ------RLFSGALCGGCSVVA 140
             +  FP +A+ F  +E  K+ +           + +WQ       L +G L    S   
Sbjct: 117 AMLGSFPSAAIFFGTYEYTKRTM-----------IEDWQINDTITHLSAGFLGDFISSFV 165

Query: 141 TYPLDLVRTRLSVQTANLSKLSKS--RASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWP 198
             P ++++TRL +Q    +   +S    S++       +   K   +E G   L+ G   
Sbjct: 166 YVPSEVLKTRLQLQGRFNNPFFQSGYNYSNL-------RNAIKTVIKEEGFRSLFFGYKA 218

Query: 199 TSLGIVPYVALNFAVYEQLKE--FMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFD 256
           T    +P+ AL FA YE+ ++  F    ++G         ++  GA +GG+A  IT P D
Sbjct: 219 TLARDLPFSALQFAFYEKFRQLAFKIEQKDGRDGELSIPNEILTGACAGGLAGIITTPMD 278

Query: 257 LLRRRFQVL----------------AMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLT 300
           +++ R Q                     G       NS+  +L T+ ++EG  G++ G+ 
Sbjct: 279 VVKTRVQTQQPPSQSNKSYSVTHPHVTNGRPAALS-NSISLSLRTVYQSEGVLGFFSGVG 337

Query: 301 ANLFKVVPSTAVSWLVYELT 320
                    +++  L+Y++T
Sbjct: 338 PRFVWTSVQSSIMLLLYQMT 357

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 70.5 bits (171), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 78/319 (24%), Positives = 126/319 (39%), Gaps = 54/319 (16%)

Query: 20  KQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKG 79
           +  T+   + G + G  S  V+ PF+ +K  LQ    TT +        G + +  + K 
Sbjct: 4   RPKTSSHLIGGFVGGLTSAIVLQPFDLLKTRLQQNKDTTLW--------GTLKEIRSPKQ 55

Query: 80  LFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGE----------QLNNWQRLFS 129
           L+RG   + +R    SA+        +  +     KGK +          QL  ++ L S
Sbjct: 56  LWRGALPSSLRTSIGSALYLSTLNVFRTAM----AKGKTQTLNPGSSFLPQLTMYENLAS 111

Query: 130 GALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGI 189
           GA   G     T P+ +++ R      +   L ++                  Y+ EG I
Sbjct: 112 GAFTRGVVGFITMPITIIKVRYESTMYSYKSLGEAT--------------RHIYSTEG-I 156

Query: 190 MGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPS---------DENGNSSMRDSLYKLSM 240
            G + G   T +   PY  L   +YE+ K  +P          DE G  +   S    S+
Sbjct: 157 RGFFNGCGATVMRDAPYAGLYVLLYEKAKLLVPMMLPSSTISYDEAGMFTTYTSTVVNSI 216

Query: 241 GA-ISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGL 299
            A +S  +A TIT PFD ++ R Q+           ++  +  LV I   E FK  + GL
Sbjct: 217 SAFMSASLATTITSPFDTIKTRMQLDPT-------KFSGFYKTLVLIVSKEKFKNLFDGL 269

Query: 300 TANLFKVVPSTAVSWLVYE 318
           T  L +   S  ++W +YE
Sbjct: 270 TLRLTRKAFSAGIAWGIYE 288

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 71/173 (41%), Gaps = 21/173 (12%)

Query: 13  NQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYN-KGLFDAIGQV 71
           N   +FL Q T    LA   +GA +R VV        +++V+  +T Y+ K L +A   +
Sbjct: 94  NPGSSFLPQLTMYENLA---SGAFTRGVVGFITMPITIIKVRYESTMYSYKSLGEATRHI 150

Query: 72  YKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCK--------KHIFHVDTKG-----KG 118
           Y  E I+G F G G   +R  PY+ +  +++E  K              D  G       
Sbjct: 151 YSTEGIRGFFNGCGATVMRDAPYAGLYVLLYEKAKLLVPMMLPSSTISYDEAGMFTTYTS 210

Query: 119 EQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAK 171
             +N+     S +L        T P D ++TR+ +     S   K+    ++K
Sbjct: 211 TVVNSISAFMSASLA----TTITSPFDTIKTRMQLDPTKFSGFYKTLVLIVSK 259

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 70.5 bits (171), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 71/270 (26%), Positives = 120/270 (44%), Gaps = 39/270 (14%)

Query: 68  IGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQ-- 125
           IG VYK+E  + LF+G G N + V P  ++ F  + G  K ++        +  NN Q  
Sbjct: 123 IGNVYKQEGFRSLFKGLGPNLVGVIPARSINFFTY-GTTKDMY-------AKAFNNGQET 174

Query: 126 ---RLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKA 182
               L + A  G  +  AT P+ L++TR+ +  A  + + + + S        W  L   
Sbjct: 175 PMIHLMAAATAGWATATATNPIWLIKTRVQLDKAGKTSVRQYKNS--------WDCLKSV 226

Query: 183 YAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPS--------DENGNSSMRDS 234
              E G  GLY+G+  + LG V  + L + +YEQ+K  +             G  S  + 
Sbjct: 227 IRNE-GFTGLYKGLSASYLGSVEGI-LQWLLYEQMKRLIKERSIEKFGYQAEGTKSTSEK 284

Query: 235 LYKLSMGAISGGVAQTI----TYPFDLLRRRF-QVLAMGGNELGFHYNSVWDALVTIGKT 289
           + +    + S G+A+ +    TYP +++R R  Q     G      Y  +  +   I K 
Sbjct: 285 VKEWCQRSGSAGLAKFVASIATYPHEVVRTRLRQTPKENGKR---KYTGLVQSFKVIIKE 341

Query: 290 EGFKGYYKGLTANLFKVVPSTAVSWLVYEL 319
           EG    Y GLT +L + VP++ + +  +E+
Sbjct: 342 EGLFSMYSGLTPHLMRTVPNSIIMFGTWEI 371

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 41/94 (43%), Gaps = 22/94 (23%)

Query: 251 ITYPFDLLRRRFQV-------------LAMGGN---------ELGFHYNSVWDALVTIGK 288
           +T PFDL++ R Q              ++ G           + G H+      +  + K
Sbjct: 69  VTCPFDLVKTRLQSDIFLKAYKSQAVNISKGSTRPKSINYVIQAGTHFKETLGIIGNVYK 128

Query: 289 TEGFKGYYKGLTANLFKVVPSTAVSWLVYELTWD 322
            EGF+  +KGL  NL  V+P+ ++++  Y  T D
Sbjct: 129 QEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKD 162

>Kwal_33.12988
          Length = 303

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 79/322 (24%), Positives = 136/322 (42%), Gaps = 31/322 (9%)

Query: 2   SEVILPAIEEENQLKNFLKQDTNVAFLAGGIAGAISRTVV-SPFERVKILLQVQSSTTAY 60
            E+ +P + ++   K+ +++   +  +  G  G I++ +V  PF+  K+ LQ  S+ T  
Sbjct: 3   DELTMPQVVDDLTDKSDIRR--TLKDITAGTTGGIAQVLVGQPFDITKVRLQTSSTPTTA 60

Query: 61  NKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQ 120
            + + D +    K E ++G ++G  L  I V    + QF   E  K++ FH     +   
Sbjct: 61  LRVVQDLV----KNEGLRGFYKGTTLPLIGVGLCVSSQFGTNEAMKRY-FHKRNNFQSTS 115

Query: 121 LNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLS 180
           L   +    G + G  +     P++ VR  L VQT + +      A D  K     KLL 
Sbjct: 116 LRLPEYYACGFVSGCANAFLATPIEHVRILLQVQTKSRADAEYQGAMDCIK-----KLL- 169

Query: 181 KAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSL--YKL 238
               +EG +M   RG  PT L      +  F VY    E M   E      R  +  +KL
Sbjct: 170 ----KEGKLM---RGFTPTIL----RTSHGFGVYFTSYEAMICSEQRKGIARKDIPAWKL 218

Query: 239 SM-GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYK 297
            + GA SG +   + YPFD+++   Q   +     G    +V+     I    G K + K
Sbjct: 219 CLYGAFSGSLLWAMVYPFDVIKSVMQSDKLRTPVYG---TNVFQVAKNIYNERGPKAFVK 275

Query: 298 GLTANLFKVVPSTAVSWLVYEL 319
           G    + + +P    ++  +E+
Sbjct: 276 GFGPTMLRSLPVNGATFTAFEM 297

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 80/184 (43%), Gaps = 21/184 (11%)

Query: 29  AGGIAGAISRTVVS-PFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLN 87
           A G   AI  T+V+ P ERVK++LQ    TT       DA  Q+ + +  + LF+G+   
Sbjct: 144 AAGFISAIPTTLVTAPTERVKVVLQ----TTQGKASFLDAAKQIVRTQGFQSLFKGSLAT 199

Query: 88  CIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLV 147
             R  P SA+ F  +E CK+++        GE L+      SG + G    V  +P+D V
Sbjct: 200 LSRDGPGSALYFASYEICKEYLNKASGHTSGE-LSITNVCISGGMAGVSMWVVVFPIDTV 258

Query: 148 RTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYV 207
           +T+L   +   S L  +R                 Y   GGI G + GV P  L   P  
Sbjct: 259 KTQLQSSSKRQSMLEVTRM---------------IYNTRGGIKGFFPGVGPAILRSFPAN 303

Query: 208 ALNF 211
           A  F
Sbjct: 304 AATF 307

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 94/219 (42%), Gaps = 26/219 (11%)

Query: 111 HVD--TKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASD 168
           HV+  ++ K +   N + L +G + G C+V+  +P DLV+ R     A         A D
Sbjct: 14  HVNDVSQTKSQLTENLKSLAAGGVGGVCAVLTGHPFDLVKVRCQSNQAR-------SAMD 66

Query: 169 IAKPPGVWKLLSKAYAEEG-----GIMGLYRGVWPTSLGIVPYVALNFAVYE---QLKEF 220
                 V  +L  A    G      + G Y+GV P  LG+ P  A++F  Y+   +L   
Sbjct: 67  -----AVSHILQAARQAAGPTSLNAVRGFYKGVVPPLLGVTPIFAVSFWGYDVGKKLVTS 121

Query: 221 MPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVW 280
           +PS     ++  +    LS  A +G ++   T        R +V+            S  
Sbjct: 122 VPSSAASGAAAVEPELTLSQMAAAGFISAIPTTLVTAPTERVKVVLQTTQ----GKASFL 177

Query: 281 DALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYEL 319
           DA   I +T+GF+  +KG  A L +  P +A+ +  YE+
Sbjct: 178 DAAKQIVRTQGFQSLFKGSLATLSRDGPGSALYFASYEI 216

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 72/333 (21%), Positives = 132/333 (39%), Gaps = 55/333 (16%)

Query: 9   IEEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAI 68
           + + +Q K+ L ++   +  AGG+ G  +     PF+ VK+  Q   + +A      DA+
Sbjct: 15  VNDVSQTKSQLTENLK-SLAAGGVGGVCAVLTGHPFDLVKVRCQSNQARSA-----MDAV 68

Query: 69  GQVYKEEN----------IKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKG 118
             + +             ++G ++G     + V P  AV F  ++  KK +  V +    
Sbjct: 69  SHILQAARQAAGPTSLNAVRGFYKGVVPPLLGVTPIFAVSFWGYDVGKKLVTSVPSSAAS 128

Query: 119 ------EQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKP 172
                  +L   Q   +G +    + + T P + V+  L       S L  +        
Sbjct: 129 GAAAVEPELTLSQMAAAGFISAIPTTLVTAPTERVKVVLQTTQGKASFLDAA-------- 180

Query: 173 PGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMR 232
                   K      G   L++G   T     P  AL FA YE  KE++ +  +G++S  
Sbjct: 181 --------KQIVRTQGFQSLFKGSLATLSRDGPGSALYFASYEICKEYL-NKASGHTSGE 231

Query: 233 DSLYKLSMGAISGGVAQT----ITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGK 288
            S+  +    ISGG+A      + +P D ++ + Q  +           S+ +    I  
Sbjct: 232 LSITNV---CISGGMAGVSMWVVVFPIDTVKTQLQSSS--------KRQSMLEVTRMIYN 280

Query: 289 TEG-FKGYYKGLTANLFKVVPSTAVSWLVYELT 320
           T G  KG++ G+   + +  P+ A ++L  ELT
Sbjct: 281 TRGGIKGFFPGVGPAILRSFPANAATFLGVELT 313

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score = 69.3 bits (168), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 82/323 (25%), Positives = 129/323 (39%), Gaps = 28/323 (8%)

Query: 1   MSEVILPAIEEENQLKNFLKQDTN--VAFLAGGIAGAISRTVV-SPFERVKILLQVQSST 57
           MSE   P  +  + L++   QD    V  L  G AG I++ ++  PF+  K+ LQ     
Sbjct: 1   MSEE-FPTPQLIDDLEDHPGQDNGRVVKDLLAGTAGGIAQVLIGQPFDTTKVRLQTSKVP 59

Query: 58  TAYNKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGK 117
           T+      + +  + K E  KG ++G     + V    ++QF V E  K+  FH      
Sbjct: 60  TSAA----EVVKNLLKNEGPKGFYKGTLTPLVGVGACVSIQFGVNEAMKR-FFHARNVDH 114

Query: 118 GEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWK 177
              L+  Q    G   G  +     P++ VR RL  QT + ++       D  K     K
Sbjct: 115 NATLSLSQYYLCGLTGGMTNSFLASPIEHVRIRLQTQTGSGAQAEFKGPIDCIK-----K 169

Query: 178 LLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYK 237
           L S+         GL RG+ PT L         F VYE L         G        +K
Sbjct: 170 LRSQK--------GLMRGLIPTMLREGHGCGTYFLVYEAL--VSKQINQGLKRTEIPPWK 219

Query: 238 LSM-GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYY 296
           L + GA+SG     + YP D+++   Q   +   + G +   V   L      EG K ++
Sbjct: 220 LCLYGALSGTALWLMVYPIDVVKSVMQTDNLNKPQNGKNMIQVARNLYA---REGLKAFF 276

Query: 297 KGLTANLFKVVPSTAVSWLVYEL 319
           KG    + +  P+   ++  +EL
Sbjct: 277 KGFGPTMLRAAPANGGTFATFEL 299

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 69.3 bits (168), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 74/321 (23%), Positives = 126/321 (39%), Gaps = 63/321 (19%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGL----------------------- 64
           L+G +A A++ TVV P + VK L+Q Q       K L                       
Sbjct: 8   LSGAVASAMANTVVYPLDLVKTLVQTQLKQDEQLKQLETEPQSQDKDEPVKDIPPVPIKL 67

Query: 65  -----------FDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVD 113
                      FDAI ++YK+E I+GL++G   + +  F  +   F  +   +K  F V 
Sbjct: 68  NENNYLQYNSTFDAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVRKCYFRVK 127

Query: 114 -TKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKP 172
               K  +    + L  G +    S + T P+ L+  R   +              I   
Sbjct: 128 LINRKNTKFTTIEELLLGIVAAATSQIFTNPISLISARQQTRQG------------IDGD 175

Query: 173 PGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKE--FMPSDENGNSS 230
                +  + Y E+  I G ++G+   SL +    ++ +  YE+LK+  F     N    
Sbjct: 176 NDFLTVAKEIYKEQRSIKGFWKGL-KVSLMLTINPSITYTSYEKLKDALFTTDTMNLKKE 234

Query: 231 MRDSLYKLS------MGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALV 284
           + DS  +LS      +G +S  ++  IT P  + +   Q         G +++S    L 
Sbjct: 235 LVDSSSQLSPYQNFTLGVLSKMISAIITMPLIISKAWLQ-------RNGSNFSSFQQVLY 287

Query: 285 TIGKTEGFKGYYKGLTANLFK 305
            + K EG + ++KGL+  L K
Sbjct: 288 YLYKNEGLRSWWKGLSPQLAK 308

 Score = 36.2 bits (82), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 48/225 (21%), Positives = 92/225 (40%), Gaps = 35/225 (15%)

Query: 121 LNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAK--------- 171
           + +++   SGA+    +    YPLDLV+T +  Q     +L +      ++         
Sbjct: 1   MASFESALSGAVASAMANTVVYPLDLVKTLVQTQLKQDEQLKQLETEPQSQDKDEPVKDI 60

Query: 172 PPGVWKL--------------LSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQL 217
           PP   KL              + K Y +E GI GLY+G+  + +         F  Y  +
Sbjct: 61  PPVPIKLNENNYLQYNSTFDAIYKIYKQE-GIRGLYQGLTTSVMAGFFQTFSYFFWYSFV 119

Query: 218 KE--FMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLA--MGGNELG 273
           ++  F     N  ++   ++ +L +G ++   +Q  T P  L+  R Q      G N+  
Sbjct: 120 RKCYFRVKLINRKNTKFTTIEELLLGIVAAATSQIFTNPISLISARQQTRQGIDGDNDFL 179

Query: 274 FHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
                ++    +I      KG++KGL  +L   + + ++++  YE
Sbjct: 180 TVAKEIYKEQRSI------KGFWKGLKVSLMLTI-NPSITYTSYE 217

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 69.3 bits (168), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 88/189 (46%), Gaps = 13/189 (6%)

Query: 11  EENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSS------TTAYN-KG 63
           +   + ++   DT     AG +    S  V  P E +K  LQ+Q         + YN K 
Sbjct: 136 KRTMINDYHLNDTFSHLTAGFLGDFFSSFVYVPSEVLKTRLQLQGCYNNPHFNSGYNYKS 195

Query: 64  LFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKG-KGEQLN 122
           L +AI  +Y+ E +  LF G      R  P+SA+QF  +E  ++  F ++ K      L+
Sbjct: 196 LRNAIATIYRTEGVAALFFGYKATLARDLPFSALQFAFYEKFRQWAFLLEGKDIYKHDLS 255

Query: 123 NWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLS-KSRASDIAKP----PGVWK 177
               + +GA  GG + + T PLD+V+TR+  Q  +   +S  ++  +++KP      ++K
Sbjct: 256 ISNEIVTGACAGGLAGILTTPLDVVKTRVQTQLPSQIDISTDTKIKNVSKPVTLTNSIFK 315

Query: 178 LLSKAYAEE 186
            L   Y  E
Sbjct: 316 SLRTVYTSE 324

 Score = 68.2 bits (165), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/198 (26%), Positives = 88/198 (44%), Gaps = 19/198 (9%)

Query: 124 WQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAY 183
           W    +G + G     A + LD V+TR            +  A ++ K   + +     +
Sbjct: 54  WHCFLAGGVGGIIGDSAMHSLDTVKTR------------QQGAPNVHKYKHMLQAYRTMF 101

Query: 184 AEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAI 243
            EEG   GLY G     LG  P  A+ F+ YE  K  M +D + N    D+   L+ G +
Sbjct: 102 IEEGFRRGLYGGYCAAMLGSFPSAAIFFSTYEFTKRTMINDYHLN----DTFSHLTAGFL 157

Query: 244 SGGVAQTITYPFDLLRRRFQVLAMGGN---ELGFHYNSVWDALVTIGKTEGFKGYYKGLT 300
               +  +  P ++L+ R Q+     N     G++Y S+ +A+ TI +TEG    + G  
Sbjct: 158 GDFFSSFVYVPSEVLKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVAALFFGYK 217

Query: 301 ANLFKVVPSTAVSWLVYE 318
           A L + +P +A+ +  YE
Sbjct: 218 ATLARDLPFSALQFAFYE 235

 Score = 60.8 bits (146), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 65/262 (24%), Positives = 113/262 (43%), Gaps = 22/262 (8%)

Query: 10  EEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIG 69
           +++N   ++        FLAGG+ G I  + +   + VK   Q   +   Y K +  A  
Sbjct: 40  DDQNLFDDYEHSPIWHCFLAGGVGGIIGDSAMHSLDTVKTRQQGAPNVHKY-KHMLQAYR 98

Query: 70  QVYKEENI-KGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNN-WQRL 127
            ++ EE   +GL+ G     +  FP +A+ F  +E  K+      T      LN+ +  L
Sbjct: 99  TMFIEEGFRRGLYGGYCAAMLGSFPSAAIFFSTYEFTKR------TMINDYHLNDTFSHL 152

Query: 128 FSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYA--- 184
            +G L    S     P ++++TRL +Q    +    S  +        +K L  A A   
Sbjct: 153 TAGFLGDFFSSFVYVPSEVLKTRLQLQGCYNNPHFNSGYN--------YKSLRNAIATIY 204

Query: 185 EEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLY--KLSMGA 242
              G+  L+ G   T    +P+ AL FA YE+ +++    E  +    D     ++  GA
Sbjct: 205 RTEGVAALFFGYKATLARDLPFSALQFAFYEKFRQWAFLLEGKDIYKHDLSISNEIVTGA 264

Query: 243 ISGGVAQTITYPFDLLRRRFQV 264
            +GG+A  +T P D+++ R Q 
Sbjct: 265 CAGGLAGILTTPLDVVKTRVQT 286

 Score = 28.5 bits (62), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 34/81 (41%), Gaps = 6/81 (7%)

Query: 241 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFK-GYYKGL 299
           G + G +  +  +  D ++ R Q     G      Y  +  A  T+   EGF+ G Y G 
Sbjct: 60  GGVGGIIGDSAMHSLDTVKTRQQ-----GAPNVHKYKHMLQAYRTMFIEEGFRRGLYGGY 114

Query: 300 TANLFKVVPSTAVSWLVYELT 320
            A +    PS A+ +  YE T
Sbjct: 115 CAAMLGSFPSAAIFFSTYEFT 135

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score = 68.9 bits (167), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 75/311 (24%), Positives = 137/311 (44%), Gaps = 46/311 (14%)

Query: 26  AFLAGGIAGAISRTVVSPFERVKILLQV-QSSTTAYNKGLFDAIGQVYKE---------- 74
           +F+AGG+ G  +     PF+ +K+  Q  Q+++T +      AI  + KE          
Sbjct: 38  SFVAGGVGGVCAVFTGHPFDLIKVRCQNGQANSTVH------AITNIIKEAKTQVKGTLF 91

Query: 75  -ENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALC 133
             ++KG ++G     + V P  AV F  ++  KK +   + +G   +L   Q   +G + 
Sbjct: 92  TNSVKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQGGSNELTMGQMAAAGFIS 151

Query: 134 GGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLY 193
              + + T P +  R ++ +QT+       S+ S I          +K   +EGGI  L+
Sbjct: 152 AIPTTLVTAPTE--RVKVVLQTS-------SKGSFIQA--------AKTIVKEGGIASLF 194

Query: 194 RGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQT--- 250
           +G   T     P  AL FA YE  K ++ S +    + +D    +    ++GG+A     
Sbjct: 195 KGSLATLARDGPGSALYFASYEISKNYLNSRQPRQDAGKDEPVNILNVCLAGGIAGMSMW 254

Query: 251 -ITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPS 309
              +P D ++ + Q  +   N L    ++  +  +  G   G KG++ GL   L +  P+
Sbjct: 255 LAVFPIDTIKTKLQASSTRQNML----SATKEIYLQRG---GIKGFFPGLGPALLRSFPA 307

Query: 310 TAVSWLVYELT 320
            A ++L  E+T
Sbjct: 308 NAATFLGVEMT 318

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 87/201 (43%), Gaps = 16/201 (7%)

Query: 123 NWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKA 182
           N +   +G + G C+V   +P DL++ R     AN +  + +     AK      L + +
Sbjct: 35  NIKSFVAGGVGGVCAVFTGHPFDLIKVRCQNGQANSTVHAITNIIKEAKTQVKGTLFTNS 94

Query: 183 YAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMP-SDENGNSSMRDSLYKLSMG 241
                 + G Y+GV P  LG+ P  A++F  Y+  K+ +  +++ G S+        + G
Sbjct: 95  ------VKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQGGSNELTMGQMAAAG 148

Query: 242 AISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTA 301
            IS      +T P + ++   Q  + G         S   A  TI K  G    +KG  A
Sbjct: 149 FISAIPTTLVTAPTERVKVVLQTSSKG---------SFIQAAKTIVKEGGIASLFKGSLA 199

Query: 302 NLFKVVPSTAVSWLVYELTWD 322
            L +  P +A+ +  YE++ +
Sbjct: 200 TLARDGPGSALYFASYEISKN 220

 Score = 35.8 bits (81), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 44/103 (42%), Gaps = 20/103 (19%)

Query: 228 NSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIG 287
           ++ +R+++     G + G  A    +PFDL++ R Q             NS   A+  I 
Sbjct: 29  SNPVRENIKSFVAGGVGGVCAVFTGHPFDLIKVRCQ---------NGQANSTVHAITNII 79

Query: 288 K-----------TEGFKGYYKGLTANLFKVVPSTAVSWLVYEL 319
           K           T   KG+YKG+   L  V P  AVS+  Y++
Sbjct: 80  KEAKTQVKGTLFTNSVKGFYKGVIPPLLGVTPIFAVSFWGYDV 122

>Kwal_27.11419
          Length = 298

 Score = 68.6 bits (166), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 78/311 (25%), Positives = 124/311 (39%), Gaps = 49/311 (15%)

Query: 27  FLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGL 86
           F+ G + G  S  ++ PF+ +K  LQ   S+      L D +  +   E    L++G   
Sbjct: 11  FIGGFVGGLTSAVILQPFDLLKTRLQQNKSSN-----LLDVVRSI---ETPGQLWKGTLP 62

Query: 87  NCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKG---------EQLNNWQRLFSGALCGGCS 137
           + +R    SA+        +  I     KG            QL+ ++ L SGA+     
Sbjct: 63  SALRTSVGSALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAITRAAV 122

Query: 138 VVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVW 197
            VAT P+ +++ R      N   L ++ A+ I             Y  EG I GL+ G  
Sbjct: 123 GVATMPITVLKVRFESTMYNYKSLGEA-ATHI-------------YRSEG-IRGLFSGCG 167

Query: 198 PTSLGIVPYVALNFAVYEQLKEFMP---------SDENGNSSMRDSLYKLSMGAI-SGGV 247
            T +   PY  L    YEQ K  +P          +E+G  S + S    S+ A  S  +
Sbjct: 168 ATVMRDAPYAGLYVLFYEQSKLQLPRILPVWMVEHNESGVFSTKTSTIINSIAAFSSASL 227

Query: 248 AQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVV 307
           A TIT PFD ++ R Q+           Y        +I + E  +  + GL+  L +  
Sbjct: 228 ATTITSPFDTIKTRMQLNPS-------QYYGFIQTFKSIIRYERPRNLFDGLSLRLSRKA 280

Query: 308 PSTAVSWLVYE 318
            S  ++W +YE
Sbjct: 281 LSAGIAWGIYE 291

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 71/158 (44%), Gaps = 19/158 (12%)

Query: 9   IEEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYN-KGLFDA 67
           I  +N   +FL Q   ++     I+GAI+R  V        +L+V+  +T YN K L +A
Sbjct: 93  IAGKNGSSSFLPQ---LSMYENLISGAITRAAVGVATMPITVLKVRFESTMYNYKSLGEA 149

Query: 68  IGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHV--------DTKG--- 116
              +Y+ E I+GLF G G   +R  PY+ +  + +E  K  +  +        +  G   
Sbjct: 150 ATHIYRSEGIRGLFSGCGATVMRDAPYAGLYVLFYEQSKLQLPRILPVWMVEHNESGVFS 209

Query: 117 -KGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSV 153
            K   + N    FS A     +   T P D ++TR+ +
Sbjct: 210 TKTSTIINSIAAFSSA---SLATTITSPFDTIKTRMQL 244

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score = 68.2 bits (165), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 73/303 (24%), Positives = 121/303 (39%), Gaps = 37/303 (12%)

Query: 27  FLAGGIAGAISRTVVSPFERVKILLQVQ-----SSTTAYNKGLFDAIGQVYKEENIKGLF 81
           F++G  AG     V+ P + VK  +Q+Q      S  AYN G+ D +GQ+ K E    L+
Sbjct: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYN-GVIDCLGQIVKREGFSRLY 70

Query: 82  RGNGLNCIRVFPYSAVQFVV---FEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSV 138
           +G     +   P  A +F     ++   K ++ VD      +L     + SG+L G    
Sbjct: 71  KGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVD------KLTQQISILSGSLAGVTEA 124

Query: 139 VATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWP 198
               P +LV+ RL  Q  N            +K  G  +++ K    E GI+ LY G+  
Sbjct: 125 CVIVPFELVKIRL--QDVN------------SKFNGPMEVVFKT-IRETGILSLYNGLES 169

Query: 199 TSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYP-FDL 257
           T      +    F V  Q++  +P  +       + L     G I G    +  +    +
Sbjct: 170 TMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIA---GTIGGYCRYSTEHTILSV 226

Query: 258 LRRRFQ---VLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSW 314
           ++ R Q      +    +   YN  W +L  I   EGF   YKG    + ++ P   +  
Sbjct: 227 VKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIML 286

Query: 315 LVY 317
           +V+
Sbjct: 287 VVF 289

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 39/80 (48%)

Query: 235 LYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKG 294
           +Y+   GA +G     + YP D+++ R Q+    G   G  YN V D L  I K EGF  
Sbjct: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR 68

Query: 295 YYKGLTANLFKVVPSTAVSW 314
            YKG+++ +    P  A  +
Sbjct: 69  LYKGISSPMLMEAPKRATKF 88

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 88/203 (43%), Gaps = 15/203 (7%)

Query: 20  KQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKG 79
           K    ++ L+G +AG     V+ PFE VKI  ++Q   + +N G  + + +  +E  I  
Sbjct: 106 KLTQQISILSGSLAGVTEACVIVPFELVKI--RLQDVNSKFN-GPMEVVFKTIRETGILS 162

Query: 80  LFRGNGLNCIRVFPYSAVQF-VVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSV 138
           L+ G      R   ++   F V+F+     I  +  K K         L +G + G C  
Sbjct: 163 LYNGLESTMWRNAFWNGGYFGVIFQ-----IRALLPKAKTNTEKTTNDLIAGTIGGYCRY 217

Query: 139 VATYP-LDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVW 197
              +  L +V++R  +Q+   + L+    + + K    W  L K Y+EE G   LY+G  
Sbjct: 218 STEHTILSVVKSR--IQSGATTTLAD--GTVVPKYNWTWPSLFKIYSEE-GFTALYKGFI 272

Query: 198 PTSLGIVPYVALNFAVYEQLKEF 220
           P  L + P   +   V+  +  F
Sbjct: 273 PKILRLGPGGGIMLVVFNGMMAF 295

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 67.8 bits (164), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 79/319 (24%), Positives = 125/319 (39%), Gaps = 25/319 (7%)

Query: 2   SEVILPAIEEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYN 61
           S  ++  +EE  Q  N       +A  AGGIA  +   V  PF+  K+ LQ  S+ T   
Sbjct: 7   SPQLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVL---VGQPFDTTKVRLQTSSTPTTA- 62

Query: 62  KGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQL 121
               + + ++   E  +G ++G     I V    ++QF V E  K+  FH         L
Sbjct: 63  ---MEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKR-FFHHRNADMSSTL 118

Query: 122 NNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSK 181
           +  Q    G   G  +     P++ VR RL  QT + +       ++   P    K L  
Sbjct: 119 SLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTN------AEFKGPLECIKKLRH 172

Query: 182 AYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSM- 240
             A       L RG+ PT L         F VYE L     +   G        +KL + 
Sbjct: 173 NKA-------LLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIF 225

Query: 241 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLT 300
           GA+SG     + YP D+++   Q   +   + G   +SV   L   G   G   ++KG  
Sbjct: 226 GALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANG---GIGAFFKGFG 282

Query: 301 ANLFKVVPSTAVSWLVYEL 319
             + +  P+   ++  +EL
Sbjct: 283 PTMLRAAPANGATFATFEL 301

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score = 67.8 bits (164), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 74/317 (23%), Positives = 131/317 (41%), Gaps = 25/317 (7%)

Query: 6   LPAIEEENQLKNFLKQDTNVAFLAGGIAGAISRTVV-SPFERVKILLQVQSSTTAYNKGL 64
           L A +  + L + L     +  +  G AG I++ +V  PF+  K+ +Q    T+A +   
Sbjct: 5   LTAPQVVDDLSDSLDYKRAIKDILSGTAGGIAQVLVGQPFDITKVRMQ----TSAGSATA 60

Query: 65  FDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNW 124
            D +  + K E I G ++G     + V    + QF V E  K+  F        + L+  
Sbjct: 61  VDVVTSLIKNEGILGFYKGTLAPLVGVGACVSCQFGVNEAMKRR-FRRMNGDPSKPLSLK 119

Query: 125 QRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYA 184
           Q    G   G  +     P++ VR RL +QT +L+      + D  +     KLL     
Sbjct: 120 QYYVCGVASGCANAFLATPIEHVRIRLQLQTKSLANAEYQGSLDCMR-----KLL----- 169

Query: 185 EEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSM-GAI 243
           ++G +M   RG   T +       + F+ YE L       + G      + +K+ + GA 
Sbjct: 170 KQGALM---RGFTATLMRTCHGFGIYFSTYEAL--IANQHKKGIPRKDIAPWKVCIFGAF 224

Query: 244 SGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANL 303
           SG     + YP D+++   Q   +       H  +VW    +I  T G + + KG    +
Sbjct: 225 SGACYWAMAYPIDVVKSIMQSDRLVSP---VHGTNVWQVAKSIYTTRGKRAFIKGFMPAM 281

Query: 304 FKVVPSTAVSWLVYELT 320
            + +P    ++  +E+T
Sbjct: 282 LRSLPVNGATFATFEMT 298

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 68.2 bits (165), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 75/151 (49%), Gaps = 8/151 (5%)

Query: 12  ENQLKNFLKQDTNVAFLAGGIAGAISRTVV-SPFERVKILLQVQSS------TTAYN-KG 63
           + Q+ N  +     + LA G  G +  +VV  P E +K  LQ+Q         + YN +G
Sbjct: 136 KRQMINEWQIHETYSHLAAGFLGDLFSSVVYVPSEVLKTRLQLQGCYNNRHFQSGYNYRG 195

Query: 64  LFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNN 123
           L DA+  + + E +  LF G      R  P+SA+QF  +E  +K  F ++ K     L+ 
Sbjct: 196 LSDAVRTIVRTEGVSALFFGYKATLSRDLPFSALQFAFYERFRKWAFLLERKPVDGHLSF 255

Query: 124 WQRLFSGALCGGCSVVATYPLDLVRTRLSVQ 154
              + +GA  GG + + T PLD+V+TR+  Q
Sbjct: 256 TAEVVTGASAGGLAGIITTPLDVVKTRIQTQ 286

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 72/302 (23%), Positives = 127/302 (42%), Gaps = 47/302 (15%)

Query: 39  TVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIK-GLFRGNGLNCIRVFPYSAV 97
           +V+   + VK   Q       Y + +  A   +  EE ++ GL+ G G   +  FP +AV
Sbjct: 69  SVMHSLDTVKTRQQGAPGEVKY-RHMISAYRTLALEEGVRRGLYGGYGAAMLGSFPSAAV 127

Query: 98  QFVVFEGCKKHIFHVDTKGKGEQLNNWQ------RLFSGALCGGCSVVATYPLDLVRTRL 151
            F  +E  K+ +           +N WQ       L +G L    S V   P ++++TRL
Sbjct: 128 FFGTYEWVKRQM-----------INEWQIHETYSHLAAGFLGDLFSSVVYVPSEVLKTRL 176

Query: 152 SVQTANLSKLSKSRASDIAKPPGVWKLLSKAY---AEEGGIMGLYRGVWPTSLGIVPYVA 208
            +Q    ++  +S  +        ++ LS A        G+  L+ G   T    +P+ A
Sbjct: 177 QLQGCYNNRHFQSGYN--------YRGLSDAVRTIVRTEGVSALFFGYKATLSRDLPFSA 228

Query: 209 LNFAVYEQLK------EFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRF 262
           L FA YE+ +      E  P D  G+ S      ++  GA +GG+A  IT P D+++ R 
Sbjct: 229 LQFAFYERFRKWAFLLERKPVD--GHLSFTA---EVVTGASAGGLAGIITTPLDVVKTRI 283

Query: 263 QVLAMG------GNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLV 316
           Q    G       +       S++ +L+ + + EG  G + G+          +++  L+
Sbjct: 284 QTQPRGSAGTPDASAPARLNGSIFRSLLVVLRYEGLGGAFSGVGPRFIWTSIQSSIMLLL 343

Query: 317 YE 318
           Y+
Sbjct: 344 YQ 345

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 68.2 bits (165), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 71/270 (26%), Positives = 118/270 (43%), Gaps = 24/270 (8%)

Query: 63  GLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLN 122
           G  +A  ++ K E +  L+RG  +  +   P + V F  +E  +         G    +N
Sbjct: 112 GTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFTGYEYVRDR---SPLNGLYPTIN 168

Query: 123 NWQRLFSGALCGGCSVVATYPLDLVRTRL-SVQTANLSKLSKSRASDIAKPPGVWKLLSK 181
               L  GA     +  +  PL+L++T+L S+ ++++   S     D+      +  +  
Sbjct: 169 P---LICGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDL------FNEIKS 219

Query: 182 AYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKE----FMPSDENGNSSMRDSLYK 237
             A  G    +++G+  T    VP+ A+ +A YE  K       PS  + NSS       
Sbjct: 220 EIAMRGVAQTMFKGLEITLWRDVPFSAIYWASYEFYKTKVAYLSPSTFDKNSSNWFHFTN 279

Query: 238 LSMGA-ISGGVAQTITYPFDLLRRRFQVLAMGGNELG---FHY---NSVWDALVTIGKTE 290
             +G  ISG +A   T+PFD+ + R Q+  +   +L      Y   N+++  L  I KTE
Sbjct: 280 SFLGGFISGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIRKTE 339

Query: 291 GFKGYYKGLTANLFKVVPSTAVSWLVYELT 320
           G    Y GL   + K+ PS A+    YELT
Sbjct: 340 GIGALYTGLAPRVAKIAPSCAIMISSYELT 369

 Score = 57.4 bits (137), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 86/205 (41%), Gaps = 13/205 (6%)

Query: 27  FLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLF---DAIGQVYKEENIKG---- 79
            + G  A  ++ T V+P E +K  LQ   S++  N  +    D   ++  E  ++G    
Sbjct: 170 LICGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSEIAMRGVAQT 229

Query: 80  LFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNW----QRLFSGALCGG 135
           +F+G  +   R  P+SA+ +  +E  K  + ++      +  +NW         G + G 
Sbjct: 230 MFKGLEITLWRDVPFSAIYWASYEFYKTKVAYLSPSTFDKNSSNWFHFTNSFLGGFISGS 289

Query: 136 CSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRG 195
            + + T+P D+ +TR  +      KL+ S          ++  L+     EG I  LY G
Sbjct: 290 LAAICTHPFDVGKTRQQISLVTDKKLANSNL-KYGSSNTMFGFLNYIRKTEG-IGALYTG 347

Query: 196 VWPTSLGIVPYVALNFAVYEQLKEF 220
           + P    I P  A+  + YE  K  
Sbjct: 348 LAPRVAKIAPSCAIMISSYELTKRL 372

 Score = 28.5 bits (62), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 22/48 (45%)

Query: 275 HYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYELTWD 322
            +N   +A   I K EG    ++G++  L   +P+  V +  YE   D
Sbjct: 109 KFNGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFTGYEYVRD 156

>Scas_718.5
          Length = 324

 Score = 67.4 bits (163), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 70/298 (23%), Positives = 125/298 (41%), Gaps = 28/298 (9%)

Query: 28  LAGGIAGAISRTVV-SPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGL 86
           +  G  G IS+ +V  PF+  K+ +Q    T+A + G  D I ++ K E +   ++G+ +
Sbjct: 43  ILAGTCGGISQVIVGQPFDTTKVRMQ----TSAKSVGALDIIRKLVKNEGVWAFYKGSLI 98

Query: 87  NCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCG-GCSVVATY--- 142
             + V    +VQF V E  K+     +T    +  +   +L    +CG    VV ++   
Sbjct: 99  PIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLAS 158

Query: 143 PLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLG 202
           P++ VR RL  QT N          +   P    + L K  +       L RG+ P  L 
Sbjct: 159 PIEHVRIRLQTQTGN------GNEREFKGPLDCIRKLVKEKS-------LMRGLRPMMLR 205

Query: 203 IVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKL-SMGAISGGVAQTITYPFDLLRRR 261
               +   F  YE L       + G      + +KL S G++SG V     YP D+++  
Sbjct: 206 AGHGLGCYFLTYEAL--IANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSM 263

Query: 262 FQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYEL 319
            Q   +         NS+ + +  + + +G   ++KG    + +  P    +++ +EL
Sbjct: 264 IQTDTLRNPRF---KNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFEL 318

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 66.2 bits (160), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 70/287 (24%), Positives = 122/287 (42%), Gaps = 31/287 (10%)

Query: 51  LQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIF 110
           +Q ++S   +N   ++A  ++ + E +  L+RG  +  +   P + V F  +E  + H  
Sbjct: 88  IQCKNSALRFN-STWEAFTKISEVEGLATLWRGLSITLLMAIPANVVYFSGYEMFRDHSP 146

Query: 111 HVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRL-SVQTANLSKLSKSRASDI 169
             D+      LN    LF GA     +     PL+L++TRL S+  +     ++    D+
Sbjct: 147 MRDSY---PSLNP---LFCGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDL 200

Query: 170 AKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLK-----EFMPSD 224
            K        ++     GG   L++G+  T    VP+ A+ +  YE  K     +F    
Sbjct: 201 LKE-------TRNEIRSGGYKVLFKGLEITLWRDVPFSAIYWGSYEFYKKNFWIDFSEQC 253

Query: 225 ENGNSSMRDSLYKLSM--GAISGGVAQTITYPFDLLRRRFQVLAMGGNELG--------- 273
              N S     +  S   G++SG  A  +T+PFD+ + R Q+     N+           
Sbjct: 254 LRWNLSPNWDFFINSFIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKR 313

Query: 274 FHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYELT 320
                ++  L  I +TEG+   Y GL   + K+ PS A+    YEL+
Sbjct: 314 VSARGMFKFLYNIKQTEGYGALYTGLIPRVMKIAPSCAIMISTYELS 360

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 87/209 (41%), Gaps = 17/209 (8%)

Query: 27  FLAGGIAGAISRTVVSPFERVKILLQV------QSSTTAYNKGLFDAIGQVYKEENIKGL 80
              G  A  ++ T V+P E +K  LQ        ++T    K L        +    K L
Sbjct: 157 LFCGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRNEIRSGGYKVL 216

Query: 81  FRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLN---NWQ----RLFSGALC 133
           F+G  +   R  P+SA+ +  +E  KK+ F +D   +  + N   NW         G++ 
Sbjct: 217 FKGLEITLWRDVPFSAIYWGSYEFYKKN-FWIDFSEQCLRWNLSPNWDFFINSFIGGSVS 275

Query: 134 GGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAK--PPGVWKLLSKAYAEEGGIMG 191
           G  + + T+P D+ +TR+ +     +K   +  S   +    G++K L      EG    
Sbjct: 276 GSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYNIKQTEG-YGA 334

Query: 192 LYRGVWPTSLGIVPYVALNFAVYEQLKEF 220
           LY G+ P  + I P  A+  + YE  K  
Sbjct: 335 LYTGLIPRVMKIAPSCAIMISTYELSKRL 363

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 25/50 (50%)

Query: 273 GFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYELTWD 322
              +NS W+A   I + EG    ++GL+  L   +P+  V +  YE+  D
Sbjct: 94  ALRFNSTWEAFTKISEVEGLATLWRGLSITLLMAIPANVVYFSGYEMFRD 143

>Kwal_55.21106
          Length = 328

 Score = 65.9 bits (159), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 72/308 (23%), Positives = 126/308 (40%), Gaps = 52/308 (16%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQS--------------------STTAYNKGLFDA 67
           + G +A +++  VV P + VK L+Q Q+                        Y   L DA
Sbjct: 8   ITGAVASSLANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSL-DA 66

Query: 68  IGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVD-TKGKGEQLNNWQR 126
           + +++K + + GL++G   + I  F  S   F  +   +K  F     +G+  + +  + 
Sbjct: 67  LIKIFKTKGVLGLYQGLWTSIIAGFLQSFSYFFWYSIVRKSFFRYKLLRGRLGKFSTPEE 126

Query: 127 LFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEE 186
           L  G +    S + T P+ ++ TR    T+                 G  ++L + Y+E+
Sbjct: 127 LLLGIVAAAVSQIFTSPIGVISTRQQTSTS-------------GSKGGFREVLHQIYSEQ 173

Query: 187 GGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKE-FMPS----DENGN----SSMRDSLYK 237
             I G +RG +  SL +    ++ FA YE+L++ F+ S    DENG     S        
Sbjct: 174 NNITGFWRG-FKVSLILTVNPSITFASYEKLQDIFITSKRAVDENGQLLETSGQLSPRQN 232

Query: 238 LSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYK 297
             +G  S  ++  IT P  + +   Q         G ++ S    L+ + K EG    +K
Sbjct: 233 FLLGVFSKVISTLITQPLIVSKAYLQ-------RTGSNFQSFQQVLLYLYKQEGLISLWK 285

Query: 298 GLTANLFK 305
           GL   L K
Sbjct: 286 GLAPQLSK 293

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 47/214 (21%), Positives = 93/214 (43%), Gaps = 21/214 (9%)

Query: 121 LNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLS---------KLSKSRASDIAK 171
           + + +   +GA+    + V  YPLDLV+T +  Q    +         +  KSR  +I  
Sbjct: 1   MTSLESAITGAVASSLANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRY 60

Query: 172 PPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKE--FMPSDENGNS 229
              +  L+ K +  + G++GLY+G+W + +         F  Y  +++  F      G  
Sbjct: 61  KHSLDALI-KIFKTK-GVLGLYQGLWTSIIAGFLQSFSYFFWYSIVRKSFFRYKLLRGRL 118

Query: 230 SMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTI-GK 288
               +  +L +G ++  V+Q  T P  ++  R Q  +  G++ GF      + L  I  +
Sbjct: 119 GKFSTPEELLLGIVAAAVSQIFTSPIGVISTRQQT-STSGSKGGFR-----EVLHQIYSE 172

Query: 289 TEGFKGYYKGLTANLFKVVPSTAVSWLVYELTWD 322
                G+++G   +L   V + ++++  YE   D
Sbjct: 173 QNNITGFWRGFKVSLILTV-NPSITFASYEKLQD 205

>Kwal_55.21338
          Length = 323

 Score = 65.9 bits (159), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 64/276 (23%), Positives = 114/276 (41%), Gaps = 23/276 (8%)

Query: 36  ISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYS 95
           IS T+  P   V   LQ Q +       L D I  +Y+++   G F G           +
Sbjct: 35  ISMTLTYPLIVVTTKLQTQDAK-GEKLSLADTIKDIYRKDGAMGFFAGLESALFGTTLSN 93

Query: 96  AVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQT 155
            V +  +E   + +         ++L   + +  G++ G  +  A  PL +  TR++VQ 
Sbjct: 94  FVYYYCYEASSRCVLRAR---HTQRLTTAESMLVGSIAGSLNATAANPLWVANTRMTVQK 150

Query: 156 ANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYE 215
           ++   LS     DI K              + GI GL++G+ P +L +V    + + VYE
Sbjct: 151 SDRGTLST--IFDIVK--------------DEGISGLFKGLNP-ALILVINPIIQYTVYE 193

Query: 216 QLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFH 275
           QLK ++ S     +      +   +GA+    A   TYP+  ++ R  +L    +     
Sbjct: 194 QLKNWILSSRQTRT--LSPSWAFILGAVGKLAATGSTYPYVTMKARMHLLGEHKSSTAAP 251

Query: 276 YNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTA 311
             S+   +  I K +G  G Y+G+   L + + + A
Sbjct: 252 PRSLLSLMAEIIKKDGILGLYRGIGIKLVQSILTAA 287

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 81/174 (46%), Gaps = 16/174 (9%)

Query: 23  TNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFR 82
           T  + L G IAG+++ T  +P       + VQ S    ++G    I  + K+E I GLF+
Sbjct: 118 TAESMLVGSIAGSLNATAANPLWVANTRMTVQKS----DRGTLSTIFDIVKDEGISGLFK 173

Query: 83  GNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATY 142
           G     I V     +Q+ V+E  K  I    +  +   L+       GA+    +  +TY
Sbjct: 174 GLNPALILVIN-PIIQYTVYEQLKNWIL---SSRQTRTLSPSWAFILGAVGKLAATGSTY 229

Query: 143 PLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGV 196
           P   ++ R+ +       L + ++S  A P  +  L+++   ++ GI+GLYRG+
Sbjct: 230 PYVTMKARMHL-------LGEHKSSTAAPPRSLLSLMAEIIKKD-GILGLYRGI 275

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 55/114 (48%), Gaps = 13/114 (11%)

Query: 4   VILPAIEEE--NQLKNFL---KQDTNV----AFLAGGIAGAISRTVVSPF----ERVKIL 50
           VI P I+     QLKN++   +Q   +    AF+ G +    +     P+     R+ +L
Sbjct: 182 VINPIIQYTVYEQLKNWILSSRQTRTLSPSWAFILGAVGKLAATGSTYPYVTMKARMHLL 241

Query: 51  LQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEG 104
            + +SST A  + L   + ++ K++ I GL+RG G+  ++    +A  F   EG
Sbjct: 242 GEHKSSTAAPPRSLLSLMAEIIKKDGILGLYRGIGIKLVQSILTAAFLFFFKEG 295

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 5/72 (6%)

Query: 247 VAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKV 306
           ++ T+TYP  ++  + Q     G +L     S+ D +  I + +G  G++ GL + LF  
Sbjct: 35  ISMTLTYPLIVVTTKLQTQDAKGEKL-----SLADTIKDIYRKDGAMGFFAGLESALFGT 89

Query: 307 VPSTAVSWLVYE 318
             S  V +  YE
Sbjct: 90  TLSNFVYYYCYE 101

 Score = 32.3 bits (72), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 75/183 (40%), Gaps = 26/183 (14%)

Query: 137 SVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGV 196
           S+  TYPL +V T+L  Q A   KLS    +D  K           Y ++G  MG + G+
Sbjct: 36  SMTLTYPLIVVTTKLQTQDAKGEKLS---LADTIK---------DIYRKDGA-MGFFAGL 82

Query: 197 WPTSLGIVPYVALNFAVYEQLKE-FMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPF 255
                G      + +  YE      + +      +  +S+    +G+I+G +  T   P 
Sbjct: 83  ESALFGTTLSNFVYYYCYEASSRCVLRARHTQRLTTAESML---VGSIAGSLNATAANPL 139

Query: 256 DLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWL 315
            +   R  V       L    ++++D    I K EG  G +KGL   L  V+ +  + + 
Sbjct: 140 WVANTRMTVQKSDRGTL----STIFD----IVKDEGISGLFKGLNPALILVI-NPIIQYT 190

Query: 316 VYE 318
           VYE
Sbjct: 191 VYE 193

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 61/248 (24%), Positives = 110/248 (44%), Gaps = 41/248 (16%)

Query: 25  VAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGN 84
           ++ L+G  AG  +  V  P + +K  LQ         KG F A G        KG++RG 
Sbjct: 6   LSLLSGAAAGTSTDLVFFPIDTIKTRLQA--------KGGFFANG------GYKGIYRGL 51

Query: 85  GLNCIRVFPYSAVQFVVFEGCK----KHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVA 140
           G   +   P +++ F+ ++  K     +I  + ++G  + ++    + S ++   C+ + 
Sbjct: 52  GSAVVASAPGASLFFISYDYMKVKSRPYISKLYSQGSEQLIDTTTHMLSSSIGEICACLV 111

Query: 141 TYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYA---EEGGIMGLYRGVW 197
             P ++V+ R  V + N S                W+ L        +EG    LYRG  
Sbjct: 112 RVPAEVVKQRTQVHSTNSS----------------WQTLQSILRNDNKEGLRKNLYRGWS 155

Query: 198 PTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSM-GAISGGVAQTITYPFD 256
            T +  +P+  + F +YE LK+   +  NG S +    +K ++ G+I+GG+A   T P D
Sbjct: 156 TTIMREIPFTCIQFPLYEYLKKTW-AKANGQSQVEP--WKGAICGSIAGGIAAATTTPLD 212

Query: 257 LLRRRFQV 264
            L+ R  +
Sbjct: 213 FLKTRLML 220

 Score = 62.8 bits (151), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 57/212 (26%), Positives = 93/212 (43%), Gaps = 22/212 (10%)

Query: 22  DTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLF 81
           DT    L+  I    +  V  P E VK   QV S+ +++   L   +    KE   K L+
Sbjct: 93  DTTTHMLSSSIGEICACLVRVPAEVVKQRTQVHSTNSSWQT-LQSILRNDNKEGLRKNLY 151

Query: 82  RGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGE-QLNNWQRLFSGALCGGCSVVA 140
           RG     +R  P++ +QF ++E  KK       K  G+ Q+  W+    G++ GG +   
Sbjct: 152 RGWSTTIMREIPFTCIQFPLYEYLKK----TWAKANGQSQVEPWKGAICGSIAGGIAAAT 207

Query: 141 TYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTS 200
           T PLD ++TRL         L+K+ AS       +  ++ + Y EEG  +  + GV P +
Sbjct: 208 TTPLDFLKTRL--------MLNKTTAS-------LGSVIIRIYREEGPAV-FFSGVGPRT 251

Query: 201 LGIVPYVALNFAVYEQLKEFMPSDENGNSSMR 232
           + I    A+   +YE +   +         MR
Sbjct: 252 MWISAGGAIFLGMYETVHSLLSKSFPTAGEMR 283

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 65.1 bits (157), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 76/329 (23%), Positives = 133/329 (40%), Gaps = 46/329 (13%)

Query: 20  KQDTNVAFL-AGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIK 78
           K + NV  + AG ++G  S T+  PFE +K  LQ+  +  A     F+ +G       ++
Sbjct: 5   KVNDNVTLITAGSVSGLFSATITYPFEFLKTGLQLHRNVVAAKP--FEVLGY-----QVR 57

Query: 79  GLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSV 138
             F G     I V   ++++F+ F+   + +       K   L+  Q L +GAL G    
Sbjct: 58  TYFAGCSAVNIGVVMKTSLRFLAFDKASEWL-RPPALAKDAPLSGVQLLMAGALTGTMES 116

Query: 139 VATYPLDLVRT-----------RLSVQTANLS-KLSKSRASDIAKPPGVWKLLSKAYAE- 185
           +   P + V+            RL+  T+N+  +++        K P +       + E 
Sbjct: 117 LCIIPFENVKVAMIQNSLLSHERLNTTTSNVQGQVANEVKKTFHKKPTLRSSYEALFPEK 176

Query: 186 --------------EGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSM 231
                         + G+   ++G  PT +  V    + F  +  LK+F P +   N   
Sbjct: 177 LPTNVLTTAAELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTMLKQFAPKEYQNNEYF 236

Query: 232 RDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEG 291
              L  +S  A+ G      T P D+++ R Q      + +  + NS+ +    I   EG
Sbjct: 237 ATLLGLISSCAVVGA-----TQPLDVIKTRMQ----AKDSVLLYRNSI-NCAYRIFVEEG 286

Query: 292 FKGYYKGLTANLFKVVPSTAVSWLVYELT 320
           F   +KG    L KV  S +VS+ +Y+ T
Sbjct: 287 FAMLWKGWLPRLMKVGLSGSVSFGIYQYT 315

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 80/192 (41%), Gaps = 18/192 (9%)

Query: 29  AGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLNC 88
           AG I+   +  V +P ER+K++LQ  S    +      A   +     +K LF G+    
Sbjct: 138 AGFISAIPTTLVTAPTERIKVVLQTNSE---FKGSFIKAAKHIVSTGGVKSLFNGSLATL 194

Query: 89  IRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVR 148
            R  P SA+ F  +E  K  +     K   +++N      +G + G    +  +P+D ++
Sbjct: 195 ARDGPGSALYFASYELSKAFLNKSVAKKDKDEVNLANVCLAGGIAGMSMWLVVFPIDTIK 254

Query: 149 TRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVA 208
           TRL V T  +S +  ++  DI             Y + GGI G + G+ P  L   P  A
Sbjct: 255 TRLQVATTPISMVQATK--DI-------------YIQRGGIKGFFPGLGPALLRSFPANA 299

Query: 209 LNFAVYEQLKEF 220
             F   E    F
Sbjct: 300 ATFLGVELTHAF 311

 Score = 56.6 bits (135), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 76/329 (23%), Positives = 128/329 (38%), Gaps = 54/329 (16%)

Query: 17  NFLKQDTNV------AFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQ 70
           N L+  T+       A +AGG+ G  +     PF+ +K+  Q   +     K   DA+  
Sbjct: 9   NILEHKTDAFRENMKALVAGGVGGVCAVLTGHPFDLIKVRCQSNQA-----KSTMDAVSI 63

Query: 71  VYKE------------------ENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHV 112
           + KE                   ++KG ++G     I V P  AV F  ++  K+ +   
Sbjct: 64  ILKEARSLSTVNGSLTTSLFFKNSVKGFYKGVIPPLIGVTPIFAVSFWGYDIGKRLV--T 121

Query: 113 DTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKP 172
             +     L   Q   +G +    + + T P +  R ++ +QT +  K S  +A+     
Sbjct: 122 WKQASDAPLTTAQMATAGFISAIPTTLVTAPTE--RIKVVLQTNSEFKGSFIKAA----- 174

Query: 173 PGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMR 232
                   K     GG+  L+ G   T     P  AL FA YE  K F+           
Sbjct: 175 --------KHIVSTGGVKSLFNGSLATLARDGPGSALYFASYELSKAFLNKSVAKKDKDE 226

Query: 233 DSLYKLSM-GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEG 291
            +L  + + G I+G     + +P D ++ R QV     + +     +  D  +  G   G
Sbjct: 227 VNLANVCLAGGIAGMSMWLVVFPIDTIKTRLQVATTPISMV----QATKDIYIQRG---G 279

Query: 292 FKGYYKGLTANLFKVVPSTAVSWLVYELT 320
            KG++ GL   L +  P+ A ++L  ELT
Sbjct: 280 IKGFFPGLGPALLRSFPANAATFLGVELT 308

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 65.1 bits (157), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 54/177 (30%), Positives = 82/177 (46%), Gaps = 8/177 (4%)

Query: 29  AGGIAGAISRTVVSPFERVKILLQVQSS------TTAYN-KGLFDAIGQVYKEENIKGLF 81
           AG +   IS  V  P E +K  LQ+Q         + YN K L DA+  + + E    LF
Sbjct: 156 AGFLGDFISSFVYVPSEVLKTRLQLQGRYNNPFFRSGYNYKNLTDAVTTIVRREGWPTLF 215

Query: 82  RGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVAT 141
            G      R  P+S +QF  +E  ++  F V+ K   E L+    + +GA  GG + + T
Sbjct: 216 FGYKATLSRDLPFSGLQFAFYEKFRQLAFAVENKTFDEDLSLSNEIITGAAAGGLAGIIT 275

Query: 142 YPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWP 198
            PLD+V+TR+  Q  ++ + S            + K +   Y  E G+ GL+ GV P
Sbjct: 276 TPLDVVKTRIQTQLPDIPENSSQNLKQQTLTNSITKGMMTVYKTE-GLAGLFSGVGP 331

 Score = 53.5 bits (127), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 65/137 (47%), Gaps = 7/137 (5%)

Query: 185 EEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAIS 244
           EEG   GLY G     LG  P  A+ FA YE  K  M     G   + ++   L+ G + 
Sbjct: 105 EEGLRKGLYGGYSGAMLGSFPSAAIFFATYEYTKRKM----IGEWGINETFSHLTAGFLG 160

Query: 245 GGVAQTITYPFDLLRRRFQVLAMGGNEL---GFHYNSVWDALVTIGKTEGFKGYYKGLTA 301
             ++  +  P ++L+ R Q+     N     G++Y ++ DA+ TI + EG+   + G  A
Sbjct: 161 DFISSFVYVPSEVLKTRLQLQGRYNNPFFRSGYNYKNLTDAVTTIVRREGWPTLFFGYKA 220

Query: 302 NLFKVVPSTAVSWLVYE 318
            L + +P + + +  YE
Sbjct: 221 TLSRDLPFSGLQFAFYE 237

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 71/288 (24%), Positives = 121/288 (42%), Gaps = 26/288 (9%)

Query: 44  FERVKILLQVQSSTTAYNKGLFDAIGQVYKEENI-KGLFRGNGLNCIRVFPYSAVQFVVF 102
            + VK   Q   ST  Y K +  A   +  EE + KGL+ G     +  FP +A+ F  +
Sbjct: 76  LDTVKTRQQGAPSTVKY-KNMIGAYRTIILEEGLRKGLYGGYSGAMLGSFPSAAIFFATY 134

Query: 103 EGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLS 162
           E  K+ +      G+      +  L +G L    S     P ++++TRL +Q    +   
Sbjct: 135 EYTKRKMI-----GEWGINETFSHLTAGFLGDFISSFVYVPSEVLKTRLQLQGRYNNPFF 189

Query: 163 KSRASDIAKPPGVWKLLSKAYA---EEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKE 219
           +S  +        +K L+ A        G   L+ G   T    +P+  L FA YE+ ++
Sbjct: 190 RSGYN--------YKNLTDAVTTIVRREGWPTLFFGYKATLSRDLPFSGLQFAFYEKFRQ 241

Query: 220 FMPSDENGNSSMRDSLY-KLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFH--- 275
              + EN       SL  ++  GA +GG+A  IT P D+++ R Q       E       
Sbjct: 242 LAFAVENKTFDEDLSLSNEIITGAAAGGLAGIITTPLDVVKTRIQTQLPDIPENSSQNLK 301

Query: 276 ----YNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYEL 319
                NS+   ++T+ KTEG  G + G+          +++  L+Y++
Sbjct: 302 QQTLTNSITKGMMTVYKTEGLAGLFSGVGPRFIWTSIQSSIMLLLYQV 349

>Kwal_27.12599
          Length = 304

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 70/296 (23%), Positives = 125/296 (42%), Gaps = 29/296 (9%)

Query: 28  LAGGIAGAISRTVV-SPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGL 86
           L  G AG +++ +V  PF+  K+ LQ  ++ T       + + ++ K E ++G ++G   
Sbjct: 28  LLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTA----VEVVKKLVKNEGLRGFYKGTLT 83

Query: 87  NCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDL 146
             + V    + QF V E  K+  F   +    + L   Q    G + G  +     P++ 
Sbjct: 84  PLVGVGACVSCQFGVNEAMKR-FFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEH 142

Query: 147 VRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPY 206
           VR RL  QTA         +  +A+  G    ++K  A  G +M   RG+ PT L     
Sbjct: 143 VRIRLQTQTA---------SGTVAEFKGPLDCINKLRAN-GALM---RGLSPTILREAQG 189

Query: 207 VALNFAVYEQLKEFMPSDENGNSSMRDSL--YKLSM-GAISGGVAQTITYPFDLLRRRFQ 263
            A  F  YE L     +++ G    R  +  +KL + GA+SG       YP D+++   Q
Sbjct: 190 CATYFLTYEALV----ANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQ 245

Query: 264 VLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYEL 319
              +     G    ++      +    G+K ++KG    + +  P+   ++  +EL
Sbjct: 246 TDNLKNPVRG---KNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFEL 298

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 85/200 (42%), Gaps = 24/200 (12%)

Query: 27  FLAGGIAGAISRTVVSPFERVKILLQVQ--SSTTAYNKGLFDAIGQVYKEENIKGLFRGN 84
           ++ G + G  +  + SP E V+I LQ Q  S T A  KG  D I ++        L RG 
Sbjct: 123 YICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRAN---GALMRGL 179

Query: 85  GLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKG---EQLNNWQRLFSGALCGGCSVVAT 141
               +R     A  F+ +E         +  GKG     +  W+    GA+ G    +  
Sbjct: 180 SPTILREAQGCATYFLTYEA-----LVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTV 234

Query: 142 YPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSL 201
           YPLD++++ +  QT NL   +  R  +I +   V +L++  Y    G    ++G  PT L
Sbjct: 235 YPLDVIKSLM--QTDNLK--NPVRGKNIIQ---VARLVNAKY----GWKSFFKGFGPTML 283

Query: 202 GIVPYVALNFAVYEQLKEFM 221
              P     FA +E    F+
Sbjct: 284 RAAPANGATFATFELAMRFL 303

>AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 315
           aa]
          Length = 315

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 61/261 (23%), Positives = 114/261 (43%), Gaps = 44/261 (16%)

Query: 61  NKGLFDAIGQVYKEENIKGLFRG----------NGLNCIRVFPYSAVQFVVFEGCKKHIF 110
           +K   +A+ ++Y++E + G + G          N LN    +  +A   +   G ++   
Sbjct: 57  SKSKLEAVREIYRKEGVVGFYYGLESAMYGMAANSLNYYYFYELAARATMRVRGSRR--- 113

Query: 111 HVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIA 170
                     LN  + + S A+ G  + +A+ P+ +V TR++V        +KS  S +A
Sbjct: 114 ----------LNTSEAILSSAVAGSMTAIASNPIWVVNTRMTV--------AKSEQSTLA 155

Query: 171 KPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSS 230
               +          + G+  L+ G+ P +L +V    + + V+EQLK  +    +G+  
Sbjct: 156 VLLDI--------VRKDGVTALFNGLRP-ALMLVSNPIIQYTVFEQLKNVVL-KWSGSDV 205

Query: 231 MRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTE 290
           +  S +   +GA+    A   TYP+  L+ R  +    G E      S+W  +V I K E
Sbjct: 206 LLPS-WAFLLGAVGKLAATGSTYPYITLKTRMHL--AKGKEDADTQQSMWSLMVDIVKKE 262

Query: 291 GFKGYYKGLTANLFKVVPSTA 311
           G +G Y G+   L + + + A
Sbjct: 263 GIQGLYHGIGVKLTQSILTAA 283

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 45/98 (45%), Gaps = 2/98 (2%)

Query: 222 PSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWD 281
           PS+   N +  D L     GA  G ++  +T P   L  R QV +    E G    S  +
Sbjct: 5   PSN-TANPAEVDELVHAVAGAGGGALSMALTMPLVTLATRMQV-SEQDKEPGTRSKSKLE 62

Query: 282 ALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYEL 319
           A+  I + EG  G+Y GL + ++ +  ++   +  YEL
Sbjct: 63  AVREIYRKEGVVGFYYGLESAMYGMAANSLNYYYFYEL 100

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 77/322 (23%), Positives = 131/322 (40%), Gaps = 30/322 (9%)

Query: 4   VILP-AIEEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNK 62
           +I P  +E+   L  F K   +V   +G + G     V  PF+ +K+ LQ    T   N 
Sbjct: 6   LITPQVVEDLTDLHGFRKTLKDV--FSGTVGGVAQVLVGQPFDIIKVRLQ----TMPGNA 59

Query: 63  GLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKG---E 119
             ++AI  + K E   G ++G     + V    + QF + E  K++ F    + +G    
Sbjct: 60  TAWEAITDLVKYEGFMGFYKGTMAPLVGVGACVSCQFGINEAMKRY-FRDLNRSRGIYDN 118

Query: 120 QLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLL 179
            L+  Q    G + G  + +   P++ VR RL +Q   L+        D  +     KLL
Sbjct: 119 TLSLGQYYTCGFVSGSANALLATPIEHVRIRLQLQKEALANAEYKSTLDCTE-----KLL 173

Query: 180 SKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLS 239
                ++G +M   RG   T +       + F  YE L        +G      S +K  
Sbjct: 174 -----KQGSLM---RGFTATLMRTSHGFGIYFLTYETL--IASQLAHGFRREDISAWKAC 223

Query: 240 M-GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKG 298
           M GA+SG     +TYPFD+++   Q   +     G    +V      I +  G + + KG
Sbjct: 224 MFGALSGAFFWAMTYPFDVVKSVMQADKLVNPAYG---TNVVQVAKNIYRERGLRAFTKG 280

Query: 299 LTANLFKVVPSTAVSWLVYELT 320
               + + +P    ++  +E+T
Sbjct: 281 FMPTMLRSLPVNGATFAAFEVT 302

>Scas_558.2
          Length = 289

 Score = 63.5 bits (153), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 90/209 (43%), Gaps = 27/209 (12%)

Query: 22  DTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEEN----I 77
           DT V  +A  +    +  V  P E +K   QV S+ +++          + K EN    I
Sbjct: 98  DTIVHMIASSMGELAACLVRVPAEVIKQRTQVHSTNSSWQ-----TFRTILKNENQEGII 152

Query: 78  KGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCS 137
           + L+RG     +R  P++ +QF ++E  KK     D +     L  W+    G++ GG +
Sbjct: 153 RNLYRGWSTTIMREIPFTCIQFPLYEFMKKEWALYDNEVG--HLKPWKGAICGSIAGGIA 210

Query: 138 VVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVW 197
              T PLD ++TRL +   ++                +  L+   Y EEG  +  + G++
Sbjct: 211 AATTTPLDFLKTRLMLNKDSIP---------------IKSLIRNIYKEEGFKI-FFSGIY 254

Query: 198 PTSLGIVPYVALNFAVYEQLKEFMPSDEN 226
           P ++ I    A+   VYE +   + S E 
Sbjct: 255 PRTMWISAGGAIFLGVYETMHFMLQSLEE 283

 Score = 58.9 bits (141), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 65/302 (21%), Positives = 129/302 (42%), Gaps = 45/302 (14%)

Query: 25  VAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGN 84
           ++ L+G  AG  +  V  P + +K  LQ +              G  ++     G++RG 
Sbjct: 8   MSLLSGAAAGTSTDLVFFPIDTLKTRLQAK--------------GGFFQNGGYHGIYRGL 53

Query: 85  GLNCIRVFPYSAVQFVVFEGCK----KHIFHV-DTKG--KGEQLNNWQRLFSGALCGGCS 137
           G   +   P +++ FV ++  K     H+  V ++ G      ++    + + ++    +
Sbjct: 54  GSAVVASAPSASLFFVTYDSMKVRVRPHVERVINSSGTRSPHSVDTIVHMIASSMGELAA 113

Query: 138 VVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVW 197
            +   P ++++ R  V + N S  +             ++ + K   +EG I  LYRG  
Sbjct: 114 CLVRVPAEVIKQRTQVHSTNSSWQT-------------FRTILKNENQEGIIRNLYRGWS 160

Query: 198 PTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSM-GAISGGVAQTITYPFD 256
            T +  +P+  + F +YE +K+     +N    ++   +K ++ G+I+GG+A   T P D
Sbjct: 161 TTIMREIPFTCIQFPLYEFMKKEWALYDNEVGHLKP--WKGAICGSIAGGIAAATTTPLD 218

Query: 257 LLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLV 316
            L+ R  +     N+      S+   +  I K EGFK ++ G+      +    A+   V
Sbjct: 219 FLKTRLML-----NKDSIPIKSL---IRNIYKEEGFKIFFSGIYPRTMWISAGGAIFLGV 270

Query: 317 YE 318
           YE
Sbjct: 271 YE 272

>Kwal_33.15446
          Length = 305

 Score = 63.5 bits (153), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 70/308 (22%), Positives = 133/308 (43%), Gaps = 47/308 (15%)

Query: 25  VAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGN 84
           + F++G  +G     V  PF+ +K+ LQ    T  + KG  D + Q  +++ I+G + G 
Sbjct: 20  MGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRF-KGPLDCVYQTMRQQGIRGFYLG- 77

Query: 85  GLNCIRVFPYSAVQFVVFE----GC--------KKHIFHVDTKGKGEQLNNWQRLFSGAL 132
                  F    V +++ +    GC        KK+++  +     E+L     + SG L
Sbjct: 78  -------FTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHE-----EKLPLSGCILSGVL 125

Query: 133 CGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGL 192
            G        P++L + +L VQ    ++ ++ R        G   ++ K YA +G I G+
Sbjct: 126 AGWSVSFIAAPVELAKAKLQVQYD--AQTTRYR--------GPLDVIKKVYAADG-IRGM 174

Query: 193 YRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVA-QTI 251
           Y+G+  T +    +V   +  YE L  +       N+++ D+      G  S      T 
Sbjct: 175 YKGLVSTLIFRTHFVYW-WGSYELLTRWF----KANTNLSDTAINFWAGGFSASFGFWTT 229

Query: 252 TYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTA 311
            YP D+++   QV+ +  ++      S  +A   I +T G +G++KG   +  +  P+ A
Sbjct: 230 AYPSDVIK---QVI-LCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANA 285

Query: 312 VSWLVYEL 319
            +   +E 
Sbjct: 286 AALASFEF 293

 Score = 34.7 bits (78), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 37/83 (44%), Gaps = 1/83 (1%)

Query: 22  DTNVAFLAGGIAGAIS-RTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGL 80
           DT + F AGG + +    T   P + +K ++          +   +A   +++   I+G 
Sbjct: 210 DTAINFWAGGFSASFGFWTTAYPSDVIKQVILCNDKYDGSLRSWRNAASDIWRTRGIRGF 269

Query: 81  FRGNGLNCIRVFPYSAVQFVVFE 103
           F+G   + +R FP +A     FE
Sbjct: 270 FKGFVPSFLRSFPANAAALASFE 292

>Scas_714.18
          Length = 305

 Score = 63.2 bits (152), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 72/308 (23%), Positives = 126/308 (40%), Gaps = 42/308 (13%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYN-KGLFDAIGQVYKEENI-KGLFRGNG 85
           LAG IAGAI + +  PF+ VK+ LQ Q    AY     +  I   Y+ E I +G ++G  
Sbjct: 17  LAGSIAGAIGKFIEYPFDTVKVRLQTQE---AYMFPSTWSCIKYTYENEGILEGFYQGIE 73

Query: 86  LNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLD 145
              I     +A+ F+ +  C   +         E       L S    G C+     P++
Sbjct: 74  SPLIGAALENAILFLAYNQCSSFL-----NAFTEFSAFLIILISAGFAGSCASFVLTPVE 128

Query: 146 LVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLS-----------KAYAEEGGIMGLYR 194
           L++ +L +   + S           +      ++            K+  +E G+ GL++
Sbjct: 129 LIKCKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRHTRIIPTIKSIIKEKGLFGLWQ 188

Query: 195 GVWPT----SLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQT 250
           G   T    S+G V +    FA YE +K+ +    +  S +  +   L  GA +G     
Sbjct: 189 GQSSTFIRESIGSVVW----FATYELMKQTL---RDPKSEVNTTWQLLISGATAGLAFNG 241

Query: 251 ITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPST 310
             +P D ++   Q            + ++ + + +I + +G  G+Y+GL   L + VPS 
Sbjct: 242 SVFPADTVKSIMQT----------EHLALMETVRSILERDGVAGFYRGLGITLLRAVPSN 291

Query: 311 AVSWLVYE 318
           A  +  YE
Sbjct: 292 AAVFYTYE 299

 Score = 56.2 bits (134), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 58/237 (24%), Positives = 94/237 (39%), Gaps = 50/237 (21%)

Query: 13  NQLKNFLKQDTN-----VAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKG---- 63
           NQ  +FL   T      +  ++ G AG+ +  V++P E +K  LQ+ +   + +      
Sbjct: 91  NQCSSFLNAFTEFSAFLIILISAGFAGSCASFVLTPVELIKCKLQISNLHYSLHDNDGEQ 150

Query: 64  -------------------LFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEG 104
                              +   I  + KE+ + GL++G     IR    S V F  +E 
Sbjct: 151 QDEEDEDQGMVIGEGRHTRIIPTIKSIIKEKGLFGLWQGQSSTFIRESIGSVVWFATYEL 210

Query: 105 CKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKS 164
            K+ +       K E    WQ L SGA  G     + +P D V++ +  QT +L+ +   
Sbjct: 211 MKQTL----RDPKSEVNTTWQLLISGATAGLAFNGSVFPADTVKSIM--QTEHLALMETV 264

Query: 165 RASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFM 221
           R+                  E  G+ G YRG+  T L  VP  A  F  YE+L + +
Sbjct: 265 RS----------------ILERDGVAGFYRGLGITLLRAVPSNAAVFYTYEKLSKIL 305

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 43/85 (50%), Gaps = 7/85 (8%)

Query: 234 SLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEG-F 292
           +L ++  G+I+G + + I YPFD ++ R Q       +  + + S W  +    + EG  
Sbjct: 12  ALREILAGSIAGAIGKFIEYPFDTVKVRLQ------TQEAYMFPSTWSCIKYTYENEGIL 65

Query: 293 KGYYKGLTANLFKVVPSTAVSWLVY 317
           +G+Y+G+ + L       A+ +L Y
Sbjct: 66  EGFYQGIESPLIGAALENAILFLAY 90

>Kwal_0.232
          Length = 274

 Score = 62.0 bits (149), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 87/197 (44%), Gaps = 31/197 (15%)

Query: 29  AGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKG----LFRGN 84
           AG IA  + R    P E +K   Q   S ++        + ++ + EN +G    L+RG 
Sbjct: 104 AGEIAACMVRV---PAEVIKQRTQTHKSDSS-----LQTLKKLLQNENGEGIRRNLYRGW 155

Query: 85  GLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPL 144
               +R  P++ +QF ++E  KK        G  EQ+  WQ  F G + GG +   T PL
Sbjct: 156 STTVMREIPFTCIQFPLYEFLKKQW---AISGGREQVAPWQGAFCGCVAGGIAAATTTPL 212

Query: 145 DLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIV 204
           D+++TRL +   ++  L  +R               + YA EG  +  + GV P ++ I 
Sbjct: 213 DVLKTRLMLSHTSVPVLHLAR---------------QIYATEGWKV-FFSGVGPRTVWIS 256

Query: 205 PYVALNFAVYEQLKEFM 221
              A+   VYE +   +
Sbjct: 257 AGGAIFLGVYETVHSIL 273

 Score = 49.7 bits (117), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 67/300 (22%), Positives = 114/300 (38%), Gaps = 46/300 (15%)

Query: 25  VAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGN 84
            + LAG  AG  +     P + +K  LQ              A G  +      G++RG 
Sbjct: 8   TSLLAGAAAGTSTDLFFFPIDTLKTRLQ--------------AAGGFFANGGYLGVYRGL 53

Query: 85  GLNCIRVFPYSAVQFVVFEGCKKH---IFHVDTKGKGEQLNNWQRLFSGALCGGCSVVAT 141
           G   +   P +++ FV ++G K +   IF+       +       +FS +     + +  
Sbjct: 54  GSAVVASAPSASLFFVTYDGMKSYSRPIFNNLITSSDQVAETATHMFSSSAGEIAACMVR 113

Query: 142 YPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSL 201
            P ++++ R     ++ S L   +           KLL     E G    LYRG   T +
Sbjct: 114 VPAEVIKQRTQTHKSD-SSLQTLK-----------KLLQNENGE-GIRRNLYRGWSTTVM 160

Query: 202 GIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLS---MGAISGGVAQTITYPFDLL 258
             +P+  + F +YE LK+     +   S  R+ +        G ++GG+A   T P D+L
Sbjct: 161 REIPFTCIQFPLYEFLKK-----QWAISGGREQVAPWQGAFCGCVAGGIAAATTTPLDVL 215

Query: 259 RRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
           + R          L      V      I  TEG+K ++ G+      +    A+   VYE
Sbjct: 216 KTRLM--------LSHTSVPVLHLARQIYATEGWKVFFSGVGPRTVWISAGGAIFLGVYE 267

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 67/299 (22%), Positives = 120/299 (40%), Gaps = 45/299 (15%)

Query: 25  VAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGN 84
           ++ L+G  AG  +  V  P + +K  LQ +              G  ++    +G++RG 
Sbjct: 7   ISLLSGAAAGTSTDLVFFPIDTLKTRLQAK--------------GGFFRNGGYRGVYRGL 52

Query: 85  GLNCIRVFPYSAVQFVVFEGCKKHI--FHVDTKGKGEQLNNWQRLFSGALCGGCSVVATY 142
           G   +   P +++ F+ ++ CK     F           +    +FS ++    + +   
Sbjct: 53  GSAVVASAPGASLFFITYDTCKAETRGFFRGLLPSSNVADVVTHMFSSSMGEIAACMVRV 112

Query: 143 PLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGG---IMGLYRGVWPT 199
           P ++V+ R           S++ AS  +     W+ L +    E G      LYRG   T
Sbjct: 113 PAEVVKQR-----------SQTHASHSS-----WETLREILKNENGEGVRRNLYRGWSTT 156

Query: 200 SLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLR 259
            +  +P+  + F +YE +K+     E   S   +       G+I+GG+A   T P D L+
Sbjct: 157 IMREIPFTCIQFPLYEYMKKVWA--ELDESDRVEPWKGAVCGSIAGGIAAATTTPLDFLK 214

Query: 260 RRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
            R  +L      LG         + TI K EGFK ++ G+      +    A+   +YE
Sbjct: 215 TRL-MLCKKSIPLG-------TLVSTIYKEEGFKVFFSGVGPRTMWISAGGAIFLGIYE 265

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 93/201 (46%), Gaps = 31/201 (15%)

Query: 30  GGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKG----LFRGNG 85
           G IA  + R    P E VK   Q  +S +++     + + ++ K EN +G    L+RG  
Sbjct: 103 GEIAACMVRV---PAEVVKQRSQTHASHSSW-----ETLREILKNENGEGVRRNLYRGWS 154

Query: 86  LNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLD 145
              +R  P++ +QF ++E  KK    +D   + +++  W+    G++ GG +   T PLD
Sbjct: 155 TTIMREIPFTCIQFPLYEYMKKVWAELD---ESDRVEPWKGAVCGSIAGGIAAATTTPLD 211

Query: 146 LVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVP 205
            ++TRL +   ++             P G   L+S  Y EE G    + GV P ++ I  
Sbjct: 212 FLKTRLMLCKKSI-------------PLGT--LVSTIYKEE-GFKVFFSGVGPRTMWISA 255

Query: 206 YVALNFAVYEQLKEFMPSDEN 226
             A+   +YE +   + +++ 
Sbjct: 256 GGAIFLGIYETVHSLLSTNKK 276

>Kwal_56.23011
          Length = 303

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 79/322 (24%), Positives = 135/322 (41%), Gaps = 31/322 (9%)

Query: 3   EVILPAIEEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNK 62
           E+  P + ++    +  KQ     F  G + G     V  PF+  K+ LQ     T   +
Sbjct: 4   ELTSPQVVDDLVDTHDFKQALKDVF-CGTVGGVAQVLVGQPFDITKVRLQTSPVPTTAAQ 62

Query: 63  GLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQ-L 121
                I  + K E +   ++G       V    + QF V E  KK     D  G  +Q L
Sbjct: 63  ----VIKSLVKNEGLLAFYKGTLAPLAGVGACVSCQFGVNEALKKWFRKKD--GNFDQPL 116

Query: 122 NNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSK 181
              Q    G + G  +     P++ VR RL +QTA+ S      + D A+     KLL  
Sbjct: 117 ALRQYYACGFVSGTANAFLATPIEHVRIRLQLQTASSSAAEYHGSLDCAR-----KLL-- 169

Query: 182 AYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSL--YKLS 239
              ++G +M   RG   T+L       + F  YE L     +++  +  +R+++  +K+ 
Sbjct: 170 ---KQGALM---RGFTATTLRTSHGFGIYFLTYETLI----ANQAHHGVLRENIPAWKVC 219

Query: 240 M-GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKG 298
           + GA SG     +TYPFD+++   Q   +     G +  +V  A   I +  G + + KG
Sbjct: 220 VYGAFSGAFFWAMTYPFDVVKSVMQADKLKNPVYGRNPLAVAKA---IYRERGPRAFTKG 276

Query: 299 LTANLFKVVPSTAVSWLVYELT 320
            T  + + +P    ++  +E+T
Sbjct: 277 FTPTMLRSLPVNGATFAAFEIT 298

>Kwal_23.2913
          Length = 320

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 75/322 (23%), Positives = 129/322 (40%), Gaps = 58/322 (18%)

Query: 21  QDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKE------ 74
           +D+  +  AGG+ G  +     PF+ +K+  Q   ++     G  DAI +V  E      
Sbjct: 26  RDSFESLAAGGVGGVCAVLTGHPFDLLKVRCQSNQAS-----GTLDAISRVLHEAKSKSG 80

Query: 75  ----ENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIF-----HVDTKGKGEQLN--- 122
                 IKG +RG     + V P  AV F  ++  K+ +        D  G   +L    
Sbjct: 81  PLPLNQIKGFYRGVIPPLLGVTPIFAVSFWGYDVGKRLVTWGSNPVTDIAGSSSKLTPLT 140

Query: 123 NWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKA 182
             Q   +G      + + T P +  R ++ +QT+                 G +   ++ 
Sbjct: 141 TSQLALAGFFSAIPTTLITAPTE--RVKVVLQTSE---------------SGSFLGAART 183

Query: 183 YAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGA 242
              EGG+  L++G   T     P  AL FA YE  K F+  +++      D+L  +S+  
Sbjct: 184 LIREGGVRSLFQGTLATLARDGPGSALYFASYEVSKRFLSRNQD-----TDALSVVSI-C 237

Query: 243 ISGGVAQTI----TYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKG 298
           ++GGVA        +P D ++ + Q  +           S+  A   I    G +G++ G
Sbjct: 238 VAGGVAGMSMWIGVFPIDTIKTKLQSSS--------RSQSMVQAAREIYTRAGLRGFFPG 289

Query: 299 LTANLFKVVPSTAVSWLVYELT 320
           L   L +  P+ A ++L  E T
Sbjct: 290 LGPALMRSFPANAATFLGVEFT 311

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 57/224 (25%), Positives = 97/224 (43%), Gaps = 32/224 (14%)

Query: 113 DTKGKGEQLNN-------WQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSR 165
           D   K EQ +N       ++ L +G + G C+V+  +P DL++ R     A+ +  + SR
Sbjct: 11  DLNAKIEQASNSHTLRDSFESLAAGGVGGVCAVLTGHPFDLLKVRCQSNQASGTLDAISR 70

Query: 166 ASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMP--- 222
               AK       L++       I G YRGV P  LG+ P  A++F  Y+  K  +    
Sbjct: 71  VLHEAKSKSGPLPLNQ-------IKGFYRGVIPPLLGVTPIFAVSFWGYDVGKRLVTWGS 123

Query: 223 ---SDENGNSSMRDSLY--KLSMGAISGGVAQT-ITYPFDLLRRRFQVLAMGGNELGFHY 276
              +D  G+SS    L   +L++      +  T IT P + ++   Q    G        
Sbjct: 124 NPVTDIAGSSSKLTPLTTSQLALAGFFSAIPTTLITAPTERVKVVLQTSESG-------- 175

Query: 277 NSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYELT 320
            S   A  T+ +  G +  ++G  A L +  P +A+ +  YE++
Sbjct: 176 -SFLGAARTLIREGGVRSLFQGTLATLARDGPGSALYFASYEVS 218

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 77/313 (24%), Positives = 121/313 (38%), Gaps = 34/313 (10%)

Query: 12  ENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQV 71
            NQL  +   D     LAG I    + + + P + VK  +Q++   T YNKG+  +  ++
Sbjct: 2   SNQLPQYSYSDYAKFALAGAIGCGSTHSSMVPIDVVKTRIQLEP--TVYNKGMVGSFRKI 59

Query: 72  YKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKG--KGEQLNNWQRLFS 129
             EE    L  G G   +      A +F  +E  KK  F +DT G     +  N   + S
Sbjct: 60  IAEEGAGALLTGFGPTLLGYSIQGAFKFGGYEVFKK--FFIDTLGYDTAARYKNSVYIGS 117

Query: 130 GALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGI 189
            A     + +A  PL+  R RL  Q    + L            G  ++L     +E G+
Sbjct: 118 AAAAEFLADIALCPLEATRIRLVSQPTFANGLVG----------GFSRIL-----KEEGV 162

Query: 190 MGLYRGVWPTSLGIVPYVALNFAVYEQLKEFM-----PSDENGNSSMRDSLYKLSMGAIS 244
              Y G  P     +PY    F V+E+  E       P D    +S+  +   L  G  +
Sbjct: 163 GSFYSGFTPILFKQIPYNIAKFLVFERASELYFSLAPPKDTLSQTSL--TAINLLSGLTA 220

Query: 245 GGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLF 304
           G  A  ++ P D L  +    +    +      S    L  + K  GF G + GL   L 
Sbjct: 221 GLAAAIVSQPADTLLSKVNKTSKAPGQ------STVGLLFQLAKQLGFVGSFAGLPTRLV 274

Query: 305 KVVPSTAVSWLVY 317
            V   T++ + +Y
Sbjct: 275 MVGTLTSLQFGIY 287

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 79/193 (40%), Gaps = 24/193 (12%)

Query: 128 FSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEG 187
            +GA+  G +  +  P+D+V+TR+ ++    +K             G+     K  AEEG
Sbjct: 18  LAGAIGCGSTHSSMVPIDVVKTRIQLEPTVYNK-------------GMVGSFRKIIAEEG 64

Query: 188 GIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMR--DSLYKLSMGAISG 245
               L  G  PT LG     A  F  YE  K+F       +++ R  +S+Y +   A + 
Sbjct: 65  A-GALLTGFGPTLLGYSIQGAFKFGGYEVFKKFFIDTLGYDTAARYKNSVY-IGSAAAAE 122

Query: 246 GVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFK 305
            +A     P +  R R        N L   ++ +        K EG   +Y G T  LFK
Sbjct: 123 FLADIALCPLEATRIRLVSQPTFANGLVGGFSRIL-------KEEGVGSFYSGFTPILFK 175

Query: 306 VVPSTAVSWLVYE 318
            +P     +LV+E
Sbjct: 176 QIPYNIAKFLVFE 188

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 83/188 (44%), Gaps = 23/188 (12%)

Query: 36  ISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYS 95
           ++   + P E  +I L  Q +   +  GL     ++ KEE +   + G      +  PY+
Sbjct: 124 LADIALCPLEATRIRLVSQPT---FANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYN 180

Query: 96  AVQFVVFEGCKKHIFHV-DTKGKGEQLN-NWQRLFSGALCGGCSVVATYPLDLVRTRLSV 153
             +F+VFE   +  F +   K    Q +     L SG   G  + + + P D +      
Sbjct: 181 IAKFLVFERASELYFSLAPPKDTLSQTSLTAINLLSGLTAGLAAAIVSQPADTL------ 234

Query: 154 QTANLSKLSKSRASDIAKPPGVWKL-LSKAYAEEGGIMGLYRGVWPTSLGIV-PYVALNF 211
               LSK++K+     +K PG   + L    A++ G +G + G+ PT L +V    +L F
Sbjct: 235 ----LSKVNKT-----SKAPGQSTVGLLFQLAKQLGFVGSFAGL-PTRLVMVGTLTSLQF 284

Query: 212 AVYEQLKE 219
            +Y QLK+
Sbjct: 285 GIYGQLKK 292

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 80/190 (42%), Gaps = 19/190 (10%)

Query: 130 GALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGI 189
           G   G  + VAT+PLDL + RL  QTA   K            P + ++ S+    EG +
Sbjct: 15  GGFGGIVACVATHPLDLAKVRL--QTAPAPK------------PTLVRMASQILRNEG-V 59

Query: 190 MGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQ 249
            GLY G+    L    Y    F VY+ +KE     E  NS     LY L     SG V  
Sbjct: 60  PGLYSGLTAAILRQCTYTTARFGVYDFVKERYIPKEYLNS----MLYLLPCSMFSGAVGG 115

Query: 250 TITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPS 309
            I  P D++  R Q  +    EL  +Y +  D L  I   EG    + G   NL + +  
Sbjct: 116 LIGNPADVVNIRMQNDSSLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNLVRGILM 175

Query: 310 TAVSWLVYEL 319
           T+   + Y++
Sbjct: 176 TSSQVVTYDI 185

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 82/192 (42%), Gaps = 23/192 (11%)

Query: 33  AGAISRTVVSPFERVKILLQVQSSTTAY----NKGLFDAIGQVYKEENIKGLFRGNGLNC 88
           +GA+   + +P + V I +Q  SS  A      K   D + ++   E +  LF G   N 
Sbjct: 110 SGAVGGLIGNPADVVNIRMQNDSSLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNL 169

Query: 89  IRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGG-CSVVATYPLDLV 147
           +R    ++ Q V ++  K ++     +  G   +N    F+ +L  G  +     P D++
Sbjct: 170 VRGILMTSSQVVTYDIAKNYL----VQNVGLDKDNKSTHFASSLLAGLVATTVCSPADVI 225

Query: 148 RTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYV 207
           +TR+     N  K S   A          ++L  A  +EG    ++RG  P+ + + P  
Sbjct: 226 KTRV----MNAHKHSHDSAV---------RILLDAVKQEGPSF-MFRGWLPSFVRLGPNT 271

Query: 208 ALNFAVYEQLKE 219
            L F   EQL++
Sbjct: 272 ILIFLTVEQLRK 283

 Score = 34.7 bits (78), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 51/102 (50%), Gaps = 13/102 (12%)

Query: 16  KNFL-------KQDTNVAFLAGGIAGAISRTVVSPFERVK--ILLQVQSSTTAYNKGLFD 66
           KN+L       K + +  F +  +AG ++ TV SP + +K  ++   + S  +  + L D
Sbjct: 187 KNYLVQNVGLDKDNKSTHFASSLLAGLVATTVCSPADVIKTRVMNAHKHSHDSAVRILLD 246

Query: 67  AIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKH 108
           A+    K+E    +FRG   + +R+ P + + F+  E  +KH
Sbjct: 247 AV----KQEGPSFMFRGWLPSFVRLGPNTILIFLTVEQLRKH 284

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 66/303 (21%), Positives = 127/303 (41%), Gaps = 37/303 (12%)

Query: 25  VAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGN 84
           + F+AG  +G     V  PF+ +K+ LQ   + T + KG  D + + ++ + I+G + G 
Sbjct: 25  MGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRF-KGPLDCVYKTFRNQGIRGFYLG- 82

Query: 85  GLNCIRVFPYSAVQFVVFE----GC---KKHIFHVDTKGKGEQLNNWQRLFSGALCGGCS 137
                  F    V +++ +    GC    + + H       E+L     + SG L G   
Sbjct: 83  -------FTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSV 135

Query: 138 VVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVW 197
                P++L + +L VQ    +   K          G   ++ K Y+ + GI GLY+G+ 
Sbjct: 136 SFIAPPIELAKAKLQVQYDKTTTRYK----------GPLDVIKKIYSAQ-GIRGLYKGLI 184

Query: 198 PTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVA-QTITYPFD 256
            T +    +V   +  YE L  +       N+ M ++      G  S      T  YP D
Sbjct: 185 STLIFRTHFVYW-WGSYELLTRWF----RENTKMSEAAINFWAGGFSASFGFWTTAYPSD 239

Query: 257 LLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLV 316
           ++++    + +  ++    + S   A+  I +++G  G++KG   +  +  P+ A +   
Sbjct: 240 VVKQ----VVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPANAAALAA 295

Query: 317 YEL 319
           +E 
Sbjct: 296 FEF 298

 Score = 30.0 bits (66), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 36/83 (43%), Gaps = 1/83 (1%)

Query: 22  DTNVAFLAGGIAGAIS-RTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGL 80
           +  + F AGG + +    T   P + VK ++          K    A+  +Y+ + I G 
Sbjct: 215 EAAINFWAGGFSASFGFWTTAYPSDVVKQVVLCNDKYDGSFKSWRTAVKDIYQSKGINGF 274

Query: 81  FRGNGLNCIRVFPYSAVQFVVFE 103
           F+G   + +R FP +A     FE
Sbjct: 275 FKGFVPSFLRSFPANAAALAAFE 297

>YPR128C (ANT1) [5547] chr16 complement(791212..792198)
           Peroxisome-localized protein involved in adenine
           nucleotide transport, medium-chain fatty acid
           metabolism, and peroxisome proliferation, has similarity
           to ADP/ATP carrier proteins [987 bp, 328 aa]
          Length = 328

 Score = 60.1 bits (144), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 65/301 (21%), Positives = 124/301 (41%), Gaps = 45/301 (14%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQ---SSTTAYNKG----------LFDAIGQVYKE 74
           L G +A A++   V P +  K ++Q Q   SS+   N+G          + D +  ++KE
Sbjct: 8   LTGAVASAMANIAVYPLDLSKTIIQSQVSPSSSEDSNEGKVLPNRRYKNVVDCMINIFKE 67

Query: 75  ENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLN--------NWQR 126
           + I GL++G  +  +  F  + V F  +   +K        G     N          + 
Sbjct: 68  KGILGLYQGMTVTTVATFVQNFVYFFWYTFIRKSYMKHKLLGLQSLKNRDGPITPSTIEE 127

Query: 127 LFSGALCGGCSVVATYPLDLVRTRL-SVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAE 185
           L  G      S + T P+ +V TR  +V +A  +K +               ++   Y E
Sbjct: 128 LVLGVAAASISQLFTSPMAVVATRQQTVHSAESAKFTN--------------VIKDIYRE 173

Query: 186 EGG-IMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAIS 244
             G I   ++G+  T L +    ++ +A +++LKE    D + ++    ++    +G +S
Sbjct: 174 NNGDITAFWKGL-RTGLALTINPSITYASFQRLKEVFFHDHSNDAGSLSAVQNFILGVLS 232

Query: 245 GGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLF 304
             ++  +T P  + +   Q         G  + +  +AL+ + K EG K  +KG+   L 
Sbjct: 233 KMISTLVTQPLIVAKAMLQ-------SAGSKFTTFQEALLYLYKNEGLKSLWKGVLPQLT 285

Query: 305 K 305
           K
Sbjct: 286 K 286

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score = 59.7 bits (143), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 66/308 (21%), Positives = 129/308 (41%), Gaps = 47/308 (15%)

Query: 25  VAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGN 84
           + F++G  +G     V  PF+ +K+ LQ    +T + KG  D + + + ++ I+G + G 
Sbjct: 62  MGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRF-KGPLDCVYKTFTQQGIRGFYLG- 119

Query: 85  GLNCIRVFPYSAVQFVVFE----GC--------KKHIFHVDTKGKGEQLNNWQRLFSGAL 132
                  F    V +++ +    GC        KK++++ +     E+L     + SG +
Sbjct: 120 -------FTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNE-----EKLPLSGCIISGVM 167

Query: 133 CGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGL 192
            G        P++L + +L VQ            +   K  G   ++ K Y+  G + GL
Sbjct: 168 AGWSVSFIAAPVELAKAKLQVQYD----------AKTTKYTGPVDVIKKVYSSNG-VRGL 216

Query: 193 YRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVA-QTI 251
           Y+G+  T +    +V   +  YE L  +     N    M D+      G  S      T 
Sbjct: 217 YKGLTSTLIFRTNFV-FWWGSYELLTRWFKEHTN----MSDTAINFWSGGFSASFGFWTT 271

Query: 252 TYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTA 311
            YP D++++    + +  ++    + S   A   I +T G++G++KG   +  +  P+ A
Sbjct: 272 AYPSDVIKQ----VVLCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPANA 327

Query: 312 VSWLVYEL 319
            +   +E 
Sbjct: 328 AALAAFEF 335

>Scas_328.1
          Length = 227

 Score = 58.5 bits (140), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 63/132 (47%), Gaps = 8/132 (6%)

Query: 188 GIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGV 247
           G++GLYRG  P+ +GI+ Y  L F +Y+ LK  + +    N+ +   L    +G      
Sbjct: 94  GVLGLYRGFLPSVVGIMVYRGLYFGLYDSLKPVLLTGSFENAFLPSFL----LGWAVTIS 149

Query: 248 AQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVV 307
           A T +YP D +RRR  ++   G  +   Y    D    I   EG    +KG  AN+F+ V
Sbjct: 150 ASTTSYPLDTVRRR--MMMTSGQAV--KYKGAIDCFQQIVSQEGVYSLFKGCGANIFRGV 205

Query: 308 PSTAVSWLVYEL 319
            +  V  L  +L
Sbjct: 206 AAAGVISLYDQL 217

 Score = 32.7 bits (73), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 28/65 (43%)

Query: 26  AFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNG 85
           +FL G      + T   P + V+  + + S      KG  D   Q+  +E +  LF+G G
Sbjct: 139 SFLLGWAVTISASTTSYPLDTVRRRMMMTSGQAVKYKGAIDCFQQIVSQEGVYSLFKGCG 198

Query: 86  LNCIR 90
            N  R
Sbjct: 199 ANIFR 203

>ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH]
           (771097..772119) [1023 bp, 340 aa]
          Length = 340

 Score = 59.3 bits (142), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 63/256 (24%), Positives = 108/256 (42%), Gaps = 34/256 (13%)

Query: 62  KGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHV-DTKGKGEQ 120
           KG  DA+ ++Y  E + GL+RG G + +  F  S   F  +   +KH F +   +G   +
Sbjct: 73  KGALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFWYTLVRKHYFRLKQARGGDAR 132

Query: 121 LNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLS 180
            +  + L  G +    S +   P+++V TR         + ++ +A+  A    V +   
Sbjct: 133 FSTPEELVLGIVAAATSQLFVNPINVVATR---------QQTRGQAAGAADMRTVAR--- 180

Query: 181 KAYAEEGGIMGLYRGVWP---TSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYK 237
           + +AE G     +RG W     SL +    ++ +A YE+L+E +       S + DS   
Sbjct: 181 EVHAENG-----WRGFWAGLKVSLVLTVNPSITYATYERLREALFPTPAAASHLVDSAAL 235

Query: 238 LS------MGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEG 291
           LS      MG +S  V+  +T P  + +   Q         G  +      L  +  TEG
Sbjct: 236 LSPGQNFVMGVLSKIVSTVLTQPLIIAKASLQ-------RSGSCFQDFHQVLHHLYSTEG 288

Query: 292 FKGYYKGLTANLFKVV 307
               +KGL   + K V
Sbjct: 289 PLSLWKGLGPQITKGV 304

 Score = 33.5 bits (75), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 42/212 (19%), Positives = 81/212 (38%), Gaps = 30/212 (14%)

Query: 130 GALCGGCSVVATYPLDLVRTRLSVQTAN---------LSKLSKSRASDIAKP-------- 172
           GA     + +A YPLDL +T +  Q  +           + + SR  +  KP        
Sbjct: 9   GATASSLANIAVYPLDLAKTLVQTQLKDEFVEAGEEAGEERAGSRRQNRIKPIALRSPQA 68

Query: 173 ----PGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKE--FMPSDEN 226
                G    L + Y  E G+ GLYRG+  +++         F  Y  +++  F      
Sbjct: 69  AEQYKGALDALQRIYGAE-GVAGLYRGLGSSTVAGFIQSFSYFFWYTLVRKHYFRLKQAR 127

Query: 227 GNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTI 286
           G  +   +  +L +G ++   +Q    P +++  R Q               +      +
Sbjct: 128 GGDARFSTPEELVLGIVAAATSQLFVNPINVVATRQQTRGQAAGA-----ADMRTVAREV 182

Query: 287 GKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
               G++G++ GL  +L   V + ++++  YE
Sbjct: 183 HAENGWRGFWAGLKVSLVLTV-NPSITYATYE 213

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 58.9 bits (141), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 90/209 (43%), Gaps = 33/209 (15%)

Query: 120 QLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLL 179
           +L ++Q L +GAL      + T P+ +++ R        + L+++          +W+  
Sbjct: 101 RLQSYQNLLTGALSRAAVGLVTMPITVIKVRYESTLYAYNGLAEATRH-------IWR-- 151

Query: 180 SKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMP---------SDENGNSS 230
                   G  G ++G   T+L   PY  L   +YEQ KE +P         +DE+G  +
Sbjct: 152 ------SEGARGFFKGAAATTLRDAPYAGLYVLLYEQAKEMLPRALPATLLGADESGKLT 205

Query: 231 MRDSLYKLSMGA-ISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKT 289
              S     + A +S  +A T+T PFD ++ R Q   +  + +GF        L  I   
Sbjct: 206 APASAMVNGVSAFLSASLATTLTAPFDTIKTRMQ---LQSHPVGF-----VQTLRHIVCE 257

Query: 290 EGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
           E  +  + GL+  L +   S  ++W +YE
Sbjct: 258 ERARTLFDGLSLRLCRKAMSACIAWGIYE 286

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 83/199 (41%), Gaps = 36/199 (18%)

Query: 127 LFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEE 186
           L SG   G  SV A  PLDL++TRL  Q A  S L +S   ++     +W          
Sbjct: 12  LVSGFFGGLASVCALQPLDLLKTRL--QQAQASSL-RSVLREVRTTRELW---------- 58

Query: 187 GGIMGLYRGVWP----TSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYK---LS 239
                  RG  P    TS+G   Y  L+   Y +      S+    SS+   L     L 
Sbjct: 59  -------RGTLPSALRTSIGSALY--LSLLNYSRSALARGSEARTRSSLLPRLQSYQNLL 109

Query: 240 MGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGL 299
            GA+S      +T P  +++ R++          + YN + +A   I ++EG +G++KG 
Sbjct: 110 TGALSRAAVGLVTMPITVIKVRYE-------STLYAYNGLAEATRHIWRSEGARGFFKGA 162

Query: 300 TANLFKVVPSTAVSWLVYE 318
            A   +  P   +  L+YE
Sbjct: 163 AATTLRDAPYAGLYVLLYE 181

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 64/141 (45%), Gaps = 24/141 (17%)

Query: 32  IAGAISRTVVS----PFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLN 87
           + GA+SR  V     P   +K+  + +S+  AYN GL +A   +++ E  +G F+G    
Sbjct: 109 LTGALSRAAVGLVTMPITVIKV--RYESTLYAYN-GLAEATRHIWRSEGARGFFKGAAAT 165

Query: 88  CIRVFPYSAVQFVVFEGCKKH--------IFHVDTKGK-----GEQLNNWQRLFSGALCG 134
            +R  PY+ +  +++E  K+         +   D  GK        +N      S +L  
Sbjct: 166 TLRDAPYAGLYVLLYEQAKEMLPRALPATLLGADESGKLTAPASAMVNGVSAFLSASL-- 223

Query: 135 GCSVVATYPLDLVRTRLSVQT 155
             +   T P D ++TR+ +Q+
Sbjct: 224 --ATTLTAPFDTIKTRMQLQS 242

 Score = 32.7 bits (73), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 16/72 (22%), Positives = 36/72 (50%), Gaps = 4/72 (5%)

Query: 32  IAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLNCIRV 91
           ++ +++ T+ +PF+ +K  +Q+QS    +  G    +  +  EE  + LF G  L   R 
Sbjct: 219 LSASLATTLTAPFDTIKTRMQLQS----HPVGFVQTLRHIVCEERARTLFDGLSLRLCRK 274

Query: 92  FPYSAVQFVVFE 103
              + + + ++E
Sbjct: 275 AMSACIAWGIYE 286

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 71/280 (25%), Positives = 115/280 (41%), Gaps = 25/280 (8%)

Query: 28  LAGGIAGAISRTVV-SPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGL 86
           L  G AG I++ +V  PF+  K+ LQ   ++T   K + D I    K E   G ++G   
Sbjct: 27  LLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKDLI----KNEGPMGFYKGTLT 82

Query: 87  NCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDL 146
             + V    ++QF V E  K+  FH   +   + L+  Q    G   G  +     P++ 
Sbjct: 83  PLVGVGACVSLQFGVNEAMKR-FFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEH 141

Query: 147 VRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPY 206
           +R RL  QT +         ++   P    K L       G +M   RG+ PT L     
Sbjct: 142 IRIRLQTQTGS------GATAEFKGPIDCIKKLRV----NGQLM---RGLTPTMLRESHG 188

Query: 207 VALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSM-GAISGGVAQTITYPFDLLRRRFQVL 265
             + F  YE L       ++G        +KL + GA SG +  T+ YP D+++   Q  
Sbjct: 189 CGVYFLTYEAL--IGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTD 246

Query: 266 AMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFK 305
            +   + G   N++     TI   +G  G +KG    + +
Sbjct: 247 NLKTPKNG---NNILTVGRTIIARQGVSGLFKGFAPTMLR 283

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 74/194 (38%), Gaps = 25/194 (12%)

Query: 127 LFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEE 186
           L +G   G   V+   P D  + RL  QT+  S  +     D+ K               
Sbjct: 27  LLAGTAGGIAQVLVGQPFDTTKVRL--QTSETSTNAVKVIKDLIK--------------N 70

Query: 187 GGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPS-DENGNSSMRDSLYKLSMGAISG 245
            G MG Y+G     +G+   V+L F V E +K F  + DE  +  +  SL +  +  ++G
Sbjct: 71  EGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHL--SLLQYYICGVAG 128

Query: 246 GVAQT-ITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLF 304
           G   + +  P + +R R Q     G    F        +  I K        +GLT  + 
Sbjct: 129 GFTNSFLASPIEHIRIRLQTQTGSGATAEFK-----GPIDCIKKLRVNGQLMRGLTPTML 183

Query: 305 KVVPSTAVSWLVYE 318
           +      V +L YE
Sbjct: 184 RESHGCGVYFLTYE 197

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 82/324 (25%), Positives = 126/324 (38%), Gaps = 40/324 (12%)

Query: 1   MSEVILPAIEEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAY 60
           MS    PAI + + + +++K       LAG I    + + + P + VK  +Q++   T Y
Sbjct: 1   MSVSAAPAIPQYS-VSDYMKFA-----LAGAIGCGSTHSSMVPIDVVKTRIQLEP--TVY 52

Query: 61  NKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKG--KG 118
           NKG+  +  Q+   E    L  G G   +      A +F  +E  KK  F +D  G    
Sbjct: 53  NKGMVGSFKQIIAGEGAGALLTGFGPTLLGYSIQGAFKFGGYEVFKK--FFIDNLGYDTA 110

Query: 119 EQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQT--ANLSKLSKSRASDIAKPPGVW 176
            +  N   + S A+    + +A  PL+  R RL  Q   AN                G+ 
Sbjct: 111 SRYKNSVYMGSAAMAEFLADIALCPLEATRIRLVSQPQFAN----------------GLV 154

Query: 177 KLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEF---MPSDENGNSSMRD 233
              S+   EEG I   Y G  P     +PY    F V+E+  EF       +   SS   
Sbjct: 155 GGFSRILKEEG-IGSFYSGFTPILFKQIPYNIAKFLVFERASEFYYGFAGPKEKLSSTST 213

Query: 234 SLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFK 293
           +L  L  G  +G  A  ++ P D L  +         +      S    L  + K  GF 
Sbjct: 214 TLLNLLSGLTAGLAAAIVSQPADTLLSKVNKTKKAPGQ------STVGLLAQLAKQLGFF 267

Query: 294 GYYKGLTANLFKVVPSTAVSWLVY 317
           G + GL   L  V   T++ + +Y
Sbjct: 268 GSFAGLPTRLVMVGTLTSLQFGIY 291

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 87/202 (43%), Gaps = 30/202 (14%)

Query: 36  ISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYS 95
           ++   + P E  +I L  Q     +  GL     ++ KEE I   + G      +  PY+
Sbjct: 128 LADIALCPLEATRIRLVSQPQ---FANGLVGGFSRILKEEGIGSFYSGFTPILFKQIPYN 184

Query: 96  AVQFVVFEGCKKHIFHVDTKGKGEQLNNWQ----RLFSGALCGGCSVVATYPLDLVRTRL 151
             +F+VFE  +   F+    G  E+L++       L SG   G  + + + P D +    
Sbjct: 185 IAKFLVFE--RASEFYYGFAGPKEKLSSTSTTLLNLLSGLTAGLAAAIVSQPADTL---- 238

Query: 152 SVQTANLSKLSKSRASDIAKPPGVWKL-LSKAYAEEGGIMGLYRGVWPTSLGIV-PYVAL 209
                 LSK++K++     K PG   + L    A++ G  G + G+ PT L +V    +L
Sbjct: 239 ------LSKVNKTK-----KAPGQSTVGLLAQLAKQLGFFGSFAGL-PTRLVMVGTLTSL 286

Query: 210 NFAVYEQLKEFM---PSDENGN 228
            F +Y  LK  +   P+ E G 
Sbjct: 287 QFGIYGSLKSTLGCPPTIEIGG 308

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 80/192 (41%), Gaps = 24/192 (12%)

Query: 129 SGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGG 188
           +GA+  G +  +  P+D+V+TR+ ++    +K             G+     +  A EG 
Sbjct: 23  AGAIGCGSTHSSMVPIDVVKTRIQLEPTVYNK-------------GMVGSFKQIIAGEGA 69

Query: 189 IMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMR--DSLYKLSMGAISGG 246
              L  G  PT LG     A  F  YE  K+F   +   +++ R  +S+Y +   A++  
Sbjct: 70  -GALLTGFGPTLLGYSIQGAFKFGGYEVFKKFFIDNLGYDTASRYKNSVY-MGSAAMAEF 127

Query: 247 VAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKV 306
           +A     P +  R R        N L   ++ +        K EG   +Y G T  LFK 
Sbjct: 128 LADIALCPLEATRIRLVSQPQFANGLVGGFSRIL-------KEEGIGSFYSGFTPILFKQ 180

Query: 307 VPSTAVSWLVYE 318
           +P     +LV+E
Sbjct: 181 IPYNIAKFLVFE 192

>Scas_687.15*
          Length = 328

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 75/331 (22%), Positives = 119/331 (35%), Gaps = 50/331 (15%)

Query: 18  FLKQ-DTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEEN 76
            LKQ D  +  LAG  A     T+  PFE +K   Q+   T       F+A+        
Sbjct: 2   LLKQTDVPIQILAGSAAAVFETTLTYPFEFLKTGFQLHRRTVGAKP--FEAL------RP 53

Query: 77  IKGLFRGNGLNCIRVFPYSAVQFVVFE-GCKKHIFHVDTKGKGEQLNNWQRLFSGALCGG 135
           IK  F G     +     ++V+F  F+  C+  I       K   L   + L +G L G 
Sbjct: 54  IKVYFAGCTALNLSAIVKTSVRFATFDKACQ--ILRDPNLPKDSLLKGPRLLLAGILTGA 111

Query: 136 CSVVATYPLDLVRTRLSVQTANLSK-----------LSKSRASDIAKPPGV-----WKLL 179
              +   P + V+  +   +  LS+           L K     +AKP  +     W+ +
Sbjct: 112 VESLCIIPFENVKVTMIENSLQLSESKPTEKEIAGTLKKKVTFHVAKPKQLSPQEQWRQV 171

Query: 180 SKAYAEEG------------GIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENG 227
              Y                G+ G  +G  PT    V    + F  Y  LK+ +   +  
Sbjct: 172 YSKYPSSNIFSVVKEIYLTRGLRGFAQGAMPTVFRQVSNSTVRFTAYTTLKQLISPTQPL 231

Query: 228 NSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIG 287
           N      +Y   +G  S      +T P D+++ R Q          + Y +  +    + 
Sbjct: 232 N-----EVYAFGIGLFSSCAVVALTQPIDVVKTRMQ-----SKTAHYFYKNSLNCAYRVF 281

Query: 288 KTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
             EG    +KG    LFKV  S  +S+ VY+
Sbjct: 282 VEEGMVSLWKGWLPRLFKVGLSGGISFGVYQ 312

>Kwal_23.3529
          Length = 395

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 53/185 (28%), Positives = 88/185 (47%), Gaps = 11/185 (5%)

Query: 22  DTNVAFLAGGIAGA-ISRTVVSPFERVKILLQVQSS------TTAYN-KGLFDAIGQVYK 73
           +  ++ L  G++G  +S  V  P E +K  LQ+Q         + YN + L DAI  + +
Sbjct: 178 NETLSHLTAGLSGDLVSSVVYVPSEVLKTRLQLQGCYNNPHFHSGYNYRNLRDAITAIVR 237

Query: 74  EENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALC 133
            E  + LF G      R  P+SA QF  +E  ++  F ++ K   + L+    L +GA  
Sbjct: 238 LEGWQTLFFGYKATLCRDLPFSAFQFAFYEKFRQWAFTLEGKTPSQDLSLLNELLTGAAA 297

Query: 134 GGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLY 193
           GG + + T P+D+++TR+  Q  +      +R   I     + K L+  Y  E G +G +
Sbjct: 298 GGLAGIITTPMDVIKTRIQTQMPSTVASDSTRLVRIEN--SLIKGLTAVYRSE-GTLGFF 354

Query: 194 RGVWP 198
            GV P
Sbjct: 355 SGVGP 359

 Score = 58.2 bits (139), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 77/163 (47%), Gaps = 12/163 (7%)

Query: 163 KSRASDIAKPPGVWKLLS---KAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKE 219
           K+R       P    ++S   K + EEG   GLY G     LG  P  A+ F  YE  K 
Sbjct: 110 KTRQQGAPNAPKYRNMISAYQKIFMEEGIRRGLYGGYTAAMLGSFPSAAIFFGTYELTKR 169

Query: 220 FMPSDENGNSSMRDSLYKLSMGAISGGVAQTITY-PFDLLRRRFQVLAMGGN---ELGFH 275
            +  D   N    ++L  L+ G +SG +  ++ Y P ++L+ R Q+     N     G++
Sbjct: 170 KLIDDWGVN----ETLSHLTAG-LSGDLVSSVVYVPSEVLKTRLQLQGCYNNPHFHSGYN 224

Query: 276 YNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
           Y ++ DA+  I + EG++  + G  A L + +P +A  +  YE
Sbjct: 225 YRNLRDAITAIVRLEGWQTLFFGYKATLCRDLPFSAFQFAFYE 267

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 72/289 (24%), Positives = 128/289 (44%), Gaps = 18/289 (6%)

Query: 39  TVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIK-GLFRGNGLNCIRVFPYSAV 97
           +V+   + VK   Q   +   Y + +  A  +++ EE I+ GL+ G     +  FP +A+
Sbjct: 101 SVMHSLDTVKTRQQGAPNAPKY-RNMISAYQKIFMEEGIRRGLYGGYTAAMLGSFPSAAI 159

Query: 98  QFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTAN 157
            F  +E  K+ +  +D  G  E L++     SG L    S V   P ++++TRL +Q   
Sbjct: 160 FFGTYELTKRKL--IDDWGVNETLSHLTAGLSGDLV---SSVVYVPSEVLKTRLQLQGCY 214

Query: 158 LSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQL 217
            +    S  +       +      A     G   L+ G   T    +P+ A  FA YE+ 
Sbjct: 215 NNPHFHSGYNYRNLRDAI-----TAIVRLEGWQTLFFGYKATLCRDLPFSAFQFAFYEKF 269

Query: 218 KEFMPSDENGNSSMRDSLY-KLSMGAISGGVAQTITYPFDLLRRRFQ-----VLAMGGNE 271
           +++  + E    S   SL  +L  GA +GG+A  IT P D+++ R Q      +A     
Sbjct: 270 RQWAFTLEGKTPSQDLSLLNELLTGAAAGGLAGIITTPMDVIKTRIQTQMPSTVASDSTR 329

Query: 272 LGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYELT 320
           L    NS+   L  + ++EG  G++ G+          +++  L+Y++T
Sbjct: 330 LVRIENSLIKGLTAVYRSEGTLGFFSGVGPRFIWTSIQSSIMLLLYQVT 378

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 73/307 (23%), Positives = 122/307 (39%), Gaps = 39/307 (12%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLN 87
            AG I G     V  PF+  K+ LQ  ++ T       + +  + K E +   ++G    
Sbjct: 39  FAGTIGGIAQVLVGQPFDTTKVRLQTATTRTTT----LEVLRNLVKNEGVFAFYKGALTP 94

Query: 88  CIRVFPYSAVQFVVFEGCKKHIFHVDTK------------GKGEQLNNWQRLFSGALCGG 135
            + V    +VQF V E  K+   + +               +   L   Q    G   G 
Sbjct: 95  LLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGV 154

Query: 136 CSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRG 195
            +     P++ +R RL  QT+N                G W  + K  A+ GG+M   RG
Sbjct: 155 VNSFLASPIEQIRIRLQTQTSNGGDREFK---------GPWDCIKKLKAQ-GGLM---RG 201

Query: 196 VWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSL--YKLSM-GAISGGVAQTIT 252
           ++PT +     +   F VYE L     + E G    R+ +  +KL + GA SG +     
Sbjct: 202 LFPTMIRAGHGLGTYFLVYEALV----AREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTV 257

Query: 253 YPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAV 312
           YP D+++   Q   +   +   + NS+     TI   EG + ++KG    + +  P    
Sbjct: 258 YPLDVVKSIIQNDDLRKPK---YKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGA 314

Query: 313 SWLVYEL 319
           ++L +EL
Sbjct: 315 TFLTFEL 321

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 86/198 (43%), Gaps = 20/198 (10%)

Query: 27  FLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYN--KGLFDAIGQVYKEENIKGLFRGN 84
           ++ G   G ++  + SP E+++I LQ Q+S       KG +D I ++  +    GL RG 
Sbjct: 146 YVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQ---GGLMRGL 202

Query: 85  GLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPL 144
               IR        F+V+E        + T     ++  W+    GA  G    +  YPL
Sbjct: 203 FPTMIRAGHGLGTYFLVYEALVAR--EIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPL 260

Query: 145 DLVRTRLSVQTANLSKLS-KSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGI 203
           D+V++   +Q  +L K   K+  S +AK           YA+EG I   ++G  PT +  
Sbjct: 261 DVVKS--IIQNDDLRKPKYKNSISYVAK---------TIYAKEG-IRAFFKGFGPTMVRS 308

Query: 204 VPYVALNFAVYEQLKEFM 221
            P     F  +E +  F+
Sbjct: 309 APVNGATFLTFELVMRFL 326

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/205 (22%), Positives = 77/205 (37%), Gaps = 34/205 (16%)

Query: 127 LFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEE 186
           +F+G + G   V+   P D  + RL   T   + L   R                   + 
Sbjct: 38  IFAGTIGGIAQVLVGQPFDTTKVRLQTATTRTTTLEVLR----------------NLVKN 81

Query: 187 GGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMP---SDENGNSSMRD---------S 234
            G+   Y+G     LG+   V++ F V E +K F     + +N N S +D          
Sbjct: 82  EGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLP 141

Query: 235 LYKLSMGAISGGVAQT-ITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFK 293
           L +  +  ++GGV  + +  P + +R R Q     G +  F     WD    I K +   
Sbjct: 142 LSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFK--GPWDC---IKKLKAQG 196

Query: 294 GYYKGLTANLFKVVPSTAVSWLVYE 318
           G  +GL   + +        +LVYE
Sbjct: 197 GLMRGLFPTMIRAGHGLGTYFLVYE 221

>Scas_715.45
          Length = 305

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 69/323 (21%), Positives = 131/323 (40%), Gaps = 46/323 (14%)

Query: 10  EEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIG 69
           + ++ ++ + K+      L G +A   + + V+P + +K  LQV  +    N      I 
Sbjct: 3   KTKSPIELYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNT---SGII 59

Query: 70  QVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKK----HIFHVDTKGKGEQLNNWQ 125
           Q+ K+E +  LF G G  CI      A ++  +E  K+    H+  V  +    +     
Sbjct: 60  QILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHL--VKDEATAYKYRTSI 117

Query: 126 RLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGV------WKLL 179
            L S A     + +   P + ++ +                     PP        WK  
Sbjct: 118 YLLSSATAEFFADIMLCPFEAIKVK----------------QQTTMPPWCNNVIEGWK-- 159

Query: 180 SKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEF----MPSDENGNSSMRDSL 235
            K YA+EG + G Y+G+ P     +PY    F  +E++ E     +P+ ++  S+++   
Sbjct: 160 -KMYAKEG-LNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQIS 217

Query: 236 YKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGY 295
                G ++G +   +++P D++  +        NE   +  S+  AL  I    GF G 
Sbjct: 218 VSFVGGYMAGILCAIVSHPADVMVSKIN------NERKVN-ESMNVALKRIYSRIGFVGL 270

Query: 296 YKGLTANLFKVVPSTAVSWLVYE 318
           + GL   +  +   T+  WL+Y+
Sbjct: 271 WNGLPVRILMIGTLTSFQWLIYD 293

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/206 (20%), Positives = 90/206 (43%), Gaps = 22/206 (10%)

Query: 20  KQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKG 79
           K  T++  L+   A   +  ++ PFE +K+  + Q++   +   + +   ++Y +E + G
Sbjct: 112 KYRTSIYLLSSATAEFFADIMLCPFEAIKV--KQQTTMPPWCNNVIEGWKKMYAKEGLNG 169

Query: 80  LFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQ--LNNWQRLFSGALCGG-- 135
            ++G      R  PY+  +F  FE   + I+      K E   L      F G    G  
Sbjct: 170 FYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGIL 229

Query: 136 CSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRG 195
           C++V ++P D++          +SK++  R  + +    + ++ S+      G +GL+ G
Sbjct: 230 CAIV-SHPADVM----------VSKINNERKVNESMNVALKRIYSRI-----GFVGLWNG 273

Query: 196 VWPTSLGIVPYVALNFAVYEQLKEFM 221
           +    L I    +  + +Y+  K ++
Sbjct: 274 LPVRILMIGTLTSFQWLIYDSFKAYV 299

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 67/279 (24%), Positives = 117/279 (41%), Gaps = 36/279 (12%)

Query: 30  GGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLNCI 89
           GG AG  +  V  P +  K+ LQ           LF  +  +   E + GL+ G     +
Sbjct: 20  GGAAGIFATMVTHPLDLAKVRLQAAPMP---KPTLFRMLESILANEGVVGLYSGLSAAVL 76

Query: 90  RVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRL-----FSGALCGGCSVVATYPL 144
           R   Y+ V+F  ++  K+++         EQL N   L     FSGA+ G     A    
Sbjct: 77  RQCTYTTVRFGAYDLLKENVI------PREQLTNMAYLLPCSMFSGAIGGLAGNFA---- 126

Query: 145 DLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIV 204
           D+V  R+   +A  +   ++  + I    GV+K+    Y  EGG+  L+ G  P  +  +
Sbjct: 127 DVVNIRMQNDSALEAAKRRNYKNAI---DGVYKI----YRYEGGLKTLFTGWKPNMVRGI 179

Query: 205 PYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQV 264
              A     Y+  K ++ +  + ++S   +   L+   ++G VA T+  P D+++ R   
Sbjct: 180 LMTASQVVTYDVFKNYLVTKLDFDAS--KNYTHLTASLLAGLVATTVCSPADVMKTRIM- 236

Query: 265 LAMGGNELGFHYNS---VWDALVTIGKTEGFKGYYKGLT 300
                N  G H  +   + DA+   G +  F+G+    T
Sbjct: 237 -----NGSGDHQPALKILADAVRKEGPSFMFRGWLPSFT 270

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 56/216 (25%), Positives = 95/216 (43%), Gaps = 28/216 (12%)

Query: 20  KQDTNVAFL--AGGIAGAISRTVVSPFERVKILLQVQSSTTAYN----KGLFDAIGQVYK 73
           +Q TN+A+L      +GAI     +  + V I +Q  S+  A      K   D + ++Y+
Sbjct: 100 EQLTNMAYLLPCSMFSGAIGGLAGNFADVVNIRMQNDSALEAAKRRNYKNAIDGVYKIYR 159

Query: 74  EEN-IKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGAL 132
            E  +K LF G   N +R    +A Q V ++  K ++    TK   +   N+  L +  L
Sbjct: 160 YEGGLKTLFTGWKPNMVRGILMTASQVVTYDVFKNYLV---TKLDFDASKNYTHLTASLL 216

Query: 133 CGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGL 192
            G  +     P D+++TR+               S   +P    K+L+ A  +EG    +
Sbjct: 217 AGLVATTVCSPADVMKTRIM------------NGSGDHQP--ALKILADAVRKEGPSF-M 261

Query: 193 YRGVWPTSLGIVPYVALNFAVYEQLKEF---MPSDE 225
           +RG  P+   + P+  L F   EQLK+    MP ++
Sbjct: 262 FRGWLPSFTRLGPFTMLIFFAIEQLKKHRVGMPKED 297

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 87/194 (44%), Gaps = 26/194 (13%)

Query: 130 GALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGI 189
           G   G  + + T+PLDL + RL  Q A + K            P ++++L    A EG +
Sbjct: 20  GGAAGIFATMVTHPLDLAKVRL--QAAPMPK------------PTLFRMLESILANEG-V 64

Query: 190 MGLYRGVWPTSLGIVPYVALNFAVYEQLKE-FMPSDENGNSS--MRDSLYKLSMGAISGG 246
           +GLY G+    L    Y  + F  Y+ LKE  +P ++  N +  +  S++  ++G ++G 
Sbjct: 65  VGLYSGLSAAVLRQCTYTTVRFGAYDLLKENVIPREQLTNMAYLLPCSMFSGAIGGLAGN 124

Query: 247 VAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTE-GFKGYYKGLTANLFK 305
            A       D++  R Q  +        +Y +  D +  I + E G K  + G   N+ +
Sbjct: 125 FA-------DVVNIRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVR 177

Query: 306 VVPSTAVSWLVYEL 319
            +  TA   + Y++
Sbjct: 178 GILMTASQVVTYDV 191

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/289 (21%), Positives = 114/289 (39%), Gaps = 20/289 (6%)

Query: 30  GGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLNCI 89
           GG AG  +     P +  K+ LQ   +       +   +  + K E I GL+ G   + +
Sbjct: 13  GGAAGIFAVMNTHPLDLTKVRLQ---AAPIPKPTIVQMLRSILKNEGIVGLYAGLSASLL 69

Query: 90  RVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRT 149
           R   Y+  +F +++  K+H+   D     +  N W  L +  + G    +A    DL+  
Sbjct: 70  RQCTYTTARFGMYDALKEHVIPRD-----KLTNMWYLLGASMVSGALGGLAGNFADLINI 124

Query: 150 RLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVAL 209
           R+  Q  +   L K R    A    V     K Y  EG       G  P  +  V   A 
Sbjct: 125 RM--QNDSALPLDKRRNYKNAIDGMV-----KIYKAEGAKSLFLTGWKPNMVRGVLMTAS 177

Query: 210 NFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGG 269
               Y+  K F+ +  N +     +   L+   ++G VA T+  P D+++    ++    
Sbjct: 178 QVVTYDMFKNFLVTKYNMDPKKNST--HLTSSLLAGFVATTVCSPADVIK---TIVMNAH 232

Query: 270 NELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
            + G +++S +  L+     EG    ++G   +  ++ P T + +   E
Sbjct: 233 KKPGHNHDSSFKILMEAINKEGPSFMFRGWVPSFTRLAPFTMLIFFAME 281

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 73/168 (43%), Gaps = 18/168 (10%)

Query: 62  KGLFDAIGQVYKEENIKGLF-RGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQ 120
           K   D + ++YK E  K LF  G   N +R    +A Q V ++  K  +    TK   + 
Sbjct: 141 KNAIDGMVKIYKAEGAKSLFLTGWKPNMVRGVLMTASQVVTYDMFKNFLV---TKYNMDP 197

Query: 121 LNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLS 180
             N   L S  L G  +     P D+++T   V  A+        +S        +K+L 
Sbjct: 198 KKNSTHLTSSLLAGFVATTVCSPADVIKT--IVMNAHKKPGHNHDSS--------FKILM 247

Query: 181 KAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEF---MPSDE 225
           +A  +EG    ++RG  P+   + P+  L F   EQLK++   MP +E
Sbjct: 248 EAINKEGPSF-MFRGWVPSFTRLAPFTMLIFFAMEQLKKYRVGMPKEE 294

>Kwal_33.15597
          Length = 305

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 72/297 (24%), Positives = 118/297 (39%), Gaps = 34/297 (11%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLN 87
           LAG I    + + + P + VK  +Q++   T YNKG+  +  Q+   E    L  G G  
Sbjct: 18  LAGAIGCGTTHSAMVPIDVVKTRIQLEP--TVYNKGMISSFKQIISSEGAGALLTGFGPT 75

Query: 88  CIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLF--SGALCGGCSVVATYPLD 145
            +      + +F  +E  KK    +DT G  + +N    ++  S A+    + +A  PL+
Sbjct: 76  LLGYSLQGSFKFGGYEVFKK--LFIDTLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLE 133

Query: 146 LVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVP 205
             R RL  Q    + L            G  ++L     +E G+   Y G  P     +P
Sbjct: 134 ATRIRLVSQPTFANGLVG----------GFSRIL-----KEEGLSSFYNGFTPILFKQIP 178

Query: 206 YVALNFAVYEQLKEF---MPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRF 262
           Y    F V+E+  E    M   +   S+   +   L  G  +G  A  ++ P D L  + 
Sbjct: 179 YNIAKFLVFERAAEVYFGMAGPKETLSTSTTTGLNLLSGLTAGLAAAIVSQPADTLLSKV 238

Query: 263 QVL--AMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVY 317
                A G + +G         L  + K  GF G + GL   L  V   T++ + +Y
Sbjct: 239 NKAKKAPGQSTIGL--------LGQLAKELGFVGSFAGLPTRLVMVGTLTSLQFGIY 287

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 76/193 (39%), Gaps = 24/193 (12%)

Query: 128 FSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEG 187
            +GA+  G +  A  P+D+V+TR+ ++    +K   S    I    G   LL+       
Sbjct: 18  LAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAGALLT------- 70

Query: 188 GIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSM--RDSLYKLSMGAISG 245
                  G  PT LG     +  F  YE  K+        + ++  ++S+Y +   AI+ 
Sbjct: 71  -------GFGPTLLGYSLQGSFKFGGYEVFKKLFIDTLGYDQAVNYKNSIY-IGSAAIAE 122

Query: 246 GVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFK 305
             A     P +  R R        N L   ++ +        K EG   +Y G T  LFK
Sbjct: 123 FFADIALCPLEATRIRLVSQPTFANGLVGGFSRIL-------KEEGLSSFYNGFTPILFK 175

Query: 306 VVPSTAVSWLVYE 318
            +P     +LV+E
Sbjct: 176 QIPYNIAKFLVFE 188

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 81/192 (42%), Gaps = 23/192 (11%)

Query: 32  IAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLNCIRV 91
           IA   +   + P E  +I L  Q +   +  GL     ++ KEE +   + G      + 
Sbjct: 120 IAEFFADIALCPLEATRIRLVSQPT---FANGLVGGFSRILKEEGLSSFYNGFTPILFKQ 176

Query: 92  FPYSAVQFVVFEGCKKHIFHV--DTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRT 149
            PY+  +F+VFE   +  F +    +           L SG   G  + + + P D +  
Sbjct: 177 IPYNIAKFLVFERAAEVYFGMAGPKETLSTSTTTGLNLLSGLTAGLAAAIVSQPADTL-- 234

Query: 150 RLSVQTANLSKLSKSRASDIAKPPGVWKL-LSKAYAEEGGIMGLYRGVWPTSLGIV-PYV 207
                   LSK++K++     K PG   + L    A+E G +G + G+ PT L +V    
Sbjct: 235 --------LSKVNKAK-----KAPGQSTIGLLGQLAKELGFVGSFAGL-PTRLVMVGTLT 280

Query: 208 ALNFAVYEQLKE 219
           +L F +Y  LK+
Sbjct: 281 SLQFGIYGSLKK 292

>KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyces
           cerevisiae YPR128c, start by similarity
          Length = 355

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 55/253 (21%), Positives = 103/253 (40%), Gaps = 28/253 (11%)

Query: 62  KGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHV-DTKGKGEQ 120
           K   D I +VY+ E   GL+ G   + +  F  S   F  +   ++H F V   KG+  +
Sbjct: 88  KHALDVIVKVYRNEGFGGLYHGLSASLLGTFIQSFSYFFWYTLIRRHYFRVKKVKGEAAR 147

Query: 121 LNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLS 180
            +  + L    L    S + T P+++V T+   +                +    +K ++
Sbjct: 148 FSTIEELLLSMLAAATSQLFTNPINIVSTKQQTRRG-------------LEGDNSFKAIA 194

Query: 181 KAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLS- 239
           K   +E GI G ++ +   SL +    ++ +A  E+LK+ +   E     + DS  +L  
Sbjct: 195 KEVYDEDGITGFWKSL-KVSLVLTINPSITYASAEKLKDILYHVEWNAKDLNDSSLQLKP 253

Query: 240 -----MGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKG 294
                +G +S  ++  +T+P  + +   Q            + S  + L  + + EG   
Sbjct: 254 GQNFLIGVLSKIISTCLTHPLIVAKASLQ-------RSSSKFTSFQEVLTYLYRHEGAHA 306

Query: 295 YYKGLTANLFKVV 307
            +KGL   L K V
Sbjct: 307 LWKGLLPQLTKGV 319

 Score = 29.3 bits (64), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 276 YNSVWDALVTIGKTEGFKGYYKGLTANLF 304
           Y    D +V + + EGF G Y GL+A+L 
Sbjct: 87  YKHALDVIVKVYRNEGFGGLYHGLSASLL 115

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 73/299 (24%), Positives = 116/299 (38%), Gaps = 38/299 (12%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLN 87
           LAG I    + + + P + VK  +Q++   T YNKG+  +  Q+   E    L  G G  
Sbjct: 18  LAGAIGCGTTHSAMVPIDVVKTRIQLEP--TVYNKGMISSFKQIISSEGAGALLTGFGPT 75

Query: 88  CIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLF--SGALCGGCSVVATYPLD 145
            +      + +F  +E  KK    +D  G  + +N    ++  S A+    + +A  PL+
Sbjct: 76  LLGYSLQGSFKFGGYEVFKK--LFIDVLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLE 133

Query: 146 LVRTRLSVQT--ANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGI 203
             R RL  Q   AN                G+    S+   EEG     Y G  P     
Sbjct: 134 ATRIRLVSQPTFAN----------------GLVGGFSRILKEEGA-GSFYNGFTPILFKQ 176

Query: 204 VPYVALNFAVYEQLKEF---MPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRR 260
           +PY    F V+E+  E    M   +   S+   +   L  G  +G  A  ++ P D L  
Sbjct: 177 IPYNIAKFLVFERAAEVYFGMAGPKESLSTASTTGINLLSGLTAGLAAAIVSQPADTLLS 236

Query: 261 RFQVL--AMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVY 317
           +      A G + +G         L  + K  GF G + GL   L  V   T++ + +Y
Sbjct: 237 KVNKTKKAPGQSTIGL--------LAQLAKQLGFVGSFAGLPTRLVMVGTLTSLQFGIY 287

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 82/203 (40%), Gaps = 29/203 (14%)

Query: 121 LNNWQRL-FSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLL 179
           L+++ +   +GA+  G +  A  P+D+V+TR+ ++    +K   S    I    G   LL
Sbjct: 10  LSDYAKFALAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAGALL 69

Query: 180 SKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEF----MPSDENGNSSMRDSL 235
           +              G  PT LG     +  F  YE  K+     +  D+  N   ++S+
Sbjct: 70  T--------------GFGPTLLGYSLQGSFKFGGYEVFKKLFIDVLGYDQAVN--YKNSI 113

Query: 236 YKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGY 295
           Y +   AI+   A     P +  R R        N L   ++ +        K EG   +
Sbjct: 114 Y-IGSAAIAEFFADIALCPLEATRIRLVSQPTFANGLVGGFSRIL-------KEEGAGSF 165

Query: 296 YKGLTANLFKVVPSTAVSWLVYE 318
           Y G T  LFK +P     +LV+E
Sbjct: 166 YNGFTPILFKQIPYNIAKFLVFE 188

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 70/295 (23%), Positives = 112/295 (37%), Gaps = 45/295 (15%)

Query: 39  TVVSPFERVKILLQVQSSTTAYNKGLF----DAIGQVYKEENIKGLFRGNGLNCIRVFPY 94
           T  +P E VK  LQ+Q    A    L+     A+  +Y+ E ++GL    GL C   + Y
Sbjct: 27  TFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGL--QQGLAC--AYAY 82

Query: 95  SAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATY----------PL 144
                ++  G +  ++       G  + + +R +  A     +               PL
Sbjct: 83  Q----ILLNGSRLGLYDPLRAALGGCVLSDRRTYGTAALAVNATAGAAAGMIGAALGSPL 138

Query: 145 DLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIV 204
            LV+TR+         L+  R   +   PG       A  ++ G+ GLY+GV    L   
Sbjct: 139 QLVKTRMQA-------LAPRRVPPL---PGRMGRRLVALFKDRGVRGLYQGVDAALLRTG 188

Query: 205 PYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITY-PFDLLRRRFQ 263
              A+  AVY   KE +      +  + D +   ++ +    VA  I   PFD+   R  
Sbjct: 189 VGSAVQLAVYSHAKEAL------SRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMY 242

Query: 264 VLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
                 +  G  Y    D L    + EGF   YKG  A L ++ P T +   + E
Sbjct: 243 ------HHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLME 291

 Score = 35.4 bits (80), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 63/164 (38%), Gaps = 24/164 (14%)

Query: 71  VYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIF-HVDTKGKGEQLNNWQRLFS 129
           ++K+  ++GL++G     +R    SAVQ  V+   K+ +  HV     G  L       S
Sbjct: 167 LFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVP---DGMALYTLASALS 223

Query: 130 G-ALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGG 188
             A+C     +A  P D+  TR+      L +             G    L K   +EG 
Sbjct: 224 SVAVC-----IAMNPFDVAMTRMYHHRGGLYR-------------GPLDCLCKTVRQEG- 264

Query: 189 IMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMR 232
              LY+G     L I P+  L   + EQ    +   EN    +R
Sbjct: 265 FSALYKGHLAQLLRIAPHTILCLTLMEQALRVVRLVENRLPQIR 308

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 90/215 (41%), Gaps = 28/215 (13%)

Query: 111 HVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIA 170
           HV T        N + L +GA+ G C+V+  +P DL++ R     A+             
Sbjct: 35  HVGTPKSNALYENAKSLAAGAVGGVCAVLTGHPFDLLKVRCQSNQAS------------G 82

Query: 171 KPPGVWKLLSKAYAEEG-----GIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDE 225
               V K+L +A A+ G      + G Y+GV P  LG+ P  A++F  Y+  K+ +    
Sbjct: 83  TVDAVRKILVEARAQSGLSAVNMMRGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLV--TW 140

Query: 226 NGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVT 285
           N NS    +    + G IS      +  P + ++   Q  +          +S+  A   
Sbjct: 141 NDNSGKLTTAQLATAGFISAIPTTLVMAPTERVKVVLQTQS---------NHSLGSAAKH 191

Query: 286 IGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYELT 320
           I  T G +  ++G  A L +  P +A+ +  YE T
Sbjct: 192 ILATGGVRSLFRGSLATLARDGPGSALYFASYEAT 226

 Score = 50.4 bits (119), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 71/326 (21%), Positives = 127/326 (38%), Gaps = 49/326 (15%)

Query: 7   PAIEEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFD 66
           P++       N L ++   +  AG + G  +     PF+ +K+  Q   ++     G  D
Sbjct: 32  PSVHVGTPKSNALYENAK-SLAAGAVGGVCAVLTGHPFDLLKVRCQSNQAS-----GTVD 85

Query: 67  AIGQVYKEEN----------IKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKG 116
           A+ ++  E            ++G ++G     + V P  AV F  ++  KK +   D  G
Sbjct: 86  AVRKILVEARAQSGLSAVNMMRGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTWNDNSG 145

Query: 117 KGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVW 176
           K   L   Q   +G +    + +   P +  R ++ +QT +   L  +            
Sbjct: 146 K---LTTAQLATAGFISAIPTTLVMAPTE--RVKVVLQTQSNHSLGSA------------ 188

Query: 177 KLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNS-SMRDSL 235
              +K     GG+  L+RG   T     P  AL FA YE  K ++ +    N  S+++  
Sbjct: 189 ---AKHILATGGVRSLFRGSLATLARDGPGSALYFASYEATKAYLNARSGTNELSIKNVC 245

Query: 236 YKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTE-GFKG 294
               M  +S  V     +P D ++   Q              ++ +A   I  T  G KG
Sbjct: 246 LAGGMAGVSMWVG---VFPIDTIKTELQS--------SNTRQTMMEATRKIYNTRGGIKG 294

Query: 295 YYKGLTANLFKVVPSTAVSWLVYELT 320
           ++ G+   L +  P+ A ++L  ELT
Sbjct: 295 FFPGIGPALLRSFPANAATFLGVELT 320

>Scas_702.10
          Length = 302

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 71/298 (23%), Positives = 119/298 (39%), Gaps = 41/298 (13%)

Query: 30  GGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLNCI 89
           GG AG  +  +  P +  K+ LQ   +       L   +  + + EN+ GL+ G     +
Sbjct: 16  GGAAGIFACVMTHPLDLAKVRLQ---AAPLPKPTLGRMLTTILRNENVMGLYSGLSAAVL 72

Query: 90  RVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRL-----FSGALCGGCSVVATYPL 144
           R   Y+ V+F  ++  K+++           +N+   L     FSGA+ G     A    
Sbjct: 73  RQCTYTTVRFGAYDLMKENLI------PQGHINDMVYLLPCSMFSGAIGGLVGNFA---- 122

Query: 145 DLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIV 204
           D+V  R+   +A   +L ++  + I    GV+K+    Y  EGGI  L  G  P  +  V
Sbjct: 123 DVVNIRMQNDSALKPELRRNYRNAID---GVYKI----YMHEGGIKTLLTGWKPNMVRGV 175

Query: 205 PYVALNFAVYEQLKEFMPS----DENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRR 260
              A     Y+  K ++ +    D   NS+       LS   ++G VA TI  P D+++ 
Sbjct: 176 LMTASQVVTYDVFKNYLVTKLSFDPKKNST------HLSASLLAGLVATTICSPADVIKT 229

Query: 261 RFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
           R        N       S    L +  K EG    ++G      ++ P T + +   E
Sbjct: 230 RIM------NAHKTESESAIKILTSAIKKEGPSFMFRGWLPIFTRLGPFTMLIFFAIE 281

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 80/192 (41%), Gaps = 22/192 (11%)

Query: 33  AGAISRTVVSPFERVKILLQVQSSTTA-YNKGLFDAIGQVYK----EENIKGLFRGNGLN 87
           +GAI   V +  + V I +Q  S+      +   +AI  VYK    E  IK L  G   N
Sbjct: 111 SGAIGGLVGNFADVVNIRMQNDSALKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKPN 170

Query: 88  CIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLV 147
            +R    +A Q V ++  K ++    TK   +   N   L +  L G  +     P D++
Sbjct: 171 MVRGVLMTASQVVTYDVFKNYLV---TKLSFDPKKNSTHLSASLLAGLVATTICSPADVI 227

Query: 148 RTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYV 207
           +TR+     N  K     A          K+L+ A  +EG    ++RG  P    + P+ 
Sbjct: 228 KTRI----MNAHKTESESA---------IKILTSAIKKEGPSF-MFRGWLPIFTRLGPFT 273

Query: 208 ALNFAVYEQLKE 219
            L F   EQLK+
Sbjct: 274 MLIFFAIEQLKK 285

 Score = 36.6 bits (83), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 35/79 (44%), Gaps = 7/79 (8%)

Query: 241 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLT 300
           G  +G  A  +T+P DL + R Q   +    LG         L TI + E   G Y GL+
Sbjct: 16  GGAAGIFACVMTHPLDLAKVRLQAAPLPKPTLG-------RMLTTILRNENVMGLYSGLS 68

Query: 301 ANLFKVVPSTAVSWLVYEL 319
           A + +    T V +  Y+L
Sbjct: 69  AAVLRQCTYTTVRFGAYDL 87

>Scas_673.17
          Length = 314

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 72/314 (22%), Positives = 123/314 (39%), Gaps = 34/314 (10%)

Query: 11  EENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQ 70
           + +++ ++   D     LAG I    + + + P + VK  +Q++   T YNKG+  +  +
Sbjct: 8   DAHKIPDYAASDYFKFALAGAIGCGTTHSSLVPVDVVKTRIQLEP--TVYNKGMVGSFKK 65

Query: 71  VYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKG--KGEQLNNWQRLF 128
           +  +E    L  G G   +      A +F  +E  KK    +DT G        N   + 
Sbjct: 66  IIADEGAGALLTGFGPTLLGYSVQGAFKFGGYEVFKK--LSIDTIGYENAVHYKNSVYMG 123

Query: 129 SGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGG 188
           S A+    + +A  PL+  R RL  Q    + L            G  ++L     +E G
Sbjct: 124 SAAVAEFLADIALCPLEATRIRLVSQPTFANGLVG----------GFSRIL-----KEEG 168

Query: 189 IMGLYRGVWPTSLGIVPYVALNFAVYEQLKEF---MPSDENGNSSMRDSLYKLSMGAISG 245
           +   Y G  P     +PY    F V+E+  E    +   +   S M ++   L  G  +G
Sbjct: 169 VGSFYSGFTPILFKQIPYNIAKFLVFERASEVYYGIVGAKETLSDMTNTGINLLSGLTAG 228

Query: 246 GVAQTITYPFDLLRRRFQVL--AMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANL 303
             A  ++ P D L  +      A G + +G         L  + K  G  G + GL   L
Sbjct: 229 FAAAFVSQPADTLLSKVNKTKKAPGQSTIGL--------LAQLAKQLGVIGSFAGLPTRL 280

Query: 304 FKVVPSTAVSWLVY 317
             V   T++ + +Y
Sbjct: 281 IMVGTLTSLQFAIY 294

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 91/209 (43%), Gaps = 27/209 (12%)

Query: 16  KNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEE 75
           +N +    +V   +  +A  ++   + P E  +I L  Q +   +  GL     ++ KEE
Sbjct: 111 ENAVHYKNSVYMGSAAVAEFLADIALCPLEATRIRLVSQPT---FANGLVGGFSRILKEE 167

Query: 76  NIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQL----NNWQRLFSGA 131
            +   + G      +  PY+  +F+VFE   +  + +   G  E L    N    L SG 
Sbjct: 168 GVGSFYSGFTPILFKQIPYNIAKFLVFERASEVYYGI--VGAKETLSDMTNTGINLLSGL 225

Query: 132 LCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKL-LSKAYAEEGGIM 190
             G  +   + P D +          LSK++K++     K PG   + L    A++ G++
Sbjct: 226 TAGFAAAFVSQPADTL----------LSKVNKTK-----KAPGQSTIGLLAQLAKQLGVI 270

Query: 191 GLYRGVWPTSLGIV-PYVALNFAVYEQLK 218
           G + G+ PT L +V    +L FA+Y  LK
Sbjct: 271 GSFAGL-PTRLIMVGTLTSLQFAIYGSLK 298

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 82/198 (41%), Gaps = 26/198 (13%)

Query: 124 WQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAY 183
           ++   +GA+  G +  +  P+D+V+TR+ ++    +K             G+     K  
Sbjct: 21  FKFALAGAIGCGTTHSSLVPVDVVKTRIQLEPTVYNK-------------GMVGSFKKII 67

Query: 184 AEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSM---RDSLYKLSM 240
           A+EG    L  G  PT LG     A  F  YE  K+ +  D  G  +    ++S+Y +  
Sbjct: 68  ADEGA-GALLTGFGPTLLGYSVQGAFKFGGYEVFKK-LSIDTIGYENAVHYKNSVY-MGS 124

Query: 241 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLT 300
            A++  +A     P +  R R        N L   ++ +        K EG   +Y G T
Sbjct: 125 AAVAEFLADIALCPLEATRIRLVSQPTFANGLVGGFSRIL-------KEEGVGSFYSGFT 177

Query: 301 ANLFKVVPSTAVSWLVYE 318
             LFK +P     +LV+E
Sbjct: 178 PILFKQIPYNIAKFLVFE 195

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 82/196 (41%), Gaps = 29/196 (14%)

Query: 26  AFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNG 85
           + ++G  AG  +  V  P + +K  LQ              A G  +     +G++RG G
Sbjct: 8   SLVSGAAAGTSTDVVFFPIDTLKTRLQ--------------AKGGFFHNGGYRGIYRGLG 53

Query: 86  LNCIRVFPYSAVQFVVFEGCKKHIFHVDTK-GKGEQLNN-WQRLFSGALCGGCSVVATYP 143
              +   P +++ FV ++  K+ +  V  +    EQL      + S +L    + +   P
Sbjct: 54  SAVVASAPGASLFFVTYDSMKQQLRPVMGRWTASEQLAEVLTHMLSSSLGEMSACLVRVP 113

Query: 144 LDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGI 203
            ++++ R      N S L   R            L+ +    EG + GLYRG W T +  
Sbjct: 114 AEVIKQRTQTHHTN-SSLQTLR------------LILRDPTGEGVVRGLYRGWWTTIMRE 160

Query: 204 VPYVALNFAVYEQLKE 219
           +P+  + F +YE LK+
Sbjct: 161 IPFTCIQFPLYEYLKK 176

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 50.1 bits (118), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 54/213 (25%), Positives = 91/213 (42%), Gaps = 33/213 (15%)

Query: 12  ENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQV 71
           E+Q  + L    + +F  G I+  + R    P E +K     Q + T         +  +
Sbjct: 90  EDQTADTLSHMVSSSF--GEISACMVRV---PAEVIK-----QRTQTHRTNSSLQTLQAL 139

Query: 72  YKEENIKGL----FRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRL 127
            + EN +GL    +RG     +R  P++ +QF ++E  KK    V  K   E+   WQ  
Sbjct: 140 LRNENGEGLRRNLYRGWSTTIMREIPFTCIQFPLYEYMKKRWAEVQGK---ERAAPWQGS 196

Query: 128 FSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEG 187
             G + GG +  AT PLD+++TR+ +   ++S L                 L+K   +E 
Sbjct: 197 VCGCIAGGIAAAATTPLDVLKTRIMLHHKSVSALH----------------LAKTMLQEE 240

Query: 188 GIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEF 220
           G+   + GV P ++ I    A+   VYE +   
Sbjct: 241 GVKVFFSGVGPRTMWISAGGAIFLGVYETVHSL 273

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 43/204 (21%), Positives = 79/204 (38%), Gaps = 50/204 (24%)

Query: 127 LFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEE 186
           L SGA  G  + +A +P+D ++TRL  +                            +   
Sbjct: 10  LVSGAAAGTSTDLAFFPIDTLKTRLQAK--------------------------GGFFAN 43

Query: 187 GGIMGLYRGVWPTSLGIVPYVALNFAVYEQLK--------EFMPSDENGNSSMRDSLYKL 238
           GG  G+YRG+    +   P  +L F  Y+ +K        + +P  E+  +     +   
Sbjct: 44  GGYKGVYRGLGSAVVASAPSASLFFVAYDSMKCWSRPVIGQLLPKGEDQTADTLSHMVSS 103

Query: 239 SMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKG---- 294
           S G IS   A  +  P +++++R Q             NS    L  + + E  +G    
Sbjct: 104 SFGEIS---ACMVRVPAEVIKQRTQT---------HRTNSSLQTLQALLRNENGEGLRRN 151

Query: 295 YYKGLTANLFKVVPSTAVSWLVYE 318
            Y+G +  + + +P T + + +YE
Sbjct: 152 LYRGWSTTIMREIPFTCIQFPLYE 175

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 79/198 (39%), Gaps = 31/198 (15%)

Query: 26  AFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNG 85
           + ++G  AG  +     P + +K  LQ         KG F A G        KG++RG G
Sbjct: 9   SLVSGAAAGTSTDLAFFPIDTLKTRLQA--------KGGFFANG------GYKGVYRGLG 54

Query: 86  LNCIRVFPYSAVQFVVFEGCK----KHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVAT 141
              +   P +++ FV ++  K      I  +  KG+ +  +    + S +     + +  
Sbjct: 55  SAVVASAPSASLFFVAYDSMKCWSRPVIGQLLPKGEDQTADTLSHMVSSSFGEISACMVR 114

Query: 142 YPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSL 201
            P ++++ R      N S L   +A            L +    EG    LYRG   T +
Sbjct: 115 VPAEVIKQRTQTHRTN-SSLQTLQA------------LLRNENGEGLRRNLYRGWSTTIM 161

Query: 202 GIVPYVALNFAVYEQLKE 219
             +P+  + F +YE +K+
Sbjct: 162 REIPFTCIQFPLYEYMKK 179

>Kwal_23.5757
          Length = 307

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 60/298 (20%), Positives = 110/298 (36%), Gaps = 33/298 (11%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLN 87
           L G +A   + + V+P + VK   QV +S    N    D   Q+ + E    +F G G  
Sbjct: 24  LGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSN---LDGWRQIVRSEGATKVFTGVGAT 80

Query: 88  CIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLV 147
            I      A ++  +E  K     + +            L + A     + +   P + +
Sbjct: 81  AIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAI 140

Query: 148 RTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMG---LYRGVWPTSLGIV 204
           + R                   A PP   + +  AY++  G  G   LY+G+ P     +
Sbjct: 141 KVR----------------QQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQI 184

Query: 205 PYVALNFAVYEQLKEF----MPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRR 260
           PY    F  +E++ E     +P+ +   S +       + G ++G +   +++P D++  
Sbjct: 185 PYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVS 244

Query: 261 RFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
           +       G        S   A   I    GF G + GL   +  +   T+  WL+Y+
Sbjct: 245 KVNNERKSGE-------STLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYD 295

>Kwal_47.19228
          Length = 281

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 56/131 (42%), Gaps = 10/131 (7%)

Query: 188 GIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGV 247
           GI G  +G  PT +      A+ F  Y  LK+ +  ++  N       Y  ++G IS   
Sbjct: 143 GIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMISPNKPLNE-----YYAFALGFISSCA 197

Query: 248 AQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVV 307
              +T P D+++ R Q      N     Y +  +    I   EGF  ++KG    L KV 
Sbjct: 198 VVAVTQPIDVIKTRMQSKYTWSN-----YKNSLNCAYRIFVEEGFTKFWKGWAPRLMKVG 252

Query: 308 PSTAVSWLVYE 318
            S  VS+ VY+
Sbjct: 253 LSGGVSFGVYQ 263

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 44/92 (47%), Gaps = 8/92 (8%)

Query: 61  NKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQ 120
           ++     + ++Y+   I+G  +G     IR    SAV+F  +   K+ I         + 
Sbjct: 128 SRQFLTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMI------SPNKP 181

Query: 121 LNNWQRLFSGALCGGCSVVA-TYPLDLVRTRL 151
           LN +   F+      C+VVA T P+D+++TR+
Sbjct: 182 LNEYY-AFALGFISSCAVVAVTQPIDVIKTRM 212

>YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to C. elegans mitochondrial
           phosphate carrier protein [903 bp, 300 aa]
          Length = 300

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/319 (18%), Positives = 119/319 (37%), Gaps = 45/319 (14%)

Query: 10  EEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIG 69
           ++  +++ + K+      L G IA   + + ++P + VK  LQV       N        
Sbjct: 5   KQPRKIQLYTKEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSN---LQGFR 61

Query: 70  QVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFS 129
           ++   E  K ++ G G                F G     + +   GK      ++ L+S
Sbjct: 62  KIIANEGWKKVYTGFG--------------ATFVG-----YSLQGAGKYGGYEYFKHLYS 102

Query: 130 GALCGGCSV------VATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAY 183
             L  G +V       A +  D++                   +++      WK   K Y
Sbjct: 103 SWLSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDG---WK---KMY 156

Query: 184 AEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSM--- 240
           AE GG+   Y+G+ P     +PY    F  +E++ + + S         ++L ++S+   
Sbjct: 157 AESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFV 216

Query: 241 -GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGL 299
            G ++G +   +++P D++  +          +      ++  +       GF G + GL
Sbjct: 217 GGYLAGILCAAVSHPADVMVSKINSERKANESMSVASKRIYQKI-------GFTGLWNGL 269

Query: 300 TANLFKVVPSTAVSWLVYE 318
              +  +   T+  WL+Y+
Sbjct: 270 MVRIVMIGTLTSFQWLIYD 288

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 44/210 (20%), Positives = 93/210 (44%), Gaps = 23/210 (10%)

Query: 17  NFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEEN 76
           ++L     V  +A   A  ++  ++ PFE +K+  + Q++   +   + D   ++Y E  
Sbjct: 103 SWLSPGVTVYLMASATAEFLADIMLCPFEAIKV--KQQTTMPPFCNNVVDGWKKMYAESG 160

Query: 77  -IKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRL----FSGA 131
            +K  ++G      R  PY+  +F  FE   + I+ V  K K E++N  Q++      G 
Sbjct: 161 GMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPK-KKEEMNALQQISVSFVGGY 219

Query: 132 LCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMG 191
           L G      ++P D++          +SK++  R ++ +       + SK   ++ G  G
Sbjct: 220 LAGILCAAVSHPADVM----------VSKINSERKANESM-----SVASKRIYQKIGFTG 264

Query: 192 LYRGVWPTSLGIVPYVALNFAVYEQLKEFM 221
           L+ G+    + I    +  + +Y+  K ++
Sbjct: 265 LWNGLMVRIVMIGTLTSFQWLIYDSFKAYV 294

 Score = 31.2 bits (69), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 23/106 (21%), Positives = 54/106 (50%), Gaps = 9/106 (8%)

Query: 5   ILPAIEEE-NQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKG 63
           +LP  +EE N L     Q  +V+F+ G +AG +   V  P +   +++   +S    N+ 
Sbjct: 197 VLPKKKEEMNAL-----QQISVSFVGGYLAGILCAAVSHPAD---VMVSKINSERKANES 248

Query: 64  LFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHI 109
           +  A  ++Y++    GL+ G  +  + +   ++ Q+++++  K ++
Sbjct: 249 MSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYV 294

>Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement
          Length = 302

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 61/295 (20%), Positives = 114/295 (38%), Gaps = 28/295 (9%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLN 87
           L G +A   + + V+P + VK  LQV       N    D    + + E +  +F G G  
Sbjct: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSN---LDGWKTIVRSEGLSKVFTGVGAT 76

Query: 88  CIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLV 147
            I      A ++  +E  K+   ++ +     +      L + A     + +   P + +
Sbjct: 77  FIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAI 136

Query: 148 RTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYV 207
           + +   Q   +    K+           W   SK  A EG + GLY+G+ P     +PY 
Sbjct: 137 KVK---QQTTIPPFCKNFLEG-------W---SKITAAEG-LSGLYKGITPLWCRQIPYT 182

Query: 208 ALNFAVYEQLKEF----MPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQ 263
              F  +E++ E     +P  +   S  +        G ++G +   +++P D++  +  
Sbjct: 183 MCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVN 242

Query: 264 VLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
                G        S+ +A   I    GF G + GL   +F +   T+  WL+Y+
Sbjct: 243 ADRKQG-------ESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYD 290

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/136 (21%), Positives = 61/136 (44%), Gaps = 5/136 (3%)

Query: 20  KQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKG 79
           +  T V   A   A  ++  ++ P+E +K+  + Q++   + K   +   ++   E + G
Sbjct: 109 RHRTAVYLCASASAEFLADILLCPWEAIKV--KQQTTIPPFCKNFLEGWSKITAAEGLSG 166

Query: 80  LFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQ---RLFSGALCGGC 136
           L++G      R  PY+  +F  FE   + I+    + K E   + Q       G L G  
Sbjct: 167 LYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGIL 226

Query: 137 SVVATYPLDLVRTRLS 152
             V ++P D++ ++++
Sbjct: 227 CAVVSHPADVMVSKVN 242

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 77/191 (40%), Gaps = 21/191 (10%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLN 87
           LAG I   I+ + + P + VK  +Q++   T YNKG+  +  Q+   E    L  G G  
Sbjct: 18  LAGAIGCGITHSSMVPIDVVKTRIQLEP--TVYNKGMVSSFKQIISSEGAGALLTGFGPT 75

Query: 88  CIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLF--SGALCGGCSVVATYPLD 145
            +      + +F  +E  KK    +D  G    +N    ++  S A+    + +A  PL+
Sbjct: 76  LLGYSLQGSFKFGGYELFKK--LAIDNMGYDNAVNYKNTIYIGSAAIAEFFADIALCPLE 133

Query: 146 LVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVP 205
             R RL  Q    +              G++   S+   EE G+   Y G  P     +P
Sbjct: 134 ATRIRLVSQPTFAN--------------GLFGGFSRILKEE-GVGSFYNGFTPILFKQIP 178

Query: 206 YVALNFAVYEQ 216
           Y    F V+E 
Sbjct: 179 YNIAKFFVFEH 189

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 76/192 (39%), Gaps = 24/192 (12%)

Query: 129 SGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGG 188
           +GA+  G +  +  P+D+V+TR+ ++    +K   S    I    G   LL+        
Sbjct: 19  AGAIGCGITHSSMVPIDVVKTRIQLEPTVYNKGMVSSFKQIISSEGAGALLT-------- 70

Query: 189 IMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSM--RDSLYKLSMGAISGG 246
                 G  PT LG     +  F  YE  K+    +   ++++  ++++Y +   AI+  
Sbjct: 71  ------GFGPTLLGYSLQGSFKFGGYELFKKLAIDNMGYDNAVNYKNTIY-IGSAAIAEF 123

Query: 247 VAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKV 306
            A     P +  R R        N L       +     I K EG   +Y G T  LFK 
Sbjct: 124 FADIALCPLEATRIRLVSQPTFANGL-------FGGFSRILKEEGVGSFYNGFTPILFKQ 176

Query: 307 VPSTAVSWLVYE 318
           +P     + V+E
Sbjct: 177 IPYNIAKFFVFE 188

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 83/195 (42%), Gaps = 23/195 (11%)

Query: 29  AGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLNC 88
           +  IA   +   + P E  +I L  Q +   +  GLF    ++ KEE +   + G     
Sbjct: 117 SAAIAEFFADIALCPLEATRIRLVSQPT---FANGLFGGFSRILKEEGVGSFYNGFTPIL 173

Query: 89  IRVFPYSAVQFVVFEGCKKHIFHV--DTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDL 146
            +  PY+  +F VFE      F +    +   E  +    L +G   G  + V + P D 
Sbjct: 174 FKQIPYNIAKFFVFEHAANAYFGLAGPKETMSETTHTAINLAAGLTAGLAAAVVSQPADT 233

Query: 147 VRTRLSVQTANLSKLSKSRASDIAKPPGVWKL-LSKAYAEEGGIMGLYRGVWPTSLGIV- 204
           +          LSK++K++     K PG   + L    A++ G +G + G+ PT L +V 
Sbjct: 234 L----------LSKVNKTK-----KAPGQSTIGLLAQLAKQLGFVGSFTGL-PTRLVMVG 277

Query: 205 PYVALNFAVYEQLKE 219
              +L F +Y  LK+
Sbjct: 278 TLTSLQFGIYGTLKK 292

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 69/301 (22%), Positives = 120/301 (39%), Gaps = 48/301 (15%)

Query: 25  VAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGN 84
           V+  +G  AG  +     P + +K  LQ         KG F A G        KG++RG 
Sbjct: 8   VSLASGAAAGTSTDLAFFPIDTLKTRLQA--------KGGFFANG------GYKGVYRGL 53

Query: 85  GLNCIRVFPYSAVQFVVFEGCKKHIFHVDTK---GKGEQLNNWQRLFSGALCGGCSVVAT 141
           G   I   P +++ FV ++  K +   V +K      +  +    +FS ++    + +  
Sbjct: 54  GSAVIASAPSASLFFVSYDSMKVYSKPVISKYVTSNNQMADTLSHMFSSSIGEVSACLVR 113

Query: 142 YPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGG---IMGLYRGVWP 198
            P ++++ R      N S                W+  +K    E G   +  LYRG   
Sbjct: 114 VPAEVIKQRTQTHKTNSS----------------WQTFTKILQNENGEGVLRNLYRGWNT 157

Query: 199 TSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSM-GAISGGVAQTITYPFDL 257
           T +  +P+  + F +YE LK+   +  NG   +  + ++ S+ G+++G +A   T P D+
Sbjct: 158 TIMREIPFTCIQFPLYEFLKKTW-AKRNGQDHV--APWQGSVCGSVAGAIAAATTTPLDV 214

Query: 258 LRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVY 317
           L+ R          L      V      I   EGFK ++ G+      +    A+   VY
Sbjct: 215 LKTRLM--------LSHKSIPVAQLAKNIYAEEGFKVFFSGVGPRTMWISAGGAIFLGVY 266

Query: 318 E 318
           E
Sbjct: 267 E 267

>Scas_562.12
          Length = 300

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 88/195 (45%), Gaps = 35/195 (17%)

Query: 29  AGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIG--QVYKEENIKGLFRGNGL 86
           AG + G I   V+ P + +KI  Q        N   F   G  ++ K+E I  L+RG G 
Sbjct: 125 AGSLIG-IGEIVLLPLDVLKIKRQT-------NPEAFKGRGFVKILKDEGIFNLYRGWGW 176

Query: 87  NCIRVFPYSAVQFVVFEG---CKKHIFHVDTKGKGEQLNNWQRLFSGALCGG-CSVVATY 142
              R  P S   F +F G    K++I  ++   +     +W + F  ++ G  CS++ + 
Sbjct: 177 TAARNAPGS---FALFGGNAFAKEYILGLEDYSQA----SWSQNFISSIVGASCSLIVSA 229

Query: 143 PLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLG 202
           PLD+++TR+           ++R+ D   P     ++   +  E GI   ++G+ P  L 
Sbjct: 230 PLDVIKTRI-----------QNRSFD--NPETGLTIVKNTFKNE-GITAFFKGLTPKLLT 275

Query: 203 IVPYVALNFAVYEQL 217
             P +  +FA+ + L
Sbjct: 276 TGPKLVFSFALAQSL 290

 Score = 29.6 bits (65), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 48/225 (21%), Positives = 80/225 (35%), Gaps = 26/225 (11%)

Query: 90  RVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRT 149
           RV+ Y    F   E   KH         GE+     R  +     G   +   PLD++  
Sbjct: 86  RVYKYGGQPFAN-EFLNKHYKKDFDSAFGEKTGKAMRSATAGSLIGIGEIVLLPLDVL-- 142

Query: 150 RLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVAL 209
                     K+ +    +  K  G  K+L     ++ GI  LYRG   T+    P    
Sbjct: 143 ----------KIKRQTNPEAFKGRGFVKIL-----KDEGIFNLYRGWGWTAARNAPGSFA 187

Query: 210 NFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGG 269
            F      KE++   E+ + +     +  S+  +    +  ++ P D+++ R Q  +   
Sbjct: 188 LFGGNAFAKEYILGLEDYSQASWSQNFISSI--VGASCSLIVSAPLDVIKTRIQNRSFDN 245

Query: 270 NELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSW 314
            E G         +    K EG   ++KGLT  L    P    S+
Sbjct: 246 PETGL------TIVKNTFKNEGITAFFKGLTPKLLTTGPKLVFSF 284

>Sklu_2127.4 , Contig c2127 6322-7293
          Length = 323

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 59/287 (20%), Positives = 125/287 (43%), Gaps = 35/287 (12%)

Query: 37  SRTVVSPFERVKILLQVQSSTTAYN-KGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYS 95
           S  +  P   +   LQ Q +      K   + I ++Y+++ + G + G       +   +
Sbjct: 27  SMALTYPLVTITTKLQTQGNDENNQVKSKLETIKEIYRKDGLLGFYAGLESAIYGMALTN 86

Query: 96  AVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQT 155
            V +  +E   +++  V    K ++LN  + + +G + G  + +A+ P+ +  TR++V  
Sbjct: 87  FVYYYFYELTSRNVLKVR---KHKKLNTLESMLTGCVAGSVTAIASNPIWVANTRMTV-- 141

Query: 156 ANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYE 215
                 +KS  + +A    + +++ K  A+      L+ G+ P +L +V    + + V+E
Sbjct: 142 ------TKSEKTALAT---IIEIVKKDSAKT-----LFNGLKP-ALVLVMNPIVQYTVFE 186

Query: 216 QLKEFMPS-DENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMG------ 268
           QLK  + + ++ G   +    +   +GA+    A   TYP+  L+ R  +   G      
Sbjct: 187 QLKNLVLAWNKQG---ILSPSWAFLLGALGKLAATGSTYPYITLKTRMHLSESGKHTDDD 243

Query: 269 -GNELGFHY---NSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTA 311
            G +   H     S+   +  I K +G  G Y+G+   L + + + A
Sbjct: 244 SGKKAKGHKASSKSMLSLITEIVKKDGVSGLYRGVGIKLAQSILTAA 290

 Score = 31.2 bits (69), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 45/103 (43%), Gaps = 10/103 (9%)

Query: 218 KEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYN 277
           KE  PSD        D L     GA  G ++  +TYP   +  + Q     GN+      
Sbjct: 4   KEICPSDV-------DELAHALAGAGGGALSMALTYPLVTITTKLQT---QGNDENNQVK 53

Query: 278 SVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYELT 320
           S  + +  I + +G  G+Y GL + ++ +  +  V +  YELT
Sbjct: 54  SKLETIKEIYRKDGLLGFYAGLESAIYGMALTNFVYYYFYELT 96

>CAGL0D04774g complement(467712..468680) similar to tr|Q06497
           Saccharomyces cerevisiae YPR128c, start by similarity
          Length = 322

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 62/302 (20%), Positives = 125/302 (41%), Gaps = 48/302 (15%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQ--------SSTTAYNKGLFDAIGQVYKEENIKG 79
             G +A +++ T V P +  K L+Q Q        S      K + D I +++K+    G
Sbjct: 8   FTGAVASSLAATTVYPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIFKKRGFLG 67

Query: 80  LFRGNGLNC--------IRVFPYSAVQ--FVVFEGCKKHIFHVDTKGKGEQLNNWQRLFS 129
           L++G   N         I  F YS ++  + VF+  +     +    K  +L+  + L  
Sbjct: 68  LYQGLATNVAANFVQNFIYFFWYSLIRSNYFVFKAGR---LQLKDDSKFIELSTIEELAL 124

Query: 130 GALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGI 189
           G   G  + V T P+ ++ TR         +L+K       +   +  ++ + Y E  G 
Sbjct: 125 GMSAGAMTQVVTNPISVISTR--------QQLTKD-----GEDASLKAVIKQIYEESNGD 171

Query: 190 MGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLS------MGAI 243
           +  +   +  +L +    A+ +  Y++LK  + + +  + S + S  +LS      +G  
Sbjct: 172 LTAFWKGFKVALVLSTNPAITYGSYQKLKSMILTAKGLSGSQKIST-QLSAGENFLLGMF 230

Query: 244 SGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANL 303
           S  ++  +T P  + +     + + G   G  + +  + L  I + EGF   +KG+   +
Sbjct: 231 SKMISTFVTQPLIVAK-----ITLQGK--GSKFKTFQEVLQHIYQNEGFLSLWKGVIPQV 283

Query: 304 FK 305
            K
Sbjct: 284 SK 285

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/209 (22%), Positives = 84/209 (40%), Gaps = 32/209 (15%)

Query: 120 QLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLL 179
           +L  ++ L +GA   G     T P+ +++ R      N S L ++              +
Sbjct: 114 RLTMYENLLTGAFARGLVGYITMPITVIKVRYESTLYNYSSLKEA--------------I 159

Query: 180 SKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMP----------SDENGNS 229
           +  Y +EG           T L   PY  L   +YE+ K+ +P          + E G +
Sbjct: 160 THIYTKEGLFGFFRGFG-ATCLRDAPYAGLYVLLYEKSKQLLPMVLPSRFIHYNPEGGFT 218

Query: 230 SMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKT 289
           +   +    +   +S  +A T+T PFD ++ R Q+      E     NS ++   +I K 
Sbjct: 219 TYTSTTVNTTSAVLSASLATTVTAPFDTIKTRMQL------EPSKFTNS-FNTFTSIVKN 271

Query: 290 EGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
           E     + GL+  L +   S  ++W +YE
Sbjct: 272 ENVLKLFSGLSMRLARKAFSAGIAWGIYE 300

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 89/201 (44%), Gaps = 26/201 (12%)

Query: 32  IAGAISRTVVSPFERVKILLQVQSSTTAYN-KGLFDAIGQVYKEENIKGLFRGNGLNCIR 90
           + GA +R +V        +++V+  +T YN   L +AI  +Y +E + G FRG G  C+R
Sbjct: 122 LTGAFARGLVGYITMPITVIKVRYESTLYNYSSLKEAITHIYTKEGLFGFFRGFGATCLR 181

Query: 91  VFPYSAVQFVVFEGCKK--------HIFHVDTKGK-GEQLNNWQRLFSGALCGGCSVVAT 141
             PY+ +  +++E  K+           H + +G      +      S  L    +   T
Sbjct: 182 DAPYAGLYVLLYEKSKQLLPMVLPSRFIHYNPEGGFTTYTSTTVNTTSAVLSASLATTVT 241

Query: 142 YPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSL 201
            P D ++TR+ ++ +  +  S +  + I K   V KL S      G  M L R  +  S 
Sbjct: 242 APFDTIKTRMQLEPSKFTN-SFNTFTSIVKNENVLKLFS------GLSMRLARKAF--SA 292

Query: 202 GIVPYVALNFAVYEQL-KEFM 221
           GI       + +YE+L K FM
Sbjct: 293 GIA------WGIYEELVKRFM 307

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 56/212 (26%), Positives = 91/212 (42%), Gaps = 43/212 (20%)

Query: 123 NWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKA 182
           N   L  G   G  S VA  PLDL++TR+                   K   +WK L   
Sbjct: 10  NSSHLIGGFFGGLTSAVALQPLDLLKTRIQQD----------------KKATLWKNLK-- 51

Query: 183 YAEEGGIMGLYRGVWP----TSLGIVPYVA-LNF--AVYEQLKEFMPS---DENGNSSMR 232
             E    + L+RG  P    TS+G   Y++ LN   +   + +  +PS   D N   +  
Sbjct: 52  --EIDSPLQLWRGTLPSALRTSIGSALYLSCLNLMRSSLAKRRNAVPSLTNDSNIVYNKS 109

Query: 233 DSLYKLSM------GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTI 286
            SL +L+M      GA + G+   IT P  +++ R++          ++Y+S+ +A+  I
Sbjct: 110 SSLPRLTMYENLLTGAFARGLVGYITMPITVIKVRYE-------STLYNYSSLKEAITHI 162

Query: 287 GKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
              EG  G+++G  A   +  P   +  L+YE
Sbjct: 163 YTKEGLFGFFRGFGATCLRDAPYAGLYVLLYE 194

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 75/325 (23%), Positives = 120/325 (36%), Gaps = 55/325 (16%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRG-NGL 86
           +AG  A     T+  PFE +K  LQ+  S    N   F+ + Q       K  F G   L
Sbjct: 99  VAGSCASVFQTTISYPFEFLKTGLQLHRSLP--NAHPFNMMHQ------FKYYFSGCAAL 150

Query: 87  NCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDL 146
           N   +F  +  +F  FE   + +   D       ++  + L +GA+ G    +   P + 
Sbjct: 151 NVGTLFK-TVTRFTTFEKACQLL--KDPSSPSAFISGPRLLMAGAITGFMESLWVVPFEN 207

Query: 147 VRTRLSVQTANLS-KLSKS---------------RASDIAKPPGV--WKLLSKAYAEEG- 187
           ++T +      LS +  K                RA+   + PG+   + L   Y E   
Sbjct: 208 IKTTMVENALVLSGRFQKEIEDKGKAETGSKREVRATFHKQTPGISPRERLFLHYEEHPT 267

Query: 188 --------------GIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRD 233
                         G+ G  +G  PT    +   A+ F  Y  LK+ +  ++  N     
Sbjct: 268 SRFFSTVKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFTTYTSLKQLISPNKPLNE---- 323

Query: 234 SLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFK 293
             Y   +G IS      +T P D+++ R Q      N     Y +  +    I   EG  
Sbjct: 324 -YYAFVLGFISSCAVVAVTQPIDVIKTRMQSKYAWAN-----YKNSLNCAYRIFVEEGIP 377

Query: 294 GYYKGLTANLFKVVPSTAVSWLVYE 318
            ++KG    L KV  S  VS+ VY+
Sbjct: 378 KFWKGWAPRLMKVGLSGGVSFGVYQ 402

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 75/169 (44%), Gaps = 18/169 (10%)

Query: 41  VSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFV 100
           +SP ER  + L  +   T+     F  + ++Y    ++G  +G      R    SAV+F 
Sbjct: 252 ISPRER--LFLHYEEHPTS---RFFSTVKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFT 306

Query: 101 VFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVA-TYPLDLVRTRLSVQTANLS 159
            +   K+ I         + LN +     G +   C+VVA T P+D+++TR+  + A  +
Sbjct: 307 TYTSLKQLI------SPNKPLNEYYAFVLGFI-SSCAVVAVTQPIDVIKTRMQSKYAWAN 359

Query: 160 -KLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYV 207
            K S + A  I    G+ K   K +A     +GL  GV   S G+  YV
Sbjct: 360 YKNSLNCAYRIFVEEGIPKFW-KGWAPRLMKVGLSGGV---SFGVYQYV 404

>CAGL0B03883g 383602..384522 weakly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, hypothetical
           start
          Length = 306

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/301 (19%), Positives = 121/301 (40%), Gaps = 21/301 (6%)

Query: 25  VAFLAGGIAGAISRTVVSPFERVKILLQ---VQSSTTAYNKGLFDAIGQVYKEENIKGLF 81
           + F+AG  +G    TV  PF+ VK+ LQ   V S      KG  D + +  K + I+GL+
Sbjct: 11  MGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLY 70

Query: 82  RGNGLNCIRVFPYSAVQFVVFEGCKKH--IFHVDTKGKGEQLNNWQRLFSGALCGGCSVV 139
            G       +F +  +   +      +  + H     + ++L     + SG + G     
Sbjct: 71  LGF---TPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSF 127

Query: 140 ATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPT 199
              P++L + +L VQ         ++ +    P  V + + K      GI+G  R ++  
Sbjct: 128 IAAPVELAKAKLQVQY-------DAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKG 180

Query: 200 SLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVA-QTITYPFDLL 258
            +  + + + NF  +    E +      N+++         G +S      T  YP D++
Sbjct: 181 LISTLIFRS-NFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWTSAYPSDVV 239

Query: 259 RRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
           ++    + +  ++    + S   A+  I +  G  G++KG   +  +  P+ A +   +E
Sbjct: 240 KQ----VVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPANAAALAAFE 295

Query: 319 L 319
            
Sbjct: 296 F 296

 Score = 36.6 bits (83), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 5/78 (6%)

Query: 231 MRDSLYKLSMGAISG---GVAQ-TITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTI 286
           + +  Y   MG ++G   GVA+ T+ +PFD ++ R Q   +G    G  +    D +   
Sbjct: 2   VSEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGA-GIQFKGPLDCVYKT 60

Query: 287 GKTEGFKGYYKGLTANLF 304
            K +G +G Y G T  LF
Sbjct: 61  LKNQGIRGLYLGFTPPLF 78

 Score = 32.3 bits (72), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 44/95 (46%), Gaps = 6/95 (6%)

Query: 15  LKNFLKQDTNVA-----FLAGGIAGAIS-RTVVSPFERVKILLQVQSSTTAYNKGLFDAI 68
           +  + +++TN++     F AGG++ +    T   P + VK ++          K    A+
Sbjct: 201 ITQWFQKNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAV 260

Query: 69  GQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFE 103
             +Y++  I G F+G   + +R FP +A     FE
Sbjct: 261 SDIYRQRGIHGFFKGFLPSFLRSFPANAAALAAFE 295

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 73/329 (22%), Positives = 118/329 (35%), Gaps = 48/329 (14%)

Query: 20  KQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKG 79
           +     + +AG  A     T+  PFE +K   Q+  +        F+ +         K 
Sbjct: 17  RHGVRSSVIAGAAAAVFQTTMSHPFEFLKTGQQLHRALP--GAAAFNML------HPFKY 68

Query: 80  LFRGNGLNCIRVFPYSAVQFVVFE-GCK--KHIFHVDTKGKGEQLNNWQRLFSGALCGGC 136
            F G     +     +  +F  FE  C   +   H D    G +L     L +GA+ G  
Sbjct: 69  YFSGCAALNVGTLLKTGTRFATFEQACVWLRDPEHADQPIAGPRL-----LLAGAITGFL 123

Query: 137 SVVATYPLDLVRTRLSVQTANLSKL----SKSRASDIAKPPGVWKLLSKAY----AEEGG 188
             +   P + ++T        LS+      ++RA+ ++K P        A     A E  
Sbjct: 124 ESLWVVPFESIKTTAVENALELSRRVQGEPETRAAAVSKGPAPKATFHAARPVQTAHERW 183

Query: 189 IMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPS--DENGNSSMR-------------- 232
           ++   R       G V  +     V   L+  MP+   + GNS +R              
Sbjct: 184 LLHYERQPSSHFAGTVLEIYRTRGVRGFLQGAMPTIFRQLGNSVVRFTTYAWIVQSLSPH 243

Query: 233 ---DSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKT 289
              D     + GA+S      +T P D+++ R Q          F Y S  +    I   
Sbjct: 244 KALDEYQAFAAGALSSAAVVALTQPIDVIKTRMQ-----SKTAWFTYKSSLNCAYRIFVE 298

Query: 290 EGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
           EGF+  +KG    LFKV  S  +S+ VY+
Sbjct: 299 EGFRYMWKGWVPRLFKVSLSGGISFGVYQ 327

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 83/195 (42%), Gaps = 35/195 (17%)

Query: 29  AGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIG--QVYKEENIKGLFRGNGL 86
           AG + G I   V+ P + +KI  Q    +       F   G  ++ ++E +  L+RG G 
Sbjct: 125 AGSLIG-IGEIVLLPLDVLKIKRQTNPES-------FKGRGFIKILRDEGLFNLYRGWGW 176

Query: 87  NCIRVFPYSAVQFVVFEG---CKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCS-VVATY 142
              R  P S   F +F G    K++I  +    K      W + F  ++ G CS ++ + 
Sbjct: 177 TAARNAPGS---FALFGGNAFAKEYILGL----KDYSQATWSQNFISSIVGACSSLIVSA 229

Query: 143 PLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLG 202
           PLD+++TR  +Q  N              P    +++      EG +   ++G+ P  L 
Sbjct: 230 PLDVIKTR--IQNRNFDN-----------PESGLRIVKNTLKNEG-VTAFFKGLTPKLLT 275

Query: 203 IVPYVALNFAVYEQL 217
             P +  +FA+ + L
Sbjct: 276 TGPKLVFSFALAQSL 290

>Scas_705.9
          Length = 323

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/299 (17%), Positives = 116/299 (38%), Gaps = 41/299 (13%)

Query: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNK------------GLFDAIGQVYKEE 75
           + G IA  ++  +V P +  K ++Q ++     ++             +   + +++++ 
Sbjct: 8   ITGAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCLIRIFRKR 67

Query: 76  NIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHV----DTKGKG-EQLNNWQRLFSG 130
            ++GL++G   +    F  S   F  +   ++  F +    +T+ +    ++  + L  G
Sbjct: 68  GLRGLYQGMSTSVFSKFVQSFCYFFWYSFLRRKYFSLKLLRNTQARPINSISTVEELIVG 127

Query: 131 ALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIM 190
                 + V   P++++             L+K + +D       + +L + Y E  G +
Sbjct: 128 VGAAALTQVVNNPIEVI-------------LTKQQTTDDKDNVDFYSVLKQIYVESNGKL 174

Query: 191 GLYRGVWPTSLGIVPYVALNFAVYEQLKEFM----PSDENGNSSMRDSLYKLSMGAISGG 246
             Y   +  SL +    ++ FA Y++ K+ +     + E   S          +GA++  
Sbjct: 175 SSYWKGFKVSLILTVNPSITFAAYQRFKDILLKQVSNSEKSYSGQLTVNQNFILGALAKI 234

Query: 247 VAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFK 305
           ++  IT P  + +   Q      N    H+  V   L    K EG    +KG+   L K
Sbjct: 235 ISTIITQPLIVAKVSLQ----RSNSKFKHFEEVLRYLY---KEEGVLALWKGVGPQLTK 286

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 39/77 (50%), Gaps = 2/77 (2%)

Query: 121 LNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQT-ANLSKLSKSRASDIAKPPGVWKLL 179
           ++N +   +GA+    + V  YPLD+ +T +  +T A  +     +   I +   V + L
Sbjct: 1   MSNLESAITGAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCL 60

Query: 180 SKAYAEEGGIMGLYRGV 196
            + + +  G+ GLY+G+
Sbjct: 61  IRIFRKR-GLRGLYQGM 76

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 61/294 (20%), Positives = 111/294 (37%), Gaps = 42/294 (14%)

Query: 43  PFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVF 102
           PFE +K  LQ+Q   TA+   L            IK  F G     +  F  + ++FV F
Sbjct: 4   PFEYLKTGLQLQPKGTAFEIIL----------PQIKSYFVGCSALNVAAFGKTILRFVTF 53

Query: 103 EG-CKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLS-- 159
           +  C     ++D     ++L  +  L +G L G    +   P + ++T L +Q+A +   
Sbjct: 54  DKLCHSLNNNIDNNDNFQRLTGYNLLIAGTLTGIVESLFIIPFENIKTTL-IQSAMIDHK 112

Query: 160 KLSK---------------SRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIV 204
           KL K               ++++ +A+   +   +   Y   G      +G   T    +
Sbjct: 113 KLEKNQPVVNAKATFHKVATKSTPVARIEKLLPAVKHMYQTRGP-AAFVQGTTATIFRQI 171

Query: 205 PYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQV 264
              ++ F  Y   K  + +  +  SS+         G  +      +T P D+++ R   
Sbjct: 172 ANTSIQFTAYTAFKRLLQARNDKASSVIT-------GLATSFTLVAMTQPIDVVKTR--- 221

Query: 265 LAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
             M        Y +  + +  I   EG   ++KG      KV  S  +++ VYE
Sbjct: 222 --MMSQNAKTEYKNTLNCMYRIFVQEGMATFWKGSIFRFMKVGISGGLTFTVYE 273

>AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH]
           (1500683..1501609) [927 bp, 308 aa]
          Length = 308

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 80/202 (39%), Gaps = 27/202 (13%)

Query: 121 LNNWQRL-FSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLL 179
           L+++ +   +GA+  G +  A  P+D+V+TR+ ++    S              G+    
Sbjct: 12  LSDYAKFALAGAIGCGATHSAMVPIDVVKTRIQLEPLKYSS-------------GMVGSF 58

Query: 180 SKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSM---RDSLY 236
            K   EEG    L  G  PT LG     A  F  YE  K+    D  G  +    R  +Y
Sbjct: 59  RKIVGEEGA-AALLTGFGPTLLGYSMQGAFKFGGYEVFKKAF-VDALGYETACQYRTPIY 116

Query: 237 KLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYY 296
            +   AI+   A     P +  R R        ++  F  N +      I K EG   +Y
Sbjct: 117 -IGSAAIAEFFADIALCPLEATRIRLV------SQPTFA-NGLVGGFARILKEEGIGSFY 168

Query: 297 KGLTANLFKVVPSTAVSWLVYE 318
            G T  LFK +P     ++V+E
Sbjct: 169 NGFTPILFKQIPYNIAKFVVFE 190

 Score = 37.0 bits (84), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 86/195 (44%), Gaps = 29/195 (14%)

Query: 32  IAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLNCIRV 91
           IA   +   + P E  +I L  Q +   +  GL     ++ KEE I   + G      + 
Sbjct: 122 IAEFFADIALCPLEATRIRLVSQPT---FANGLVGGFARILKEEGIGSFYNGFTPILFKQ 178

Query: 92  FPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQ----RLFSGALCGGCSVVATYPLDLV 147
            PY+  +FVVFE      F +   G  E L+        L +G   G  + V + P D +
Sbjct: 179 IPYNIAKFVVFEHAANAYFGL--AGSKENLSTTAATGINLLAGLTAGLAAAVISQPADTL 236

Query: 148 RTRLSVQTANLSKLSKSRASDIAKPPG--VWKLLSKAYAEEGGIMGLYRGVWPTSLGIV- 204
                     LSK++K++     K PG   + LL +  A++ G +G + G+ PT L +V 
Sbjct: 237 ----------LSKVNKTK-----KAPGQSTFGLLMQ-LAKQLGFVGSFAGL-PTRLVMVG 279

Query: 205 PYVALNFAVYEQLKE 219
              +L F +Y +LK+
Sbjct: 280 TLTSLQFGIYGKLKQ 294

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 74/347 (21%), Positives = 127/347 (36%), Gaps = 74/347 (21%)

Query: 22  DTNVAF----LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENI 77
           DTN +     LAG  A     T+  PFE +K   Q+  S    N   F+         ++
Sbjct: 3   DTNPSLYSNLLAGSAAAVFQTTLSHPFEFLKTGQQLHRSLP--NAEAFNMF------HHV 54

Query: 78  KGLFRGNGLNCIRVFPYSAVQFVVFE-GCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGC 136
           K  F G     I +   +A +F  F+  C+      D +     ++  + + +G++ G  
Sbjct: 55  KSYFAGCSALNIGILLKTATRFATFDKACQ---LLKDPENPEAPVSGLRLIAAGSITGFM 111

Query: 137 SVVATYPLDLVRTRL-------------SVQTANLSKLSKSRASDIAKP----PGVWKLL 179
             +   P + ++TR+              V+T    K      +++       P ++K +
Sbjct: 112 ESMLIIPFENIKTRMIENALILSNRYQEEVETGGKDKPRSKSVNNMETKEQIRPKLYKQV 171

Query: 180 SKA---------YAEEG----------------GIMGLYRGVWPTSLGIVPYVALNFAVY 214
            K          Y E+                 G    ++G  PT    V   A+ F  Y
Sbjct: 172 KKEINPRYEKFLYYEKHPSTNIFTTVREMVQTRGFTTFFQGSMPTIFRQVGNSAVRFTTY 231

Query: 215 EQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQ---VLAMGGNE 271
             LK+ +    + N  + +  Y   +G  S      +T P D+++ R Q     ++  N 
Sbjct: 232 TTLKQMI----SPNKPLSE-YYAFGIGVFSSCAVVALTQPIDVVKTRMQSKYTWSLYRNS 286

Query: 272 LGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
           L    N V+   +     EG    +KG    LFKV  S  VS+ VY+
Sbjct: 287 L----NCVYRTFIE----EGLTSLWKGWVPRLFKVGLSGGVSFGVYQ 325

>AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH]
           complement(1408478..1409410) [933 bp, 310 aa]
          Length = 310

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 83/197 (42%), Gaps = 22/197 (11%)

Query: 10  EEENQLKNFLKQDTNVAFLAGGIAGAISRTVVS-PFERVKILLQVQSSTTAYNKGL---- 64
           E E Q +     +     L GG++G +++  ++  F      +++  S  A   G+    
Sbjct: 94  EAEYQFRRLGLSNFGAGIL-GGVSGGVAQAYLTMGFCTCMKTVEITRSKAASAPGVPVPS 152

Query: 65  -FDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNN 123
                 Q++  E ++G+ +G     IR       +F +    +  I  V  K   E+L+ 
Sbjct: 153 SLQVFKQIFAAEGLRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRRVTHKRSDEKLSA 212

Query: 124 WQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPG--VWKLLSK 181
            +++ + AL GG S     P++++R  +           +SR +D  +P    V K    
Sbjct: 213 MEKIVASALGGGLSA-WNQPIEVIRVEM-----------QSRTNDPNRPKNLTVGKTFRY 260

Query: 182 AYAEEGGIMGLYRGVWP 198
            Y E  G+ GLYRGV P
Sbjct: 261 IY-ENNGLRGLYRGVTP 276

>YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1
           mutant that affects mitochondrial HMG-like DNA-binding
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 82/185 (44%), Gaps = 22/185 (11%)

Query: 28  LAGGIAGAISRTVVS-----PFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFR 82
           + GG+ G +++  ++       + V+I     +S     +  +     +YK+E I+G+ +
Sbjct: 114 ILGGVTGGVTQAYLTMGFCTCMKTVEITRHKSASAGGVPQSSWSVFKNIYKKEGIRGINK 173

Query: 83  GNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTK-GKGEQLNNWQRLFSGALCGGCSVVAT 141
           G     IR       +F +    +  I  +  K  K ++LN ++++ + AL GG S    
Sbjct: 174 GVNAVAIRQMTNWGSRFGLSRLVEDGIRKITGKTNKDDKLNPFEKIGASALGGGLSA-WN 232

Query: 142 YPLDLVRTRLSVQTANLSKLSKSRASDIAKPPG--VWKLLSKAYAEEGGIMGLYRGVWP- 198
            P++++R  +           +S+  D  +P    V K     Y +  G+ GLYRGV P 
Sbjct: 233 QPIEVIRVEM-----------QSKKEDPNRPKNLTVGKTFKYIY-QSNGLKGLYRGVTPR 280

Query: 199 TSLGI 203
             LGI
Sbjct: 281 IGLGI 285

 Score = 31.2 bits (69), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 72/182 (39%), Gaps = 32/182 (17%)

Query: 128 FSGALCGGC---SVVATY--PLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKA 182
           FS  L G C   S V T   PL++V+T ++    N + L   +         VW      
Sbjct: 20  FSNILLGACLNLSEVTTLGQPLEVVKTTMAANR-NFTFLESVKH--------VW------ 64

Query: 183 YAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDEN--GNSSMRDSLYKLSM 240
               GGI+G Y+G       ++P+  +  +    +  F+ ++      S   ++     +
Sbjct: 65  --SRGGILGYYQG-------LIPWAWIEASTKGAVLLFVSAEAEYRFKSLGLNNFASGIL 115

Query: 241 GAISGGVAQT-ITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGL 299
           G ++GGV Q  +T  F    +  ++        G    S W     I K EG +G  KG+
Sbjct: 116 GGVTGGVTQAYLTMGFCTCMKTVEITRHKSASAGGVPQSSWSVFKNIYKKEGIRGINKGV 175

Query: 300 TA 301
            A
Sbjct: 176 NA 177

>Scas_198.1
          Length = 72

 Score = 38.5 bits (88), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 22/28 (78%)

Query: 27 FLAGGIAGAISRTVVSPFERVKILLQVQ 54
          FL GG++ AI++T  +P ERVKIL+Q Q
Sbjct: 19 FLMGGVSAAIAKTGAAPIERVKILMQNQ 46

>Kwal_27.11626
          Length = 299

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 85/195 (43%), Gaps = 36/195 (18%)

Query: 29  AGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIG--QVYKEENIKGLFRGNGL 86
           AG + G I   V+ P + +KI  Q    +       F   G  ++ K+E   GL+RG G 
Sbjct: 124 AGSLIG-IGEIVLLPLDVLKIKRQTNPES-------FKGRGFIKILKDEGF-GLYRGWGW 174

Query: 87  NCIRVFPYSAVQFVVFEG---CKKHIFHVDTKGKGEQLNNWQRLFSGALCGG-CSVVATY 142
              R  P S   F +F G    K++I  +    K      W + F  ++ G   S++ + 
Sbjct: 175 TAARNAPGS---FALFGGNAFAKEYILGL----KDYSSATWSQNFVSSIVGASASLIVSA 227

Query: 143 PLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLG 202
           PLD+++TR+           ++R  D   P   ++++      EG I   ++G+ P  L 
Sbjct: 228 PLDVIKTRI-----------QNRHFD--NPESGFRIVQNTLKNEG-ITAFFKGLTPKLLT 273

Query: 203 IVPYVALNFAVYEQL 217
             P +  +FA+ + L
Sbjct: 274 TGPKLVFSFALAQSL 288

 Score = 29.6 bits (65), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 30/68 (44%), Gaps = 6/68 (8%)

Query: 251 ITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPST 310
           ++ P D+++ R Q       E GF    V + L    K EG   ++KGLT  L    P  
Sbjct: 225 VSAPLDVIKTRIQNRHFDNPESGFRI--VQNTL----KNEGITAFFKGLTPKLLTTGPKL 278

Query: 311 AVSWLVYE 318
             S+ + +
Sbjct: 279 VFSFALAQ 286

>KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces
           cerevisiae YMR241w YHM2 yeast suppressor gene of HM
           (mitochondrial histone) mutant (ABF2) singleton, start
           by similarity
          Length = 308

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 87/188 (46%), Gaps = 25/188 (13%)

Query: 26  AFLAGGIAGAISRTVVS-----PFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGL 80
           A + GG++G +++  ++       + V+I    +S+     +  + A  ++Y +E I+G+
Sbjct: 107 AGIMGGVSGGVAQAYLTMGFCTCMKTVEITKH-KSAAAGAKQSSWAAFKEIYNKEGIRGI 165

Query: 81  FRGNGLNCIRVFPYSAVQF----VVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGC 136
            +G     IR       +F    +V EG +K     +     ++L   +++F+ A+ GG 
Sbjct: 166 NKGVNAVAIRQMTNWGSRFGFSRLVEEGLRKFTGKTNPD---DKLTALEKIFASAIGGGL 222

Query: 137 SVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGV 196
           S     P++++R  +  +T +      +R  D+     V K     Y +  G+ GLYRGV
Sbjct: 223 SA-WNQPIEVIRVEMQSKTND-----PNRPKDLT----VGKAFRYIY-QSNGVKGLYRGV 271

Query: 197 WP-TSLGI 203
            P   LGI
Sbjct: 272 TPRIGLGI 279

 Score = 28.9 bits (63), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 55/265 (20%), Positives = 107/265 (40%), Gaps = 37/265 (13%)

Query: 51  LQVQSSTTAYNK--GLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQ------FVVF 102
           L+V  +T A N+    F AI  ++    + G ++G       + P++ ++       ++F
Sbjct: 36  LEVVKTTMAANRQFTFFQAINHIWSRGGVFGFYQG-------LIPWAWIEASTKGAVLLF 88

Query: 103 EGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLS 162
              +   +H    G    LNN+     G + GG +  A   +       +V+      ++
Sbjct: 89  VSAEAE-YHFKKLG----LNNFGAGIMGGVSGGVAQ-AYLTMGFCTCMKTVE------IT 136

Query: 163 KSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFA----VYEQLK 218
           K +++        W    + Y +EG I G+ +GV   ++  +      F     V E L+
Sbjct: 137 KHKSAAAGAKQSSWAAFKEIYNKEG-IRGINKGVNAVAIRQMTNWGSRFGFSRLVEEGLR 195

Query: 219 EFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNS 278
           +F  + +        +L K+   AI GG++     P +++R   Q      N       +
Sbjct: 196 KF--TGKTNPDDKLTALEKIFASAIGGGLS-AWNQPIEVIRVEMQSKTNDPNRP--KDLT 250

Query: 279 VWDALVTIGKTEGFKGYYKGLTANL 303
           V  A   I ++ G KG Y+G+T  +
Sbjct: 251 VGKAFRYIYQSNGVKGLYRGVTPRI 275

>Scas_613.24
          Length = 177

 Score = 39.3 bits (90), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 77/180 (42%), Gaps = 34/180 (18%)

Query: 126 RLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAE 185
            L SG + G  S V   PLDL++TR  +Q    + L  S   DI  P   W         
Sbjct: 11  HLVSGFIGGLSSAVTLQPLDLLKTR--IQQHKGATLW-SAIKDIKDPIQFW--------- 58

Query: 186 EGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLK-EFMPSDENGNSSMRDSLYKLSM---- 240
                   RG  P++L      AL  +    ++ + +   +   +S   SL +L+M    
Sbjct: 59  --------RGTLPSALRTSIGSALYLSCLNIMRTQLVHGKKGSAASKSSSLPQLTMYENL 110

Query: 241 --GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKG 298
             GA++ G+   IT P  +L+ R++          + Y S+ +A+  I K EG  G++KG
Sbjct: 111 LTGAMARGLVGYITMPITILKVRYE-------STYYSYKSMNEAIKDIYKMEGISGFFKG 163

 Score = 33.9 bits (76), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 32  IAGAISRTVVSPFERVKILLQVQSSTTAYN-KGLFDAIGQVYKEENIKGLFRGNG 85
           + GA++R +V        +L+V+  +T Y+ K + +AI  +YK E I G F+G G
Sbjct: 111 LTGAMARGLVGYITMPITILKVRYESTYYSYKSMNEAIKDIYKMEGISGFFKGFG 165

 Score = 31.2 bits (69), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 40/190 (21%), Positives = 75/190 (39%), Gaps = 30/190 (15%)

Query: 23  TNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFR 82
           T+V  ++G I G  S   + P + +K  +Q     T     L+ AI  +  ++ I+  +R
Sbjct: 8   TSVHLVSGFIGGLSSAVTLQPLDLLKTRIQQHKGAT-----LWSAIKDI--KDPIQ-FWR 59

Query: 83  GNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKG------EQLNNWQRLFSGALCGGC 136
           G   + +R    SA+        +  + H              QL  ++ L +GA+  G 
Sbjct: 60  GTLPSALRTSIGSALYLSCLNIMRTQLVHGKKGSAASKSSSLPQLTMYENLLTGAMARGL 119

Query: 137 SVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGV 196
               T P+ +++ R      +   ++++              +   Y  E GI G ++G 
Sbjct: 120 VGYITMPITILKVRYESTYYSYKSMNEA--------------IKDIYKME-GISGFFKGF 164

Query: 197 WPT-SLGIVP 205
            PT  +GI P
Sbjct: 165 GPTVGIGIPP 174

>Scas_671.1*
          Length = 123

 Score = 38.1 bits (87), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 50/116 (43%), Gaps = 17/116 (14%)

Query: 213 VYEQLKEFMPS---------DENGNSSMRDSLYKLSMGAI-SGGVAQTITYPFDLLRRRF 262
           +YE+ K+ +P           E+   S   S    S+ AI S  +A  IT PFD ++ R 
Sbjct: 8   LYEKSKQILPKFLPKSLIHYKEDMKFSTSTSTVVNSVSAIASASLATAITAPFDTIKTRM 67

Query: 263 QVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
           Q+           + + +  LV I K E     + GL+  L +   S  ++W +YE
Sbjct: 68  QLKPKV-------FTNFFTTLVLITKNESIFQLFSGLSMRLTRKALSAGIAWGIYE 116

>Sklu_2194.3 YMR241W, Contig c2194 5245-6183
          Length = 312

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/183 (21%), Positives = 82/183 (44%), Gaps = 29/183 (15%)

Query: 28  LAGGIAGAISRTVVS-----PFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFR 82
           + GG+ G +++  ++       + V+I  +  +   A  +  + A  ++YK++ IKG+ +
Sbjct: 112 IMGGVTGGVAQAYLTMGFCTCMKTVEITKKKSAGAGAIPQSSWGAFKEIYKKDGIKGINK 171

Query: 83  GNGLNCIRVFPYSAVQF----VVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSV 138
           G     IR       +F    +V EG +      +     ++L   +++ + A+ GG S 
Sbjct: 172 GVNAVAIRQMTNWGSRFGFSRLVEEGIRNATGKTNPD---DKLTALEKIAASAIGGGLSA 228

Query: 139 VATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYA---EEGGIMGLYRG 195
               P++++R  +           +S+  D  +P  +   +S A+    +  GI GLYRG
Sbjct: 229 W-NQPIEVIRVEM-----------QSKKEDPNRPKNL--TVSSAFKYIYQSSGIKGLYRG 274

Query: 196 VWP 198
           V P
Sbjct: 275 VAP 277

 Score = 32.3 bits (72), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 50/120 (41%), Gaps = 12/120 (10%)

Query: 186 EGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLS---MGA 242
            GG+ G Y+G       ++P+  +  +    +  F+ S E+     R  L       MG 
Sbjct: 64  RGGVFGFYQG-------LIPWAWIEASTKGAVLLFV-SAESEYQFKRMGLSNFGSGIMGG 115

Query: 243 ISGGVAQT-ITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTA 301
           ++GGVAQ  +T  F    +  ++        G    S W A   I K +G KG  KG+ A
Sbjct: 116 VTGGVAQAYLTMGFCTCMKTVEITKKKSAGAGAIPQSSWGAFKEIYKKDGIKGINKGVNA 175

>Kwal_34.15907
          Length = 312

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 81/184 (44%), Gaps = 27/184 (14%)

Query: 26  AFLAGGIAGAISRTVVS-----PFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGL 80
           A + GG++G +++  ++       + V+I     +   A  +  + A  ++Y +E IKG+
Sbjct: 110 AGIMGGVSGGVAQAYLTMGFCTCMKTVEITKAKSAVAGAIPQSSWSAFKEIYSKEGIKGI 169

Query: 81  FRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTK-GKGEQLNNWQRLFSGALCGGCSVV 139
            +G     IR       +F +    ++ I     K    ++L   +++F+ AL GG S  
Sbjct: 170 NKGVNAVAIRQMTNWGSRFGLSRLVEQGIRDFTGKTNPDDKLTALEKIFASALGGGLSAW 229

Query: 140 ATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYA-----EEGGIMGLYR 194
              P++++R  +           +S+  D  +P    K L+   A     +  GI GLYR
Sbjct: 230 -NQPIEVIRVEM-----------QSKKEDPNRP----KKLTVGSAFKYIYQSSGIKGLYR 273

Query: 195 GVWP 198
           GV P
Sbjct: 274 GVAP 277

 Score = 32.0 bits (71), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 28/63 (44%), Gaps = 1/63 (1%)

Query: 240 MGAISGGVAQT-ITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKG 298
           MG +SGGVAQ  +T  F    +  ++        G    S W A   I   EG KG  KG
Sbjct: 113 MGGVSGGVAQAYLTMGFCTCMKTVEITKAKSAVAGAIPQSSWSAFKEIYSKEGIKGINKG 172

Query: 299 LTA 301
           + A
Sbjct: 173 VNA 175

>Scas_696.9
          Length = 312

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 73/162 (45%), Gaps = 19/162 (11%)

Query: 47  VKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCK 106
           V+I     +S  A  +  ++    +Y +E ++G+++G     IR       +F      +
Sbjct: 136 VEITRLKSASAGAPVQSSWNVFRSIYAKEGLRGIYKGVNAVAIRQMTNWGSRFGFSRLVE 195

Query: 107 KHIFHVDTKGKGE-QLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSR 165
             +     K K E +LN W+++ + A+ GG S     P++++R  +           +S+
Sbjct: 196 DWVRKATGKTKPEDRLNAWEKIGATAVGGGLS-AWNQPIEVIRVEM-----------QSK 243

Query: 166 ASDIAKPPGVWKLLSKAYA---EEGGIMGLYRGVWP-TSLGI 203
             D  +P  +   ++K +    +  G+ GLYRGV P   LGI
Sbjct: 244 KEDPNRPKNL--TVAKTFKYIMKTNGVKGLYRGVTPRIGLGI 283

 Score = 31.6 bits (70), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 65/154 (42%), Gaps = 10/154 (6%)

Query: 153 VQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFA 212
           ++T  +++L  + A   A     W +    YA+EG + G+Y+GV   ++  +      F 
Sbjct: 133 MKTVEITRLKSASAG--APVQSSWNVFRSIYAKEG-LRGIYKGVNAVAIRQMTNWGSRFG 189

Query: 213 VYEQLKEFMPSDENGNSSMRDSL---YKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGG 269
            + +L E       G +   D L    K+   A+ GG++     P +++R   Q      
Sbjct: 190 -FSRLVEDWVRKATGKTKPEDRLNAWEKIGATAVGGGLS-AWNQPIEVIRVEMQSKKEDP 247

Query: 270 NELGFHYNSVWDALVTIGKTEGFKGYYKGLTANL 303
           N       +V      I KT G KG Y+G+T  +
Sbjct: 248 NRP--KNLTVAKTFKYIMKTNGVKGLYRGVTPRI 279

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 54/127 (42%), Gaps = 14/127 (11%)

Query: 96  AVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQT 155
           AV+F  +   K+ +         + L + Q    GAL G  +V AT P+D V+TR+    
Sbjct: 184 AVRFGCYTQLKQAVQRYAGTPADQPLGSGQTFLVGALSGIVTVYATMPVDTVKTRM---- 239

Query: 156 ANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYE 215
                    +A D A+  G      +A   E G+  L+RG  P    +V    + F  YE
Sbjct: 240 ---------QALDAAR-YGSTVGCFRAVVREEGVRALWRGATPRLGRLVLSGGIVFTAYE 289

Query: 216 QLKEFMP 222
           +L   +P
Sbjct: 290 KLLVLLP 296

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 70/304 (23%), Positives = 121/304 (39%), Gaps = 30/304 (9%)

Query: 22  DTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLF 81
           D   +F+AG  AGAI   V  PFE  K  LQ+    +  ++     + +  + +    L+
Sbjct: 9   DAARSFVAGAAAGAIEGCVTYPFEFAKTRLQLAQQGSGESRNPLVLLYRTARTQGAGALY 68

Query: 82  RGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGC-SVVA 140
            G     +     + V+F+ F+  ++ +   D +G    L+  + + +G   G   SV+A
Sbjct: 69  VGCPAFVVGNTCKAGVRFLGFDALRRAL--QDERGA---LSGPRGMLAGLGAGLLESVLA 123

Query: 141 TYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTS 200
             P +      +V+TA +     +R        G  +  +    E G        V P +
Sbjct: 124 VTPFE------AVKTALIDDRQAARPRYQHNGRGAARNYALLLRELGLRGLYGGLV-PVA 176

Query: 201 LGIVPYVALNFAVYEQLKEFM------PSDENGNSSMRDSLYKLSMGAISGGVAQTITYP 254
           L      A+ F  Y QLK+ +      P+D+   S          +GA+SG V    T P
Sbjct: 177 LRQASNQAVRFGCYTQLKQAVQRYAGTPADQPLGSGQ-----TFLVGALSGIVTVYATMP 231

Query: 255 FDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSW 314
            D ++ R Q L          Y S       + + EG +  ++G T  L ++V S  + +
Sbjct: 232 VDTVKTRMQALDAA------RYGSTVGCFRAVVREEGVRALWRGATPRLGRLVLSGGIVF 285

Query: 315 LVYE 318
             YE
Sbjct: 286 TAYE 289

>CAGL0K07436g complement(734496..735419) highly similar to sp|Q04013
           Saccharomyces cerevisiae YMR241w, hypothetical start
          Length = 307

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 63/137 (45%), Gaps = 17/137 (12%)

Query: 71  VYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTK-GKGEQLNNWQRLFS 129
           +YK+E I+G+ +G     IR       +F +    +  I  +  K GK ++L   +++ +
Sbjct: 155 IYKKEGIRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRKLTGKTGKDDKLTALEKIMA 214

Query: 130 GALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPG--VWKLLSKAYAEEG 187
            A+ GG S     P++++R  +           +S+  D  +P    V K     Y +  
Sbjct: 215 SAIGGGLSA-WNQPIEVIRVEM-----------QSKKEDPNRPKNLTVGKTFKYIY-QSN 261

Query: 188 GIMGLYRGVWP-TSLGI 203
           G+ GLYRGV P   LGI
Sbjct: 262 GLKGLYRGVTPRVGLGI 278

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 54/130 (41%), Gaps = 19/130 (14%)

Query: 180 SKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLS 239
           +K     GGI G Y+G       ++P+  +  +    +  F+ ++    +  R  +  L+
Sbjct: 52  TKHVWSRGGIFGFYQG-------LIPWAWIEASTKGAVLLFVSAE----AEYRFKVLGLN 100

Query: 240 ------MGAISGGVAQT-ITYPFDLLRRRFQVLAM-GGNELGFHYNSVWDALVTIGKTEG 291
                 MG I+GGV Q  +T  F    +  ++      N  G    S W    +I K EG
Sbjct: 101 NFGAGIMGGITGGVTQAYLTMGFCTCMKTVEITRQKAANVPGVIPQSSWQVFKSIYKKEG 160

Query: 292 FKGYYKGLTA 301
            +G  KG+ A
Sbjct: 161 IRGINKGVNA 170

>Sklu_2250.1 YBL030C, Contig c2250 1624-1847
          Length = 75

 Score = 35.4 bits (80), Expect = 0.006,   Method: Composition-based stats.
 Identities = 13/25 (52%), Positives = 20/25 (80%)

Query: 30 GGIAGAISRTVVSPFERVKILLQVQ 54
          GG++ A+S+T  +P ERVK+L+Q Q
Sbjct: 2  GGVSAAVSKTAAAPIERVKLLIQNQ 26

>YDR470C (UGO1) [1287] chr4 complement(1399694..1401202) Protein of
           the mitochondrial outer membrane required for
           mitochondrial fusion, member of the mitochondrial
           carrier family (MCF) of membrane transporters [1509 bp,
           502 aa]
          Length = 502

 Score = 35.4 bits (80), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 49/234 (20%), Positives = 94/234 (40%), Gaps = 21/234 (8%)

Query: 66  DAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLN--N 123
           D I  ++ +E I+GL++ N    I  F   ++    F G       V      E +N  +
Sbjct: 231 DVINALFDQEGIRGLWKANNTTFIYNFLSLSID-TWFTGLLSSFLGVPDPYFMEVINSPD 289

Query: 124 WQRLFSGALCGGC-SVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKA 182
             + F  AL  G  + +   P+DL+RTRL V +    K  K+   ++       + L + 
Sbjct: 290 ISKSFILALGAGVFTSIILLPVDLIRTRLIVTSFKKKKNVKTDGKNMVTNTRSLRQLIRC 349

Query: 183 YAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGA 242
           ++     + +   +W  SL I+   ++N + + +L + +  ++        ++   +M  
Sbjct: 350 WSWRKNGVSIPLDMW--SLTILQ--SINNSFFNKLFDLVIYNQFHIEKYSQTVMYNTMKF 405

Query: 243 ISGGVAQTITYPFDLLRRRFQV-LAMGGNELGF------------HYNSVWDAL 283
            S  +   I  P + L RR Q+   +    L F             YN +WD +
Sbjct: 406 FSKSLELFIKLPLENLLRRCQLNYLLNDQRLSFKVDSTELIVKPKKYNGIWDVI 459

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 32.3 bits (72), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 53/230 (23%), Positives = 86/230 (37%), Gaps = 28/230 (12%)

Query: 90  RVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRT 149
           RV+ Y    F   E   KH         G++     R  +     G   +   PLD++  
Sbjct: 86  RVYKYGGQPFAN-EFLNKHFKKDFDSAFGDKTGKALRSATAGSLIGIGEIVLLPLDVL-- 142

Query: 150 RLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVAL 209
                     K+ +    +  K  G  K+L     ++ GI  LYRG   T+    P    
Sbjct: 143 ----------KIKRQTNPEAFKGRGFLKIL-----KDEGIFNLYRGWGWTAARNAPGSFA 187

Query: 210 NFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTI-TYPFDLLRRRFQVLAMG 268
            F      KE++   ++ + +     +   + +I G  A  I + P D+++ R Q     
Sbjct: 188 LFGGNAFAKEYILGLQDYSQATWSQNF---ISSIVGASASLIVSAPLDVIKTRIQNRNFD 244

Query: 269 GNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
             E GF    V + L    K EGF  ++KGLT  L    P    S+ + +
Sbjct: 245 NPESGFKI--VKNTL----KNEGFTAFFKGLTPKLLTTGPKLVFSFALAQ 288

>Sklu_2436.18 YDR470C, Contig c2436 37947-39431 reverse complement
          Length = 494

 Score = 32.3 bits (72), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 41/94 (43%), Gaps = 4/94 (4%)

Query: 65  FDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNW 124
            D +  V  EE  +GL+R N    I  F  SA     F G       +      + +++ 
Sbjct: 234 MDIMNSVMDEEGTRGLWRANNTTFIYNF-LSATLDAWFTGMLSPFLQIPDPYFIDIIHSP 292

Query: 125 QRLFSGALCGGCSV---VATYPLDLVRTRLSVQT 155
               S AL    SV   +A  PLDL++TRL++ +
Sbjct: 293 DPQKSIALTLAASVFTGIALLPLDLIKTRLTITS 326

>Sklu_2117.2 YDL198C, Contig c2117 3737-4633
          Length = 298

 Score = 31.6 bits (70), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 31/68 (45%), Gaps = 6/68 (8%)

Query: 251 ITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPST 310
           I+ P D+++ R Q       E GF    V + L    K EGF  ++KGLT  L    P  
Sbjct: 225 ISAPLDVIKTRIQNKNFENPESGFTI--VKNTL----KNEGFSAFFKGLTPKLLTTGPKL 278

Query: 311 AVSWLVYE 318
             S+ + +
Sbjct: 279 VFSFALAQ 286

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 31/68 (45%), Gaps = 6/68 (8%)

Query: 251 ITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPST 310
           ++ P D+++ R Q       E GF    + + L    K EGF  ++KGLT  L    P  
Sbjct: 226 VSAPLDVIKTRIQNRNFDNPESGFKI--IKNTL----KNEGFTAFFKGLTPKLLTTGPKL 279

Query: 311 AVSWLVYE 318
             S+ + +
Sbjct: 280 VFSFALAQ 287

>Scas_630.19
          Length = 495

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 30/138 (21%), Positives = 55/138 (39%), Gaps = 33/138 (23%)

Query: 99  FVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSG---ALCGGCSVVATYPLDLVRTRLSVQT 155
            V+  G      H++  G+ E    W+   +G   A+CGG + +   PL+ V    +V+ 
Sbjct: 62  MVILPGLVDSHVHLNEPGRTE----WEGFATGTQAAICGGVTTIIDMPLNAVPPTTTVEN 117

Query: 156 ANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSL-GIVPYVAL----- 209
            N+                    L+ A+ +    +G + G+ P +L  ++P V       
Sbjct: 118 LNIK-------------------LNAAHNQLWCDVGFWGGLVPDNLHDLIPLVNAGVRGF 158

Query: 210 -NFAVYEQLKEFMPSDEN 226
             F ++  + EF   DEN
Sbjct: 159 KGFLIHSGVDEFPSIDEN 176

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 54/230 (23%), Positives = 88/230 (38%), Gaps = 29/230 (12%)

Query: 90  RVFPYSAVQFVVFEGCKKHIFHVDTKGK-GEQLNNWQRLFSGALCGGCSVVATYPLDLVR 148
           RV+ Y    F   E   KH F  D  G  GE+     R  +     G   +   PLD++ 
Sbjct: 85  RVYKYGGQPFAN-EFLNKH-FKADFDGAFGEKTGKALRSATAGSLIGIGEIVLLPLDVL- 141

Query: 149 TRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVA 208
                      K+ +    +  +  G  ++L     +EG  MGLYRG   T+    P   
Sbjct: 142 -----------KIKRQTNPESFRGRGFLRILR----DEG--MGLYRGWGWTAARNAPGSF 184

Query: 209 LNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMG 268
             F      KE++   ++ + +     +  S+   S  +   ++ P D+++ R Q     
Sbjct: 185 ALFGGNAFAKEYILGLKDYSQATWGQNFVSSIFGASASL--IVSAPLDVIKTRIQSRNFE 242

Query: 269 GNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318
             E GF    V + L    K EG   ++KGLT  L    P    S+ + +
Sbjct: 243 SAESGFTI--VKNTL----KNEGATAFFKGLTPKLLTTGPKLVFSFAIAQ 286

>YDL056W (MBP1) [809] chr4 (352877..355378) Transcription factor
           that collaborates with Swi6p to form the MBF
           (Mbp1p-Swi6p) factor for regulation at Mlu1 cell cycle
           box (MCB) elements, has two ankyrin repeats [2502 bp,
           833 aa]
          Length = 833

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 8/66 (12%)

Query: 153 VQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFA 212
           ++ AN +K  ++R  +        ++L + + +  G  G Y+G W   L I   +A  F+
Sbjct: 40  LKAANFAKAKRTRILE-------KEVLKETHEKVQGGFGKYQGTW-VPLNIAKQLAEKFS 91

Query: 213 VYEQLK 218
           VY+QLK
Sbjct: 92  VYDQLK 97

>CAGL0K06545g complement(641129..642667) similar to tr|Q03327
           Saccharomyces cerevisiae YDR470c, hypothetical start
          Length = 512

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 49/118 (41%), Gaps = 7/118 (5%)

Query: 41  VSPFERVKI-LLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQF 99
           V+  E   I  L  + S    +K   D +  +  EE IKGL++ N  N I     S ++ 
Sbjct: 212 VASIEETHIRCLTPERSINPESKHTLDIMNSILDEEGIKGLWKANNTNFIYQILSSTLE- 270

Query: 100 VVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGAL----CGGCSVVATYPLDLVRTRLSV 153
             + G    + H+      + L ++    S  L     G  + +   P+DL+RTR  V
Sbjct: 271 AWYTGLISPLLHIPDPYFID-LIHFPDTQSAVLLTLSVGVLTALTLIPIDLIRTRFIV 327

>AEL060C [2446] [Homologous to NOHBY] (525069..526358) [1290 bp, 429
           aa]
          Length = 429

 Score = 28.5 bits (62), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 6/57 (10%)

Query: 268 GGNE--LGFHYNSVWDAL---VTIGKTEGFKGY-YKGLTANLFKVVPSTAVSWLVYE 318
           GGN   L  ++NS  D L    +I K+ G   + YKG   N   ++P TA   L+ E
Sbjct: 356 GGNTRLLHLYFNSYIDTLEHVASISKSTGTARWLYKGFLRNTLAIIPGTATGLLLLE 412

>Sklu_1523.1 YMR319C, Contig c1523 73-1734 reverse complement
          Length = 553

 Score = 28.5 bits (62), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 4/48 (8%)

Query: 274 FHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYELTW 321
            H+N   D    I  + GF G +KG T N+  V+   A S +V+ L W
Sbjct: 61  LHFNKRGD----IETSRGFTGLWKGRTDNVLDVLVRIAGSQVVFFLMW 104

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.137    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,239,964
Number of extensions: 415802
Number of successful extensions: 2753
Number of sequences better than 10.0: 219
Number of HSP's gapped: 1515
Number of HSP's successfully gapped: 570
Length of query: 322
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 220
Effective length of database: 13,065,073
Effective search space: 2874316060
Effective search space used: 2874316060
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)