Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0J00957g1971528131e-112
Scas_533.41961527571e-103
YLR009W (RLP24)1991527501e-102
Sklu_1938.51961507351e-100
KLLA0E09416g1981507351e-100
ADR346W1971527225e-98
Kwal_33.152991961416861e-92
YGR148C (RPL24B)155571606e-14
Sklu_1642.21491051581e-13
YGL031C (RPL24A)155571581e-13
Kwal_14.2299155911562e-13
CAGL0A01562g155911546e-13
KLLA0E10857g155571493e-12
AFR477C155911493e-12
Scas_648.9155901441e-11
Scas_4.166521338e-11
KLLA0C11055g54864680.75
CAGL0L12584g29489661.1
Sklu_1742.468560632.7
CAGL0J09526g1071102608.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J00957g
         (194 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J00957g 96608..97201 highly similar to tr|Q07915 Saccharomy...   317   e-112
Scas_533.4                                                            296   e-103
YLR009W (RLP24) [3427] chr12 (166536..167135) Possible ribosomal...   293   e-102
Sklu_1938.5 YLR009W, Contig c1938 7059-7649                           287   e-100
KLLA0E09416g complement(836948..837544) similar to sgd|S0003999 ...   287   e-100
ADR346W [2087] [Homologous to ScYLR009W (RLP24) - SH] complement...   282   5e-98
Kwal_33.15299                                                         268   1e-92
YGR148C (RPL24B) [2103] chr7 complement(787315..787782) Ribosoma...    66   6e-14
Sklu_1642.2 YGR148C, Contig c1642 2421-2870 reverse complement         65   1e-13
YGL031C (RPL24A) [1943] chr7 complement(437470..437937) Ribosoma...    65   1e-13
Kwal_14.2299                                                           65   2e-13
CAGL0A01562g 152953..153420 highly similar to sp|P24000 Saccharo...    64   6e-13
KLLA0E10857g 957487..957954 gi|730554|sp|P38665|RL24_KLULA Kluyv...    62   3e-12
AFR477C [3669] [Homologous to ScYGL031C (RPL24A) - SH; ScYGR148C...    62   3e-12
Scas_648.9                                                             60   1e-11
Scas_4.1                                                               56   8e-11
KLLA0C11055g complement(950647..952293) similar to sp|P38775 Sac...    31   0.75 
CAGL0L12584g complement(1351867..1352751) similar to tr|Q03080 S...    30   1.1  
Sklu_1742.4 YGL145W, Contig c1742 3577-5634                            29   2.7  
CAGL0J09526g 931021..934236 similar to sp|P06777 Saccharomyces c...    28   8.2  

>CAGL0J00957g 96608..97201 highly similar to tr|Q07915 Saccharomyces
           cerevisiae YLR009w, start by similarity
          Length = 197

 Score =  317 bits (813), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%)

Query: 1   MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLKWTKAFRKAAG 60
           MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLKWTKAFRKAAG
Sbjct: 1   MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLKWTKAFRKAAG 60

Query: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSRIEEIRQKRERAFYKNRMKGNSERDF 120
           KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSRIEEIRQKRERAFYKNRMKGNSERDF
Sbjct: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSRIEEIRQKRERAFYKNRMKGNSERDF 120

Query: 121 LRDKKLVETNPELLRLREVEIANRLAKEQAAA 152
           LRDKKLVETNPELLRLREVEIANRLAKEQAAA
Sbjct: 121 LRDKKLVETNPELLRLREVEIANRLAKEQAAA 152

>Scas_533.4
          Length = 196

 Score =  296 bits (757), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 141/152 (92%), Positives = 147/152 (96%)

Query: 1   MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLKWTKAFRKAAG 60
           MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHK+FKQRRNPRKLKWTKAFRKAAG
Sbjct: 1   MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKSFKQRRNPRKLKWTKAFRKAAG 60

Query: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSRIEEIRQKRERAFYKNRMKGNSERDF 120
           KELAVDSTLTFAQRRNVPVRYNREL+ATTLKAMSRIEEIR KRERAFYKNRM+GN ERDF
Sbjct: 61  KELAVDSTLTFAQRRNVPVRYNRELMATTLKAMSRIEEIRVKRERAFYKNRMRGNKERDF 120

Query: 121 LRDKKLVETNPELLRLREVEIANRLAKEQAAA 152
           LRDKKLVE NPELLR+REVEIAN+LA+EQ  A
Sbjct: 121 LRDKKLVEANPELLRMREVEIANKLAREQERA 152

>YLR009W (RLP24) [3427] chr12 (166536..167135) Possible ribosomal
           protein with similarity to ribosomal protein L24 [600
           bp, 199 aa]
          Length = 199

 Score =  293 bits (750), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 146/152 (96%)

Query: 1   MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLKWTKAFRKAAG 60
           MRIYQCHFCSSP YPGHGIMFVRNDAKEFRFCRSKCHK FKQRRNPRKLKWTKAFRKAAG
Sbjct: 1   MRIYQCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60

Query: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSRIEEIRQKRERAFYKNRMKGNSERDF 120
           KELAVDSTLTFAQRRNVPVRYNRELVATTLKAM+RIEEIRQKRERAFYKNRM+GN E+DF
Sbjct: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMARIEEIRQKRERAFYKNRMRGNKEKDF 120

Query: 121 LRDKKLVETNPELLRLREVEIANRLAKEQAAA 152
           LRDKKLVE+NPELLR+REVEIA +LAKEQ  A
Sbjct: 121 LRDKKLVESNPELLRIREVEIARKLAKEQERA 152

>Sklu_1938.5 YLR009W, Contig c1938 7059-7649
          Length = 196

 Score =  287 bits (735), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 144/150 (96%)

Query: 1   MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLKWTKAFRKAAG 60
           MRIY CHFCSSPVYP HGIMFVRNDAKEFRFCRSKCHK FKQRRNPRKLKWTKAFRKAAG
Sbjct: 1   MRIYSCHFCSSPVYPSHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60

Query: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSRIEEIRQKRERAFYKNRMKGNSERDF 120
           KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSRIEEIRQ+RERAFYKNRM+GN ER+F
Sbjct: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSRIEEIRQRRERAFYKNRMRGNKEREF 120

Query: 121 LRDKKLVETNPELLRLREVEIANRLAKEQA 150
           LRDK LVE+NPELL++REVEIAN+LA ++A
Sbjct: 121 LRDKSLVESNPELLKVREVEIANKLASKEA 150

>KLLA0E09416g complement(836948..837544) similar to sgd|S0003999
           Saccharomyces cerevisiae YLR009w, start by similarity
          Length = 198

 Score =  287 bits (735), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 136/150 (90%), Positives = 144/150 (96%)

Query: 1   MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLKWTKAFRKAAG 60
           MR+Y CHFCSSP YPGHGIMFVRNDAKEFRFCRSKCHK FKQRRNPRKL+WTKAFRKAAG
Sbjct: 1   MRVYACHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLRWTKAFRKAAG 60

Query: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSRIEEIRQKRERAFYKNRMKGNSERDF 120
           KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSRIEEIRQ+RERAFYKNRMKGN+ERDF
Sbjct: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSRIEEIRQRRERAFYKNRMKGNNERDF 120

Query: 121 LRDKKLVETNPELLRLREVEIANRLAKEQA 150
           LRDK LVE+NPELLRLREVE+A + AKE+A
Sbjct: 121 LRDKALVESNPELLRLREVELARQAAKEEA 150

>ADR346W [2087] [Homologous to ScYLR009W (RLP24) - SH]
           complement(1316666..1317259) [594 bp, 197 aa]
          Length = 197

 Score =  282 bits (722), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 135/152 (88%), Positives = 143/152 (94%), Gaps = 1/152 (0%)

Query: 1   MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLKWTKAFRKAAG 60
           MRIY CHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHK FKQRRNPRKLKWTKAFRKAAG
Sbjct: 1   MRIYSCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60

Query: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSRIEEIRQKRERAFYKNRMKGNSERDF 120
           KELAVDSTLTFAQRRNVPVRYNRELV TTLKAM+RIEEIRQKRERAFYKNRMKGN+E+DF
Sbjct: 61  KELAVDSTLTFAQRRNVPVRYNRELVETTLKAMTRIEEIRQKRERAFYKNRMKGNTEKDF 120

Query: 121 LRDKKLVETNPELLRLREVEIANRLAKEQAAA 152
           LRDKKLVE+NPELL++REVE+  R A+  AA 
Sbjct: 121 LRDKKLVESNPELLKMREVEL-QRQAERAAAG 151

>Kwal_33.15299
          Length = 196

 Score =  268 bits (686), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 123/141 (87%), Positives = 136/141 (96%)

Query: 1   MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLKWTKAFRKAAG 60
           MR+Y CHFCSSP YPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKL+WTKAFRKAAG
Sbjct: 1   MRVYSCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLRWTKAFRKAAG 60

Query: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSRIEEIRQKRERAFYKNRMKGNSERDF 120
           KELAVDSTL FAQRRNVPVRYNRELVATTL+AM+R+EEIRQ+RERAFYKNRM+GN ER+F
Sbjct: 61  KELAVDSTLAFAQRRNVPVRYNRELVATTLRAMARVEEIRQRRERAFYKNRMRGNKEREF 120

Query: 121 LRDKKLVETNPELLRLREVEI 141
           LRDK+LVE NPELL++R+VE+
Sbjct: 121 LRDKQLVERNPELLKVRDVEL 141

>YGR148C (RPL24B) [2103] chr7 complement(787315..787782) Ribosomal
          protein L24B (yeast L30; rp29; YL21; rat L24), nearly
          identical to Rpl24Ap [468 bp, 155 aa]
          Length = 155

 Score = 66.2 bits (160), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 37/57 (64%)

Query: 1  MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLKWTKAFRK 57
          M++    F  + +YPG G +FVR D+K FRF  SK    FKQR+NPR++ WT  FRK
Sbjct: 1  MKVEVDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRRIAWTVLFRK 57

>Sklu_1642.2 YGR148C, Contig c1642 2421-2870 reverse complement
          Length = 149

 Score = 65.5 bits (158), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 58/105 (55%), Gaps = 11/105 (10%)

Query: 1   MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLKWTKAFRKAAG 60
           M++    F  + +YPG G +FVR D+K FRF  SK    FKQR+NPRK+ WT  +R+   
Sbjct: 1   MKVEVDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRKIAWTVLYRRHHK 60

Query: 61  KELAVDSTLTFAQRRN-VPVRYNRELVATTLKAMSRIEEIRQKRE 104
           K +    T   A++R+   V+  R +V  +L      E I+Q+R 
Sbjct: 61  KGI----TEEVAKKRSRKTVKAQRAIVGASL------EFIKQRRS 95

>YGL031C (RPL24A) [1943] chr7 complement(437470..437937) Ribosomal
          protein L24A (yeast L30; rp29; YL21; rat L24), nearly
          identical to Rpl24Bp [468 bp, 155 aa]
          Length = 155

 Score = 65.5 bits (158), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 37/57 (64%)

Query: 1  MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLKWTKAFRK 57
          M++    F  + +YPG G +FVR D+K FRF  SK    FKQR+NPR++ WT  FRK
Sbjct: 1  MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRRIAWTVLFRK 57

>Kwal_14.2299
          Length = 155

 Score = 64.7 bits (156), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 52/91 (57%), Gaps = 5/91 (5%)

Query: 1  MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLKWTKAFRKAAG 60
          M++    F  + +YPG G +FVR D+K FRF  SK    FKQR+NPR++ WT  +R+   
Sbjct: 1  MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSSSLFKQRKNPRRIAWTVLYRRHHK 60

Query: 61 KELAVDSTLTFAQRRN-VPVRYNRELVATTL 90
          K +    T   A++R+   V+  R +V  +L
Sbjct: 61 KGI----TEEVAKKRSRKTVKSQRAIVGASL 87

>CAGL0A01562g 152953..153420 highly similar to sp|P24000
          Saccharomyces cerevisiae YGR148c RPL30B or sp|P04449
          Saccharomyces cerevisiae YGL031c RPL30A, start by
          similarity
          Length = 155

 Score = 63.9 bits (154), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 52/91 (57%), Gaps = 5/91 (5%)

Query: 1  MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLKWTKAFRKAAG 60
          M++    F  + +YPG G +FVR D+K FRF  SK    FKQR+NPR++ WT  +R+   
Sbjct: 1  MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRRVAWTVLYRRHHK 60

Query: 61 KELAVDSTLTFAQRRN-VPVRYNRELVATTL 90
          K +    T   A++R+   V+  R +V  +L
Sbjct: 61 KGI----TEEVAKKRSRKTVKAQRAIVGASL 87

>KLLA0E10857g 957487..957954 gi|730554|sp|P38665|RL24_KLULA
          Kluyveromyces lactis 60S RIBOSOMAL PROTEIN L24 (L30),
          start by similarity
          Length = 155

 Score = 62.0 bits (149), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 36/57 (63%)

Query: 1  MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLKWTKAFRK 57
          M++    F  + +YPG G +FVR D+K FRF  SK    F QR+NPR++ WT  +R+
Sbjct: 1  MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQSSKSASLFHQRKNPRRIAWTVLYRR 57

>AFR477C [3669] [Homologous to ScYGL031C (RPL24A) - SH; ScYGR148C
          (RPL24B) - SH] (1296295..1296762) [468 bp, 155 aa]
          Length = 155

 Score = 62.0 bits (149), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 51/91 (56%), Gaps = 5/91 (5%)

Query: 1  MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLKWTKAFRKAAG 60
          M++    F  + +YPG G +FVR D+K FRF  SK    F QR+NPR++ WT  +R+   
Sbjct: 1  MKVEIDSFSGAKIYPGRGTLFVRGDSKVFRFHSSKSASLFHQRKNPRRIAWTVLYRRHHK 60

Query: 61 KELAVDSTLTFAQRRN-VPVRYNRELVATTL 90
          K +    T   A++R+   V+  R +V  +L
Sbjct: 61 KGI----TEEVAKKRSRKTVKAQRAVVGASL 87

>Scas_648.9
          Length = 155

 Score = 60.1 bits (144), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 49/90 (54%), Gaps = 3/90 (3%)

Query: 1  MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLKWTKAFRKAAG 60
          M++    F  + +YPG G +F+R D+K FRF  SK    F QR+NPR++ WT  +R+   
Sbjct: 1  MKVEIDSFSGNKIYPGRGTLFIRGDSKIFRFQNSKSASLFHQRKNPRRVAWTVLYRRHHK 60

Query: 61 KELAVDSTLTFAQRRNVPVRYNRELVATTL 90
          K +  + +    +R    V+  R +V  +L
Sbjct: 61 KGITEEVS---KKRTRKAVKAQRPIVGASL 87

>Scas_4.1
          Length = 66

 Score = 55.8 bits (133), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 33/52 (63%)

Query: 1  MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLKWT 52
          M++    F  + +YPG G +F+R D+K FRF  SK    F QR+NPR++ WT
Sbjct: 3  MKVEIDSFSGNKIYPGRGTLFIRGDSKIFRFQNSKSASLFHQRKNPRRVAWT 54

>KLLA0C11055g complement(950647..952293) similar to sp|P38775
           Saccharomyces cerevisiae YHR045w hypothetical protein
           singleton, start by similarity
          Length = 548

 Score = 30.8 bits (68), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 31/64 (48%), Gaps = 2/64 (3%)

Query: 49  LKWTKAFRKAAGKELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSRIEEIRQKRERAFY 108
           + W    +      + V ST+ F    +V +   R+L   +L A S +E +R++ E A Y
Sbjct: 2   VDWITFSKYLVAILVIVASTVWFIN--SVIIDSKRDLHTISLNAQSNVESVRKEHETAIY 59

Query: 109 KNRM 112
           +N +
Sbjct: 60  RNLL 63

>CAGL0L12584g complement(1351867..1352751) similar to tr|Q03080
           Saccharomyces cerevisiae YPL039w, hypothetical start
          Length = 294

 Score = 30.0 bits (66), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 42/89 (47%), Gaps = 11/89 (12%)

Query: 20  MFVRNDAKEFRFCRSKCHKNFKQRRNPRKLKWTKAFRK--AAGKELA---------VDST 68
           + +R   ++++  R K  K+ ++ R+PR ++ T    +  A   +LA         + ST
Sbjct: 153 ILIRRSREQYKAIRYKQMKDARRERDPRIIQLTNDMNEDTATMSDLALHNFLEPFDITST 212

Query: 69  LTFAQRRNVPVRYNRELVATTLKAMSRIE 97
            TF +R N+       L A+ +  MSR +
Sbjct: 213 FTFTKRNNIGTSAPASLGASMMLNMSRTD 241

>Sklu_1742.4 YGL145W, Contig c1742 3577-5634
          Length = 685

 Score = 28.9 bits (63), Expect = 2.7,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 5/60 (8%)

Query: 96  IEEIRQKRERAFYKNRMKGNSERDFLR-----DKKLVETNPELLRLREVEIANRLAKEQA 150
           I ++  +RER   + R K N E DFL      D  LV  + E+ +++ VE   +L ++  
Sbjct: 29  IGQVNNQRERLALQLRTKKNEEEDFLEHFVLMDVTLVTISEEISKVKSVEDIKKLREKHG 88

>CAGL0J09526g 931021..934236 similar to sp|P06777 Saccharomyces
           cerevisiae YPL022w RAD1 component of the nucleotide
           excision repairosome, start by similarity
          Length = 1071

 Score = 27.7 bits (60), Expect = 8.2,   Method: Composition-based stats.
 Identities = 26/102 (25%), Positives = 46/102 (45%), Gaps = 17/102 (16%)

Query: 49  LKWTKAFRKAAGKELAV-DSTLTFAQRRNVPVRYNRELVATTLKAMSRIEEIRQKRERAF 107
           + + K  R   G  L V ++  T  Q R V  +Y+ E     +  +S++E  + KRE   
Sbjct: 492 IAYEKTTRNIEGSTLIVCNNNTTVLQLRRVISKYDNEFGMRNI-MLSKLEWYKMKREE-- 548

Query: 108 YKNRMKGNSERDFLRDKKLVETNPELLRLREVEIANRLAKEQ 149
                     +  +RD K  ET PE+    ++ +++  AKE+
Sbjct: 549 ---------RKRIVRDFKKEETEPEV----QLSVSSSFAKEE 577

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.323    0.133    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,660,803
Number of extensions: 171493
Number of successful extensions: 695
Number of sequences better than 10.0: 36
Number of HSP's gapped: 693
Number of HSP's successfully gapped: 36
Length of query: 194
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 98
Effective length of database: 13,272,781
Effective search space: 1300732538
Effective search space used: 1300732538
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 59 (27.3 bits)