Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0J00935g1531515861e-78
Scas_590.71581214444e-57
YLR008C (PAM18)1681204394e-56
ADR345C1581214384e-56
KLLA0E09438g1631204176e-53
Sklu_1938.41641184142e-52
Kwal_33.152981711204031e-50
AGR393W142691532e-13
Sklu_2034.5142871523e-13
YNL328C (MDJ2)146661506e-13
Scas_716.461441351499e-13
CAGL0D02552g143791463e-12
Kwal_55.22136145741323e-10
KLLA0E02024g146691314e-10
Kwal_14.114395346631.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J00935g
         (151 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J00935g complement(95878..96339) highly similar to tr|Q0791...   230   1e-78
Scas_590.7                                                            175   4e-57
YLR008C (PAM18) [3426] chr12 complement(165576..166082) Protein ...   173   4e-56
ADR345C [2086] [Homologous to ScYLR008C - SH] (1315746..1316222)...   173   4e-56
KLLA0E09438g 838259..838750 similar to sgd|S0003998 Saccharomyce...   165   6e-53
Sklu_1938.4 YLR008C, Contig c1938 6198-6692 reverse complement        164   2e-52
Kwal_33.15298                                                         159   1e-50
AGR393W [4704] [Homologous to ScYNL328C (MDJ2) - SH] complement(...    64   2e-13
Sklu_2034.5 YNL328C, Contig c2034 7065-7493 reverse complement         63   3e-13
YNL328C (MDJ2) [4287] chr14 complement(22834..23274) Protein inv...    62   6e-13
Scas_716.46                                                            62   9e-13
CAGL0D02552g 261991..262422 similar to sp|P42834 Saccharomyces c...    61   3e-12
Kwal_55.22136                                                          55   3e-10
KLLA0E02024g complement(191062..191502) similar to sp|P42834 Sac...    55   4e-10
Kwal_14.1143                                                           29   1.7  

>CAGL0J00935g complement(95878..96339) highly similar to tr|Q07914
           Saccharomyces cerevisiae YLR008c, start by similarity
          Length = 153

 Score =  230 bits (586), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 119/151 (78%), Positives = 119/151 (78%)

Query: 1   MDGTGISDGSSVXXXXXXXXXXXXXXXXXSKQGMDLYFDNALQYMGEHPVLAGVGGFLAL 60
           MDGTGISDGSSV                 SKQGMDLYFDNALQYMGEHPVLAGVGGFLAL
Sbjct: 1   MDGTGISDGSSVTGDAAAGFPAGATQAPGSKQGMDLYFDNALQYMGEHPVLAGVGGFLAL 60

Query: 61  YVGAGVYKGVQTRLNGGKAATQFLKGGFDPKMNAKEALQIXXXXXXXXXXXXXXXVHRKI 120
           YVGAGVYKGVQTRLNGGKAATQFLKGGFDPKMNAKEALQI               VHRKI
Sbjct: 61  YVGAGVYKGVQTRLNGGKAATQFLKGGFDPKMNAKEALQILNLKENNLTTKKLKEVHRKI 120

Query: 121 MLANHPDKGGSPYLATKINEAKDFLEKKGIV 151
           MLANHPDKGGSPYLATKINEAKDFLEKKGIV
Sbjct: 121 MLANHPDKGGSPYLATKINEAKDFLEKKGIV 151

>Scas_590.7
          Length = 158

 Score =  175 bits (444), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 82/121 (67%), Positives = 88/121 (72%)

Query: 30  SKQGMDLYFDNALQYMGEHPVLAGVGGFLALYVGAGVYKGVQTRLNGGKAATQFLKGGFD 89
           +K GMDLYFD A+QYMG HPV+ GV  FL LY  AG YK + T+LNGGKA   FLKGGFD
Sbjct: 36  TKNGMDLYFDEAMQYMGRHPVMTGVAAFLTLYAAAGTYKSISTKLNGGKATATFLKGGFD 95

Query: 90  PKMNAKEALQIXXXXXXXXXXXXXXXVHRKIMLANHPDKGGSPYLATKINEAKDFLEKKG 149
            KMN KEALQI               VHRKIMLANHPDKGGSPYLATKINEAKDFLEKK 
Sbjct: 96  AKMNQKEALQILNLTENKLNMKKLKEVHRKIMLANHPDKGGSPYLATKINEAKDFLEKKS 155

Query: 150 I 150
           +
Sbjct: 156 V 156

>YLR008C (PAM18) [3426] chr12 complement(165576..166082) Protein
           containing a DnaJ domain, which are part of chaperone
           (protein folding) system that mediates interaction with
           heat shock proteins, has high similarity to C. albicans
           Orf6.3647p [507 bp, 168 aa]
          Length = 168

 Score =  173 bits (439), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 89/120 (74%)

Query: 31  KQGMDLYFDNALQYMGEHPVLAGVGGFLALYVGAGVYKGVQTRLNGGKAATQFLKGGFDP 90
           K GMDLYFD AL YMGEHPV+ G G FL LY  AG YK +   LNGGK+ T FLKGGFDP
Sbjct: 47  KTGMDLYFDQALNYMGEHPVITGFGAFLTLYFTAGAYKSISKGLNGGKSTTAFLKGGFDP 106

Query: 91  KMNAKEALQIXXXXXXXXXXXXXXXVHRKIMLANHPDKGGSPYLATKINEAKDFLEKKGI 150
           KMN+KEALQI               VHRKIMLANHPDKGGSP+LATKINEAKDFLEK+GI
Sbjct: 107 KMNSKEALQILNLTENTLTKKKLKEVHRKIMLANHPDKGGSPFLATKINEAKDFLEKRGI 166

>ADR345C [2086] [Homologous to ScYLR008C - SH] (1315746..1316222)
           [477 bp, 158 aa]
          Length = 158

 Score =  173 bits (438), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 93/121 (76%)

Query: 30  SKQGMDLYFDNALQYMGEHPVLAGVGGFLALYVGAGVYKGVQTRLNGGKAATQFLKGGFD 89
            K+GMDLYFD  + ++GEHPV+ G+GGF+ALY  AG+++ V  R+NGGK AT+FLKGGFD
Sbjct: 36  QKRGMDLYFDKVVDFVGEHPVVGGIGGFVALYAAAGLWRAVSIRMNGGKEATKFLKGGFD 95

Query: 90  PKMNAKEALQIXXXXXXXXXXXXXXXVHRKIMLANHPDKGGSPYLATKINEAKDFLEKKG 149
           PKMN KEAL I               VHRKIMLANHPDKGGSPYLATKINEAKDFLEK+G
Sbjct: 96  PKMNTKEALAILNLTESTLTKKRVKDVHRKIMLANHPDKGGSPYLATKINEAKDFLEKRG 155

Query: 150 I 150
           I
Sbjct: 156 I 156

>KLLA0E09438g 838259..838750 similar to sgd|S0003998 Saccharomyces
           cerevisiae YLR008c, start by similarity
          Length = 163

 Score =  165 bits (417), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 81/120 (67%), Positives = 86/120 (71%)

Query: 31  KQGMDLYFDNALQYMGEHPVLAGVGGFLALYVGAGVYKGVQTRLNGGKAATQFLKGGFDP 90
           K GMDLYFD AL YMG+HPVL GVGGF ALY  AG YK V  RL G     ++LKGGFDP
Sbjct: 42  KSGMDLYFDQALDYMGDHPVLTGVGGFFALYFAAGAYKSVSKRLGGSSQGVKYLKGGFDP 101

Query: 91  KMNAKEALQIXXXXXXXXXXXXXXXVHRKIMLANHPDKGGSPYLATKINEAKDFLEKKGI 150
           KMNAKEAL I               VHR+IMLANHPDKGGSPYLATKINEAKDFLEKK +
Sbjct: 102 KMNAKEALAILNLNETNLSKKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKKVV 161

>Sklu_1938.4 YLR008C, Contig c1938 6198-6692 reverse complement
          Length = 164

 Score =  164 bits (414), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 79/118 (66%), Positives = 86/118 (72%)

Query: 33  GMDLYFDNALQYMGEHPVLAGVGGFLALYVGAGVYKGVQTRLNGGKAATQFLKGGFDPKM 92
           GMDLYFD AL  MG+HPVL G+GGF  LY  AG Y+ V T+L G   A +FLKGGFDPKM
Sbjct: 45  GMDLYFDQALDVMGQHPVLTGIGGFFTLYFLAGAYRSVSTKLGGNTGAAKFLKGGFDPKM 104

Query: 93  NAKEALQIXXXXXXXXXXXXXXXVHRKIMLANHPDKGGSPYLATKINEAKDFLEKKGI 150
           NA EALQI               VHR+IMLANHPDKGGSPYLATKINEAKDFLEK+GI
Sbjct: 105 NAGEALQILNLNESTLTKKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKRGI 162

>Kwal_33.15298
          Length = 171

 Score =  159 bits (403), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 87/120 (72%)

Query: 31  KQGMDLYFDNALQYMGEHPVLAGVGGFLALYVGAGVYKGVQTRLNGGKAATQFLKGGFDP 90
           K GMD  FD+AL +MG+HPVL+G GGFL LY  AG +K V   L GG A TQ+ KGGFDP
Sbjct: 50  KGGMDQAFDDALAFMGQHPVLSGFGGFLGLYFAAGAFKSVSRALGGGAATTQYAKGGFDP 109

Query: 91  KMNAKEALQIXXXXXXXXXXXXXXXVHRKIMLANHPDKGGSPYLATKINEAKDFLEKKGI 150
           KMN KEA+QI               VHR+IMLANHPDKGGSPYLATKINEAKDFLEK+G+
Sbjct: 110 KMNVKEAMQILNLNENSLNRKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKRGV 169

>AGR393W [4704] [Homologous to ScYNL328C (MDJ2) - SH]
           complement(1451330..1451758) [429 bp, 142 aa]
          Length = 142

 Score = 63.5 bits (153), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 40/69 (57%), Gaps = 3/69 (4%)

Query: 86  GGFDPKMNAKEA---LQIXXXXXXXXXXXXXXXVHRKIMLANHPDKGGSPYLATKINEAK 142
           GGF  +MN  EA   LQI                HR+ ML NHPDKGGSPY+A KINEA+
Sbjct: 73  GGFYKRMNEVEAMLILQITGDEIKLLDRNMLKKKHRRAMLLNHPDKGGSPYVAMKINEAR 132

Query: 143 DFLEKKGIV 151
           D +E+  +V
Sbjct: 133 DVMEQSSLV 141

>Sklu_2034.5 YNL328C, Contig c2034 7065-7493 reverse complement
          Length = 142

 Score = 63.2 bits (152), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 37/87 (42%), Positives = 49/87 (56%), Gaps = 10/87 (11%)

Query: 64  AGVYKGVQTRLNGGKAATQFLKGGFDPKMNAKEALQIXXXXXXXXXXXXXXXV---HRKI 120
           +G+ + +Q+RLN      Q+  GGF  +M   EAL I               +   HR+ 
Sbjct: 55  SGLNQELQSRLN------QY-PGGFYSRMTETEALLILGISSEEIEHLNATMLKRKHRRA 107

Query: 121 MLANHPDKGGSPYLATKINEAKDFLEK 147
           ML NHPDKGGSPYLA KINEA++ LE+
Sbjct: 108 MLQNHPDKGGSPYLAMKINEARETLER 134

>YNL328C (MDJ2) [4287] chr14 complement(22834..23274) Protein
           involved in import and folding of mitochondrial
           proteins, has similarity to E. coli DnaJ and other
           DnaJ-like proteins, function partially overlaps that of
           Mdj1p [441 bp, 146 aa]
          Length = 146

 Score = 62.4 bits (150), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 39/66 (59%), Gaps = 3/66 (4%)

Query: 85  KGGFDPKMNAKEALQIXXXXXXXXXXXXXXXV---HRKIMLANHPDKGGSPYLATKINEA 141
           +GGF P+M   EAL I               +   HRK M+ NHPD+GGSPY+A KINEA
Sbjct: 74  QGGFAPRMTEPEALLILDISAREINHLDEKLLKKKHRKAMVRNHPDRGGSPYMAAKINEA 133

Query: 142 KDFLEK 147
           K+ LE+
Sbjct: 134 KEVLER 139

>Scas_716.46
          Length = 144

 Score = 62.0 bits (149), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 61/135 (45%), Gaps = 37/135 (27%)

Query: 49  PVLAGVG-GFLALYVGAG-----VYKGVQ----TRLNGGKAAT----------------- 81
           P++ GVG  F+A+ + +G     VYK +      R+NG +                    
Sbjct: 4   PLILGVGVTFVAVTIRSGLRAWIVYKSLTPIMIARMNGIRITRSEINYTNKFQSTKLSNE 63

Query: 82  ------QFLKGGFDPKMNAKEA---LQIXXXXXXXXXXXXXXXVHRKIMLANHPDKGGSP 132
                 QF +GGF P M   EA   L I                HR  M+ NHPDKGGSP
Sbjct: 64  LKTKLDQF-QGGFYPTMTESEAILILDISSKDIKKLDEKLLKRKHRGAMILNHPDKGGSP 122

Query: 133 YLATKINEAKDFLEK 147
           YLATKINEA++ LE+
Sbjct: 123 YLATKINEAREVLER 137

>CAGL0D02552g 261991..262422 similar to sp|P42834 Saccharomyces
           cerevisiae YNL328c MDJ2 heat shock protein - chaperone,
           start by similarity
          Length = 143

 Score = 60.8 bits (146), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/79 (46%), Positives = 42/79 (53%), Gaps = 4/79 (5%)

Query: 73  RLNGG-KAATQFLKGGFDPKMNAKEALQIXXXXXXXXXXXXXXXV---HRKIMLANHPDK 128
           RLN G K      +GGF   M+  EAL I               +   HR  ML NHPDK
Sbjct: 59  RLNPGLKMQLNKWEGGFYHPMSESEALMILNITQKEIMSLNAPLLKKKHRLAMLKNHPDK 118

Query: 129 GGSPYLATKINEAKDFLEK 147
           GGSPYL+ KINEAK+ LEK
Sbjct: 119 GGSPYLSAKINEAKELLEK 137

>Kwal_55.22136
          Length = 145

 Score = 55.5 bits (132), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 38/74 (51%), Gaps = 3/74 (4%)

Query: 76  GGKAATQFLKGGFDPKMNAKEALQIXXXXXXXXXXXXXXXV---HRKIMLANHPDKGGSP 132
           G KA      GGF  KM   EAL I               +   HR+ ++ NHPD+GGSP
Sbjct: 65  GLKARLNQYGGGFSSKMTDSEALLILGISGSEVAALDENLLKRKHRQAIVHNHPDRGGSP 124

Query: 133 YLATKINEAKDFLE 146
           YLA KINEA+D L 
Sbjct: 125 YLALKINEARDILS 138

>KLLA0E02024g complement(191062..191502) similar to sp|P42834
           Saccharomyces cerevisiae YNL328c MDJ2 heat shock protein
           - chaperone singleton, start by similarity
          Length = 146

 Score = 55.1 bits (131), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 39/69 (56%), Gaps = 3/69 (4%)

Query: 86  GGFDPKMNAKEALQIXXXXXXXXXXXXXXXV---HRKIMLANHPDKGGSPYLATKINEAK 142
           GGF  KM+  EAL I               +   HR+ M+ NHPDKGGSP++A+KIN+A+
Sbjct: 73  GGFYDKMSETEALLILGISAREIEALDERLLRQKHRRAMIMNHPDKGGSPFIASKINQAR 132

Query: 143 DFLEKKGIV 151
           D L    I+
Sbjct: 133 DLLANSVIL 141

>Kwal_14.1143
          Length = 953

 Score = 28.9 bits (63), Expect = 1.7,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 2/46 (4%)

Query: 41  ALQYMGEHPVLAGVGGFLALYVGAGVYKGVQTRLNGGKAATQFLKG 86
            L  +G   VL   GG LA  +GAG+  G+ T   G   AT FL G
Sbjct: 444 GLATIGGSVVLGLSGGLLAPVIGAGIAAGLSTA--GITGATGFLTG 487

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.138    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,668,104
Number of extensions: 108692
Number of successful extensions: 239
Number of sequences better than 10.0: 19
Number of HSP's gapped: 236
Number of HSP's successfully gapped: 19
Length of query: 151
Length of database: 16,596,109
Length adjustment: 92
Effective length of query: 59
Effective length of database: 13,411,253
Effective search space: 791263927
Effective search space used: 791263927
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 57 (26.6 bits)