Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0I08613g55955024830.0
Scas_576.0d48947416880.0
Kwal_56.2339053350815440.0
KLLA0C11913g52949715120.0
AGR155C49541010071e-131
CAGL0K03157g7242051381e-08
Kwal_55.221736591991336e-08
YHL016C (DUR3)7352061283e-07
Kwal_14.803693189820.072
KLLA0F28083g698297810.11
Kwal_33.12966702192790.16
KLLA0C18909g692134780.24
Kwal_26.8136721173750.47
KLLA0C17468g723114740.60
Sklu_2444.8695134721.1
ABR043W686207711.3
Scas_709.61738176702.2
CAGL0H08778g106562666.3
Scas_686.738926656.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0I08613g
         (550 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0I08613g complement(839912..841591) weakly similar to sp|P33...   961   0.0  
Scas_576.0d                                                           654   0.0  
Kwal_56.23390                                                         599   0.0  
KLLA0C11913g complement(1024233..1025822) similar to ca|CA4263|I...   587   0.0  
AGR155C [4466] [Homologous to NOHBY] (1041283..1042770) [1488 bp...   392   e-131
CAGL0K03157g 290552..292726 highly similar to sp|P33413 Saccharo...    58   1e-08
Kwal_55.22173                                                          56   6e-08
YHL016C (DUR3) [2270] chr8 complement(72033..74240) Urea permeas...    54   3e-07
Kwal_14.803                                                            36   0.072
KLLA0F28083g complement(2594274..2596370) similar to ca|CA5245|C...    36   0.11 
Kwal_33.12966                                                          35   0.16 
KLLA0C18909g complement(1676552..1678630) similar to ca|CA4384|C...    35   0.24 
Kwal_26.8136                                                           33   0.47 
KLLA0C17468g complement(1532768..1534939) similar to sp|P33413 S...    33   0.60 
Sklu_2444.8 , Contig c2444 22738-24825 reverse complement              32   1.1  
ABR043W [634] [Homologous to ScYHL016C (DUR3) - SH] complement(4...    32   1.3  
Scas_709.61                                                            32   2.2  
CAGL0H08778g 854147..857344 some similarities with tr|Q12221 Sac...    30   6.3  
Scas_686.7                                                             30   6.4  

>CAGL0I08613g complement(839912..841591) weakly similar to sp|P33413
           Saccharomyces cerevisiae YHL016c DUR3, hypothetical
           start
          Length = 559

 Score =  961 bits (2483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/550 (88%), Positives = 487/550 (88%)

Query: 1   MGHLSIPAAHAIIWPTYGVLLITASMVAYWKRDSKTFLSANGTQKAIPLAFNFVASGLGC 60
           MGHLSIPAAHAIIWPTYGVLLITASMVAYWKRDSKTFLSANGTQKAIPLAFNFVASGLGC
Sbjct: 1   MGHLSIPAAHAIIWPTYGVLLITASMVAYWKRDSKTFLSANGTQKAIPLAFNFVASGLGC 60

Query: 61  GVLSTYPQIANLDGLHGLLVYALAGGLPMFVFAFLGPLIRKKTPSGFVLTEWVFHRFGLL 120
           GVLSTYPQIANLDGLHGLLVYALAGGLPMFVFAFLGPLIRKKTPSGFVLTEWVFHRFGLL
Sbjct: 61  GVLSTYPQIANLDGLHGLLVYALAGGLPMFVFAFLGPLIRKKTPSGFVLTEWVFHRFGLL 120

Query: 121 CGWYLSACTILTVYLFLVSEVASLKYAIDTLTNINSLPVIIIECVVTTIYTSIGGFHISF 180
           CGWYLSACTILTVYLFLVSEVASLKYAIDTLTNINSLPVIIIECVVTTIYTSIGGFHISF
Sbjct: 121 CGWYLSACTILTVYLFLVSEVASLKYAIDTLTNINSLPVIIIECVVTTIYTSIGGFHISF 180

Query: 181 MTDSLQVSIVFILLVIVAAAMGSRIHIDRDLIGPSGLLKGNKLGWQLVYILTVAIFTNDF 240
           MTDSLQVSIVFILLVIVAAAMGSRIHIDRDLIGPSGLLKGNKLGWQLVYILTVAIFTNDF
Sbjct: 181 MTDSLQVSIVFILLVIVAAAMGSRIHIDRDLIGPSGLLKGNKLGWQLVYILTVAIFTNDF 240

Query: 241 FMSGFWLRTFASRSNKDLLIGCSLACFILXXXXXXXXXXXXIAVWAGLLPARDQENSGAA 300
           FMSGFWLRTFASRSNKDLLIGCSLACFIL            IAVWAGLLPARDQENSGAA
Sbjct: 241 FMSGFWLRTFASRSNKDLLIGCSLACFILVTFVTVVGVTGFIAVWAGLLPARDQENSGAA 300

Query: 301 FYLLLAQLPSWIIGFTLVFVAVLSTCTLDSLQSALVSTISNDVFRNKLHIMLXXXXXXXX 360
           FYLLLAQLPSWIIGFTLVFVAVLSTCTLDSLQSALVSTISNDVFRNKLHIML        
Sbjct: 301 FYLLLAQLPSWIIGFTLVFVAVLSTCTLDSLQSALVSTISNDVFRNKLHIMLVRGIVVAI 360

Query: 361 XXXXXXXGLIAQDXXXXXXXXXXXXXXXXXXXXXXXWGKLDEIWSAWEVIGGGCAGILGV 420
                  GLIAQD                       WGKLDEIWSAWEVIGGGCAGILGV
Sbjct: 361 MVPVVVVGLIAQDVLSIYLIVDLLSSSVVPVLVVGLWGKLDEIWSAWEVIGGGCAGILGV 420

Query: 421 WIFGTVYYHSAKEGGRLLLISNGLYADDWXXXXXXXXXXXXXLVCSVIILAIRLSLMKLY 480
           WIFGTVYYHSAKEGGRLLLISNGLYADDW             LVCSVIILAIRLSLMKLY
Sbjct: 421 WIFGTVYYHSAKEGGRLLLISNGLYADDWGAFGAFVVAPGAGLVCSVIILAIRLSLMKLY 480

Query: 481 KKNPEGRFHRTCNKLGQVTGITRLYHFVNYWDSRLIDRSATEELPSDISLRSDEEDNKKS 540
           KKNPEGRFHRTCNKLGQVTGITRLYHFVNYWDSRLIDRSATEELPSDISLRSDEEDNKKS
Sbjct: 481 KKNPEGRFHRTCNKLGQVTGITRLYHFVNYWDSRLIDRSATEELPSDISLRSDEEDNKKS 540

Query: 541 MESIRVHELS 550
           MESIRVHELS
Sbjct: 541 MESIRVHELS 550

>Scas_576.0d
          Length = 489

 Score =  654 bits (1688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/474 (71%), Positives = 376/474 (79%)

Query: 1   MGHLSIPAAHAIIWPTYGVLLITASMVAYWKRDSKTFLSANGTQKAIPLAFNFVASGLGC 60
           MG LS   A+AIIWPTY VLLI+AS +AYWKRDSK+FLS+NGTQKA+PLAFNFVASGLGC
Sbjct: 12  MGILSAVTANAIIWPTYMVLLISASAIAYWKRDSKSFLSSNGTQKALPLAFNFVASGLGC 71

Query: 61  GVLSTYPQIANLDGLHGLLVYALAGGLPMFVFAFLGPLIRKKTPSGFVLTEWVFHRFGLL 120
           GVLS YPQIAN+DGLHGLLVYA++GGLPMFVFA+LGPLIRKKTP GFVLTEWVFHRFGL+
Sbjct: 72  GVLSAYPQIANIDGLHGLLVYAISGGLPMFVFAWLGPLIRKKTPKGFVLTEWVFHRFGLI 131

Query: 121 CGWYLSACTILTVYLFLVSEVASLKYAIDTLTNINSLPVIIIECVVTTIYTSIGGFHISF 180
           CGWYLSACTILTVYLFLVSEVASLKY I+T+T I +LPVIIIECVVTTIYTSIGGF+ISF
Sbjct: 132 CGWYLSACTILTVYLFLVSEVASLKYCIETMTTIKALPVIIIECVVTTIYTSIGGFNISF 191

Query: 181 MTDSLQVSIVFILLVIVAAAMGSRIHIDRDLIGPSGLLKGNKLGWQLVYILTVAIFTNDF 240
           +TD LQVS VF+LL+IVA AMGS I IDR LIGPSGLLK NKLGWQLVYILT AIFTNDF
Sbjct: 192 ITDFLQVSTVFVLLIIVACAMGSYIEIDRSLIGPSGLLKQNKLGWQLVYILTFAIFTNDF 251

Query: 241 FMSGFWLRTFASRSNKDLLIGCSLACFILXXXXXXXXXXXXIAVWAGLLPARDQENSGAA 300
           FMSGFWLRTFASRS+KDL+IGCS+AC IL            IAVWAGL+   D+ENSGAA
Sbjct: 252 FMSGFWLRTFASRSDKDLMIGCSVACVILVVFCTVVGVTGFIAVWAGLVQVADEENSGAA 311

Query: 301 FYLLLAQLPSWIIGFTLVFVAVLSTCTLDSLQSALVSTISNDVFRNKLHIMLXXXXXXXX 360
           F++LLAQLP+W++GFT+VFV VLSTCTLDSLQSALVSTISNDVFRN+LHIM         
Sbjct: 312 FFILLAQLPTWVMGFTMVFVTVLSTCTLDSLQSALVSTISNDVFRNRLHIMWVRGIVVLI 371

Query: 361 XXXXXXXGLIAQDXXXXXXXXXXXXXXXXXXXXXXXWGKLDEIWSAWEVIGGGCAGILGV 420
                  GLIA++                       W K D++W+AWEVIGGG  GIL V
Sbjct: 372 MVPVVVVGLIAENVLNIYLIVDLLSSSVVPVLVLGFWSKFDDLWTAWEVIGGGLGGILSV 431

Query: 421 WIFGTVYYHSAKEGGRLLLISNGLYADDWXXXXXXXXXXXXXLVCSVIILAIRL 474
           WIFGTVYYHSA+EGGRLLLISNGLY DDW             LV S  IL IRL
Sbjct: 432 WIFGTVYYHSAREGGRLLLISNGLYVDDWSTFGAFVVAPGGGLVFSGFILVIRL 485

>Kwal_56.23390
          Length = 533

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/508 (58%), Positives = 366/508 (72%), Gaps = 20/508 (3%)

Query: 1   MGHLSIPAAHAIIWPTYGVLLITASMVAYWKRDSKTFLSANGTQKAIPLAFNFVASGLGC 60
           MGHLS+PAAH IIWP YGVLL+TA  VAYWK+D+KTFLSANGTQK +PLAFNFVAS LG 
Sbjct: 1   MGHLSVPAAHGIIWPMYGVLLLTACAVAYWKKDAKTFLSANGTQKGVPLAFNFVASALGV 60

Query: 61  GVLSTYPQIANLDGLHGLLVYALAGGLPMFVFAFLGPLIRKKTPSGFVLTEWVFHRFGLL 120
           GV STYPQIAN+ GLHGLLVYALAGGLPMF+FAF GP+IRKK P GFVLTEWVFHR+G++
Sbjct: 61  GVFSTYPQIANISGLHGLLVYALAGGLPMFLFAFFGPIIRKKVPHGFVLTEWVFHRYGVV 120

Query: 121 CGWYLSACTILTVYLFLVSEVASLKYAIDTLTNINSLPVIIIECVVTTIYTSIGGFHISF 180
            G YLSACTILT++LF+VSE+ASLK+ I++LT+I +LPV+I+ECV+TTIYT++GGFHISF
Sbjct: 121 GGLYLSACTILTLFLFMVSELASLKFCIESLTSIKALPVVIVECVITTIYTTVGGFHISF 180

Query: 181 MTDSLQVSIVFILLVIVAAAMGSRIHIDRDLIGPSGLLKGNKLGWQLVYILTVAIFTNDF 240
           +TD++QVS+VF++LVIVA AMG+ I ID   IGPSGLLK NKLGWQLVYIL VAIFTNDF
Sbjct: 181 LTDTMQVSVVFVILVIVACAMGNYIEIDTSKIGPSGLLKQNKLGWQLVYILVVAIFTNDF 240

Query: 241 FMSGFWLRTFASRSNKDLLIGCSLACFILXXXXXXXXXXXXIAVWAGLLPARDQENSGAA 300
           F+SGFWLRTFA+R++KDLLIGCSLA  +L            +AVWAGL+   DQE  G++
Sbjct: 241 FLSGFWLRTFAARTDKDLLIGCSLAFAVLVAIVALIGVTGFLAVWAGLVEVADQELGGSS 300

Query: 301 FYLLLAQLPSWIIGFTLVFVAVLSTCTLDSLQSALVSTISNDVFRNKLHIMLXXXXXXXX 360
           F++LL  +PSW++GF L F+ +LSTCTLDSLQSA+VSTISND+FRNKL ++         
Sbjct: 301 FFILLTAMPSWVMGFVLAFITILSTCTLDSLQSAMVSTISNDLFRNKLPLIYVRGLVALI 360

Query: 361 XXXXXXXGLIAQDXXXXXXXXXXXXXXXXXXXXXXXWGKLDEIWSAWEVIGGGCAGILGV 420
                  GLIA+D                       W +L  + SAWE++GGG  GI  V
Sbjct: 361 MVPVVVVGLIAEDVLSIFLIVDLLSSAVVPVLMLGLWSRLFFL-SAWEIVGGGLGGIFAV 419

Query: 421 WIFGTVYYHSAKEGGRLLLISNGL--------YADDWXXXXXXXXXXXXXLVCSVIILAI 472
           WIFGTVYY S +EGGRLLL+SNGL        Y +DW             ++   +ILA+
Sbjct: 420 WIFGTVYYDSPREGGRLLLVSNGLYGQDSQGVYGNDWSAFGAFVVAPFGGMLAGFLILAL 479

Query: 473 RLSLMKL-----------YKKNPEGRFH 489
           R +++ L           YKK P     
Sbjct: 480 RTAVVYLRCRSKGLEFDMYKKPPAAELQ 507

>KLLA0C11913g complement(1024233..1025822) similar to
           ca|CA4263|IPF2277 Candida albicans unknown function,
           start by similarity
          Length = 529

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/497 (60%), Positives = 359/497 (72%), Gaps = 3/497 (0%)

Query: 1   MGHLSIPAAHAIIWPTYGVLLITASMVAYWK--RDSKTFLSANGTQKAIPLAFNFVASGL 58
           MG +S  AAH I+WPTY V+L+ AS++A+WK     KTFLSANGTQ+ +PLAFNFVAS L
Sbjct: 1   MGSISEAAAHGIVWPTYIVMLVCASLLAFWKFSDKPKTFLSANGTQRGVPLAFNFVASAL 60

Query: 59  GCGVLSTYPQIANLDGLHGLLVYALAGGLPMFVFAFLGPLIRKKTPSGFVLTEWVFHRFG 118
           GCGVLS YPQIAN+DGL GLLVY+LAG LPMF+FAF GP+IRKK P GFVLTEWV  RFG
Sbjct: 61  GCGVLSAYPQIANIDGLQGLLVYSLAGSLPMFIFAFFGPIIRKKCPDGFVLTEWVIRRFG 120

Query: 119 LLCGWYLSACTILTVYLFLVSEVASLKYAIDTLTNINSLPVIIIECVVTTIYTSIGGFHI 178
           ++CGWYLSACTI+T++LF+VSE+ASLKYAI++LT I +LPVII+ECVVTTIYTSIGGFHI
Sbjct: 121 IICGWYLSACTIITIFLFMVSELASLKYAIESLTKIKALPVIIVECVVTTIYTSIGGFHI 180

Query: 179 SFMTDSLQVSIVFILLVIVAAAMGSRIHIDRDLIGPSGLLKGNKLGWQLVYILTVAIFTN 238
           SF+TD++QVSIVFILL+IV+ AMGS +HID+ LI  SGLLK + LGWQLVYILTVAIFTN
Sbjct: 181 SFITDTIQVSIVFILLIIVSCAMGSYVHIDKSLIAESGLLKASTLGWQLVYILTVAIFTN 240

Query: 239 DFFMSGFWLRTFASRSNKDLLIGCSLACFILXXXXXXXXXXXXIAVWAGLLPARDQENSG 298
           DFFMSGFWLRTFA+R++KDL+IGCS+A  IL            IAVWAG +P  DQENSG
Sbjct: 241 DFFMSGFWLRTFAARTDKDLMIGCSIAAVILAVFVTVIGVTGMIAVWAGYMPVADQENSG 300

Query: 299 AAFYLLLAQLPSWIIGFTLVFVAVLSTCTLDSLQSALVSTISNDVFRNKLHIMLXXXXXX 358
           AAF+++L Q+P W+IGF L FV +LSTCTLDSLQSALVSTISND+FRNKL I+       
Sbjct: 301 AAFFIVLTQMPGWVIGFVLAFVVMLSTCTLDSLQSALVSTISNDIFRNKLPIIWIRGIVV 360

Query: 359 XXXXXXXXXGLIAQDXXXXXXXXXXXXXXXXXXXXXXXWGKLDEIWSAWEVIGGGCAGIL 418
                    GLIA D                         K D + +AWE+IGGG  G+L
Sbjct: 361 LIMVPVVVVGLIADDVLTIYLIVDLLSSSVVPILMLGLSSKFDFL-TAWEIIGGGFGGLL 419

Query: 419 GVWIFGTVYYHSAKEGGRLLLISNGLYADDWXXXXXXXXXXXXXLVCSVIILAIRLSLMK 478
            VWIFGTVYY S +EGG+LLLI NGLYADDW             L+    +L +R  ++ 
Sbjct: 420 SVWIFGTVYYDSPREGGKLLLIWNGLYADDWAAFGAFVVAPFGGLIFGFFVLFVRTIIVY 479

Query: 479 LYKKNPEGRFHRTCNKL 495
           +  K     F     K 
Sbjct: 480 IDCKKNNKPFDLYSKKF 496

>AGR155C [4466] [Homologous to NOHBY] (1041283..1042770) [1488 bp,
           495 aa]
          Length = 495

 Score =  392 bits (1007), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 233/410 (56%), Positives = 289/410 (70%), Gaps = 3/410 (0%)

Query: 1   MGHLSIPAAHAIIWPTYGVLLITASMVAYWKRDSKTFLSANGTQKAIPLAFNFVASGLGC 60
           MG LS  AA+AI+WPTY V+L  AS++AY  R+ +TFLSANGTQKA+PLA NF+ASGLGC
Sbjct: 62  MGKLSYVAANAIVWPTYAVMLAVASVLAYRLRNVRTFLSANGTQKAVPLALNFIASGLGC 121

Query: 61  GVLSTYPQIANLDGLHGLLVYALAGGLPMFVFAFLGPLIRKKTPSGFVLTEWVFHRFGLL 120
           GVL  YPQ+AN+ GL GLLVY L   LPM+VFAF GPLI++  P GFVLTEWV  RFG +
Sbjct: 122 GVLLAYPQMANVAGLQGLLVYVLTSALPMYVFAFFGPLIKQTCPDGFVLTEWVLRRFGRV 181

Query: 121 CGWYLSACTILTVYLFLVSEVASLKYAIDTLTNINSLPVIIIECVVTTIYTSIGGFHISF 180
              YLSACTILT+YLF+VSE+ SL+ A+  L+NI  +PV++++CVVTTIYT+IGGFHISF
Sbjct: 182 AALYLSACTILTLYLFMVSEIVSLRLAVQALSNIKPIPVVVVQCVVTTIYTAIGGFHISF 241

Query: 181 MTDSLQVSIVFILLVIVAAAMGSRIHIDRDLIGPSGLLKGNKLGWQLVYILTVAIFTNDF 240
           +TDSLQ ++V +L+V+ A A+G+ + ID   IGPSGLL+ ++LGWQLVYILTVAIFTNDF
Sbjct: 242 VTDSLQATVVLLLVVVGAVAVGTSVKIDPARIGPSGLLRPSRLGWQLVYILTVAIFTNDF 301

Query: 241 FMSGFWLRTFASRSNKDLLIGCSLACFILXXXXXXXXXXXXIAVWAGLLPARDQENSGAA 300
           FMSGFWLRTFA+RSN+DLL+GCSLA  +L            +AVWAG  P  D ++  A+
Sbjct: 302 FMSGFWLRTFAARSNRDLLLGCSLAAVLLAVVLLLVGVTGLLAVWAGYAPVADLDS--AS 359

Query: 301 FYLLLAQLPSWIIGFTLVFVAVLSTCTLDSLQSALVSTISNDVFRNKLHIMLXXXXXXXX 360
           F+LLLA LP+W  G  L  V VLSTCTLDS QSALVSTISND+FRN+L  +         
Sbjct: 360 FFLLLAALPAWANGVVLALVVVLSTCTLDSFQSALVSTISNDLFRNRLPPLYARAAVAVV 419

Query: 361 XXXXXXXGLIAQDXXXXXXXXXXXXXXXXXXXXXXXWGKLDEIWSAWEVI 410
                  GL+A D                       W +   + SAWE+I
Sbjct: 420 MVPVVVVGLLATDILAIYLIVDLLSAAVVPVMLLGFWPRAARL-SAWELI 468

>CAGL0K03157g 290552..292726 highly similar to sp|P33413
           Saccharomyces cerevisiae YHL016c Urea active
           transporter, start by similarity
          Length = 724

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/205 (25%), Positives = 93/205 (45%), Gaps = 15/205 (7%)

Query: 18  GVLLITASMVAYWKR--DSKTFLSANGTQKAIPLAFNFVASGLGCGVLSTYPQIANLDGL 75
           G++L T  +  Y K    ++ F +A  T K   +A   V+S + C  L T      LDG+
Sbjct: 27  GMILTTYMLRRYQKEIITAEEFTTAGRTVKTGLVAAAVVSSWIWCSTLLTSAS-KQLDGM 85

Query: 76  HGLLVYALAGGLPMFVFAFLGPLIRKKTPSGFVLTEWVFHRFGLL--CGW--YLSACTIL 131
            G   Y+      +  FA L    ++K P+     E V  R+G +  C +  Y  A  IL
Sbjct: 86  LGGYSYSAGACFQIVAFAILAIKTKQKAPNAHTYLELVRKRYGKIGHCCYLFYAFATNIL 145

Query: 132 TVYLFLVSEVASLKYAIDTLTNINSLPVIIIECVVTTIYTSIGGFHISFMTDSLQVSIVF 191
              + L S  A      +++T +NS+    +  V   IYT  GG   +F+TD +   ++ 
Sbjct: 146 VTAMLLTSGAA----VFESMTGMNSVASCFLLPVGVVIYTLFGGIKATFLTDFIHTCVII 201

Query: 192 ILLVIVAAAMGSRIHIDRDLIGPSG 216
           +++++ A     +++   D++G  G
Sbjct: 202 VIIMVFAF----KVYATSDVLGSPG 222

>Kwal_55.22173
          Length = 659

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 49/199 (24%), Positives = 100/199 (50%), Gaps = 33/199 (16%)

Query: 70  ANLDGLHGLLVYALAGGLPMFVFAFLGPLIRKKTPSGFVLTEWVFHRFG------LLCGW 123
           A L G+ G  +YA+ G + + +FAFL   I+++ PS   ++E ++ RFG       LC  
Sbjct: 79  AYLHGISGAWLYAVGGTIQITLFAFLALQIKQRAPSAHTVSEMLYVRFGKSGHIMYLC-- 136

Query: 124 YLSACTILTVYLFLV--SEVASLKYAIDTLTNINSLPVIIIECVVTTIYTSIGGFHISFM 181
           Y +A  ++   L L+  S+  +    + T+     LP+ ++      +YT++GG   +F+
Sbjct: 137 YCAATNVMVSSLLLLGGSQAFAAATGMHTVAASFLLPLNVV------VYTALGGLKATFI 190

Query: 182 TDSLQVSIVFILLVIVAAAMGSRIHIDRDLIGPSGLLKGNKLGWQLVYILTVAIFTNDFF 241
           +D +   I++++L+         ++ +  LIG  G +      W+L+    VA  ++   
Sbjct: 191 SDWVHTVIIYVILLTTCYT----VYCNSSLIGSPGKM------WELLKDAQVAFPSS--- 237

Query: 242 MSGFWLRTFASRSNKDLLI 260
            SG   +++ S  +KD+++
Sbjct: 238 -SG---KSYLSFKDKDMIL 252

>YHL016C (DUR3) [2270] chr8 complement(72033..74240) Urea permease,
           member of the solute:sodium symporter (SSS) family of
           membrane transporters [2208 bp, 735 aa]
          Length = 735

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/206 (22%), Positives = 92/206 (44%), Gaps = 15/206 (7%)

Query: 18  GVLLITASMVAYWKRD---SKTFLSANGTQKAIPLAFNFVASGLGCGVLSTYPQIANLDG 74
           G++++T  ++  ++++   ++ F +A  + K   +A   V+S + C  L T       DG
Sbjct: 26  GMMVLTTYLLKRYQKEIITAEEFTTAGRSVKTGLVAAAVVSSWIWCSTLLTSSTKEYADG 85

Query: 75  LHGLLVYALAGGLPMFVFAFLGPLIRKKTPSGFVLTEWVFHRFGLLCG----WYLSACTI 130
           + G   YA      +  FA L    ++  P+     E V  R+G +      +Y  A  I
Sbjct: 86  IFGGYAYAAGACFQIIAFAILAIKTKQMAPNAHTYLELVRTRYGKIGHGCYLFYAIATNI 145

Query: 131 LTVYLFLVSEVASLKYAIDTLTNINSLPVIIIECVVTTIYTSIGGFHISFMTDSLQVSIV 190
           L   + L S  A        LT +N++    +  V   +YT  GG   +F+TD +   ++
Sbjct: 146 LVTSMLLTSGSA----VFSDLTGMNTIASCFLLPVGVVVYTLFGGIKATFLTDYMHTCVI 201

Query: 191 FILLVIVAAAMGSRIHIDRDLIGPSG 216
            I++++ A     +++   D++G  G
Sbjct: 202 IIIVLVFAF----KVYATSDVLGSPG 223

>Kwal_14.803
          Length = 693

 Score = 36.2 bits (82), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 78/189 (41%), Gaps = 33/189 (17%)

Query: 91  VFAFLGPLIRKKTPSGFVLTEWVFHRFGLLCGWYLSACTILTVYLFLVSEVASLKYAIDT 150
           V A LG   +KK P G    E V  R+G        +  IL ++L LV+ + S    I  
Sbjct: 107 VMALLGIHAKKKIPKGHTCLEIVHLRYG-------KSTHILYMFLCLVNNLLSTSAMILA 159

Query: 151 LTNINSLPVIIIECVVTTI--------YTSIGGFHISFMTDSLQVSIVFILLVIVAAAMG 202
                S+    +  V +T+        YT +GG   +F+TD +   I   +LV +  A+ 
Sbjct: 160 AAGAISIICGDLHIVASTMLIPFGVMAYTVVGGLKATFLTDYVHSLIALAILVYINTAVI 219

Query: 203 SRIHID-----RDLI---GPSGLLKGNKLGWQLVYILTVAIF------TNDFFM----SG 244
           +  HI       DL+     S  ++GN  G  L      AIF        DF +    S 
Sbjct: 220 NSEHIGGIGGLYDLVLKQDSSRYIEGNYKGSFLTGKSQGAIFFGIIHCIGDFGLTVMDSS 279

Query: 245 FWLRTFASR 253
           FW ++F++ 
Sbjct: 280 FWQKSFSAN 288

>KLLA0F28083g complement(2594274..2596370) similar to
           ca|CA5245|CaDUR32 Candida albicans Urea transport
           protein (by homology), start by similarity
          Length = 698

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 75/297 (25%), Positives = 119/297 (40%), Gaps = 57/297 (19%)

Query: 93  AFLGPLIRKKTPSGFVLTEWVFHRFGLLCGWYLSACTILTVYLFLVSEVASLKYAIDTLT 152
           A LG   +KK P+G    E V  R+G        +  IL +++ LV+ + S    I  L 
Sbjct: 109 ALLGIQAKKKIPNGHTCLEIVELRYG-------KSAHILYMFMCLVNNLLSSSSMI--LG 159

Query: 153 NINSLPVII--IECVVTTI--------YTSIGGFHISFMTDSLQVSIVFILLVIVAAAMG 202
           +  ++ +I   +  V +T+        YT +GG   +F+TD +   I  I+LV    A+ 
Sbjct: 160 SAAAISIISGNLHIVASTMLIPFGVMCYTVVGGLKATFLTDYMHSLIALIILVYFNTAV- 218

Query: 203 SRIHIDRDLIGP-SGL------------LKGNKLGWQLVYILTVAIF------TNDFFM- 242
               I  D IG  SGL            ++GN  G  L      AIF        DF + 
Sbjct: 219 ----ISSDKIGGISGLYDKVIQHEGDRYIEGNYQGSFLTGKSQGAIFFGIIHCVGDFGLT 274

Query: 243 ---SGFWLRTFASRSNKDL---LIGCSLACFILXXXXXXXXXXXXIAVWAGLLPARDQE- 295
              S FW + F++     +   LI  +L   I+            +       P   +  
Sbjct: 275 VMDSSFWQKAFSANVKASVPGYLIAAALIPAIVWPLGTIIGLSNIVLEGESFFPTYPRAM 334

Query: 296 -----NSGAAF-YLLLAQLPSWIIGFTLVFVAVLSTCTLDSLQSALVSTISNDVFRN 346
                N+G    Y L+A L    +G  L+ + +  T T+ +   A+ S IS D++RN
Sbjct: 335 TSYEINNGFGLPYTLMAVLGKSSLGGLLLAIYLAVTSTVSAQMIAVSSIISFDIYRN 391

>Kwal_33.12966
          Length = 702

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 43/192 (22%), Positives = 78/192 (40%), Gaps = 16/192 (8%)

Query: 31  KRDSKTFLSANGTQKAIPLAFNFVASGLGCGVLSTYPQIANLDGLHGLLVYALAGGLPMF 90
           K+DS+ F +A+   K   ++   V+S      L T        G+ G   Y+  G   + 
Sbjct: 75  KQDSERFTTASRNVKQGLISSAVVSSWTWPATLLTSGAWTYSYGISGAYWYSATGCFQIL 134

Query: 91  VFAFLGPLIRKKTPSGFVLTEWVFHRFGL---LCGWYLSAC---TILTVYLFLVSEVASL 144
           VF  +   I+ + P    + E    RFG     C  YL  C    ++   + L+     +
Sbjct: 135 VFTLVAIEIKLRCPGIHTIAEVAKVRFGKWGHFC--YLFYCLGTNVIVSGMILLGGSQGI 192

Query: 145 KYAIDTLTNINSLPVIIIECVVTTIYTSIGGFHISFMTDSLQVSIVFILLVIVAAAMGSR 204
            Y     T +N +    +  V   IYT  GG   +F++D     ++++++++        
Sbjct: 193 AYT----TGMNIIAACFLLPVSVCIYTLFGGLQATFLSDWSHTIVIYVMILVSVVT---- 244

Query: 205 IHIDRDLIGPSG 216
           ++   DLIG  G
Sbjct: 245 VYGTSDLIGSPG 256

>KLLA0C18909g complement(1676552..1678630) similar to
           ca|CA4384|CaDUR34 Candida albicans Urea transport
           protein (by homology), start by similarity
          Length = 692

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 29/134 (21%), Positives = 56/134 (41%), Gaps = 22/134 (16%)

Query: 74  GLHGLLVYALAGGLPMFVFAFLGPLIRKKTPSGFVLTEWVFHRFG-----------LLCG 122
           G+ G   YA+ G + + VF+ +   ++          E  + RFG           ++C 
Sbjct: 83  GISGSYFYAVGGLIQVSVFSIVASKVKANANLVTTFPEAGYLRFGNAGHLAFLWCGMVCN 142

Query: 123 WYLSACTILTVYLFLVSEVASLKYAIDTLTNINSLPVIIIECVVTTIYTSIGGFHISFMT 182
             +SAC +L                I+ +T +N+   + +  +V  IY   GG   +F++
Sbjct: 143 TIVSACILL-----------GGAAVINAITGMNTYAALYLLPLVCAIYVYFGGLRATFIS 191

Query: 183 DSLQVSIVFILLVI 196
           D+L    + + L+I
Sbjct: 192 DALHTFPLLVFLII 205

>Kwal_26.8136
          Length = 721

 Score = 33.5 bits (75), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 70/173 (40%), Gaps = 10/173 (5%)

Query: 17  YGVLLITASMVAYWKR--DSKTFLSANGTQKAIPLAFNFVASGLGCGVLSTYPQIANLDG 74
           +G++L T  +  Y K    ++ F +A  T K   +A   V+S      L     +    G
Sbjct: 26  FGMILTTYMLRRYQKEIITAEEFATAGRTVKTGLIAAAVVSSWTWAATLLESTSMVYKVG 85

Query: 75  LHGLLVYALAGGLPMFVFAFLGPLIRKKTPSGFVLTEWVFHRFG----LLCGWYLSACTI 130
           + G   Y       +  FA L    +++ P+     E +  R+G    +   +Y  A  I
Sbjct: 86  ISGGYYYGAGACFQIIAFATLAIKAKQRAPNAHTFLEIINARYGKAAHICYMFYALATNI 145

Query: 131 LTVYLFLVSEVASLKYAIDTLTNINSLPVIIIECVVTTIYTSIGGFHISFMTD 183
           L   + L    A     ++ LT ++++    +  +   IYT  GG   +F+TD
Sbjct: 146 LVTAMLLTGGSA----VVNDLTGMDTVAACFLLPLGVIIYTLFGGIKATFLTD 194

>KLLA0C17468g complement(1532768..1534939) similar to sp|P33413
           Saccharomyces cerevisiae YHL016c DUR3 urea transport
           protein singleton, start by similarity
          Length = 723

 Score = 33.1 bits (74), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 50/114 (43%), Gaps = 8/114 (7%)

Query: 74  GLHGLLVYALAGGLPMFVFAFLGPLIRKKTPSGFVLTEWVFHRFGLL---C-GWYLSACT 129
           G+ G   YA   G  + +F+ L    +++ P+     E +  R+G +   C  +Y  A  
Sbjct: 85  GISGGYFYAAGAGYQVILFSALAIKCKQRAPNAHTYLEIIKARYGTIGHFCYMFYALATN 144

Query: 130 ILTVYLFLVSEVASLKYAIDTLTNINSLPVIIIECVVTTIYTSIGGFHISFMTD 183
           +L   + L    A     +  LT ++++    +  V   +YT  GG   +F+TD
Sbjct: 145 VLVTAMLLTGGSA----VVSDLTGMHTVAACFLLPVGVVLYTIFGGIKATFLTD 194

>Sklu_2444.8 , Contig c2444 22738-24825 reverse complement
          Length = 695

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 53/134 (39%), Gaps = 22/134 (16%)

Query: 74  GLHGLLVYALAGGLPMFVFAFLGPLIRKKTPSGFVLTEWVFHRFGLL-----------CG 122
           G+ G  +YA+ G + + VF+ +   ++          E  F RFG L           C 
Sbjct: 83  GVSGGYLYAVGGFIQVSVFSVVASKVKANANLVTTFPEAGFLRFGALGHLSFLWCGIVCN 142

Query: 123 WYLSACTILTVYLFLVSEVASLKYAIDTLTNINSLPVIIIECVVTTIYTSIGGFHISFMT 182
             +SAC +L                I+ LT +N    + +   V  IY   GG   +F++
Sbjct: 143 TIVSACILL-----------GGAAVINALTGMNIYAALYLLPFVCAIYVYFGGLRATFIS 191

Query: 183 DSLQVSIVFILLVI 196
           D+     + + L+I
Sbjct: 192 DASHTFPLLVFLII 205

>ABR043W [634] [Homologous to ScYHL016C (DUR3) - SH]
           complement(474297..476357) [2061 bp, 686 aa]
          Length = 686

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 83/207 (40%), Gaps = 23/207 (11%)

Query: 1   MGHLSIP----AAHAIIWPTYGVLLITASMVAY----WKRD---SKTFLSANGTQKAIPL 49
           M HL+ P      +AI+     V  I   M  Y    ++R+   ++ F +A  T K   +
Sbjct: 1   MDHLNPPLSQGVGYAIVVGLGAVFAIGMVMTTYIFERYQREVITAEEFATARRTVKTGLI 60

Query: 50  AFNFVASGLGCGVLSTYPQIANLDGLHGLLVYALAGGLPMFVFAFLGPLIRKKTPSGFVL 109
           A   V+S            +A   G+ G   YA    + + +F+ L    +++ P+    
Sbjct: 61  ASAVVSSWTWQPRYCQSTTMAYKVGVSGPFYYAAGACVQIILFSTLAIKCKQRAPNAHTF 120

Query: 110 TEWVFHRFGL------LCGWYLSACTILTVYLFLVSEVASLKYAIDTLTNINSLPVIIIE 163
            E +  R+G       +C   ++   + T+ L   S V S    + T      LPV +I 
Sbjct: 121 LEIIKARYGRKAHILHMCYALVTNVLVTTMLLTGGSAVVSELTGMHTAAACFLLPVGVI- 179

Query: 164 CVVTTIYTSIGGFHISFMTDSLQVSIV 190
                IYT  GG   +F+TD +   I+
Sbjct: 180 -----IYTLFGGIKATFLTDYVHTVII 201

>Scas_709.61
          Length = 738

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 72/176 (40%), Gaps = 10/176 (5%)

Query: 17  YGVLLITASMVAYWKR--DSKTFLSANGTQKAIPLAFNFVASGLGCGVLSTYPQIANLDG 74
           +G++LIT  +  Y K    ++ F +A  T K   +A   V+S +    L T        G
Sbjct: 26  FGMVLITYMLRRYQKEIITAEEFTTAGRTVKTGLVAAAVVSSWIWASTLLTSVSKQYTGG 85

Query: 75  LHGLLVYALAGGLPMFVFAFLGPLIRKKTPSGFVLTEWVFHRFG----LLCGWYLSACTI 130
           + G   Y+      +  FA +    ++K P+     E V  R+G    L   +Y  A  I
Sbjct: 86  MFGGYSYSAGACFQIIAFAIIAIKTKQKAPNAHTYLEIVKARYGTPGHLTFLFYALATNI 145

Query: 131 LTVYLFLVSEVASLKYAIDTLTNINSLPVIIIECVVTTIYTSIGGFHISFMTDSLQ 186
           L   + L S  A        +T ++ +    +  V   +YT  GG   +F+TD L 
Sbjct: 146 LVTAMLLTSGSA----VFSDITGMSPIASCFLLPVGVVVYTLFGGIKATFLTDYLH 197

>CAGL0H08778g 854147..857344 some similarities with tr|Q12221
           Saccharomyces cerevisiae YPR042c PUF2 or sp|P47135
           Saccharomyces cerevisiae YJR091c JSN1, hypothetical
           start
          Length = 1065

 Score = 30.0 bits (66), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 5/62 (8%)

Query: 119 LLCGWYLSACTILTVYLFLVSE-----VASLKYAIDTLTNINSLPVIIIECVVTTIYTSI 173
           LL  WYL +CT    Y  ++S      V    + + +LT +  L + I +CV  +I T+I
Sbjct: 782 LLVTWYLDSCTFEEKYAMIISSLIPHIVELCSHRLGSLTVLKLLNLRIDQCVKDSILTAI 841

Query: 174 GG 175
            G
Sbjct: 842 FG 843

>Scas_686.7
          Length = 389

 Score = 29.6 bits (65), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 2/26 (7%)

Query: 488 FHRTCNKLGQVTGITRLYHFVNYWDS 513
           FH+T  KLG+V  IT L  F  YWD+
Sbjct: 278 FHKT--KLGKVVRITNLNDFAPYWDT 301

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.326    0.141    0.442 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,853,195
Number of extensions: 547507
Number of successful extensions: 1742
Number of sequences better than 10.0: 20
Number of HSP's gapped: 1745
Number of HSP's successfully gapped: 20
Length of query: 550
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 443
Effective length of database: 12,891,983
Effective search space: 5711148469
Effective search space used: 5711148469
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 64 (29.3 bits)